7h-pyrrolo[2,3-d]pyrimidine derivatives as cyclin-dependent kinase inhibitors useful for the treatment of cancer

7H-pyrrolo[2,3-d]pyrimidine derivatives provide a solution to the limitations of current CDK4/6 inhibitors by offering selective CDK4 inhibition and significant CDK2 activity, enhancing cancer treatment efficacy and safety.

WO2026003749A1PCT designated stage Publication Date: 2026-01-02NOVARTIS AG
View PDF 3 Cites 0 Cited by

Patent Information

Application Number
PCT/IB2025/056453
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2025-06-02
Filing Date
2025-06-25
Publication Date
2026-01-02

AI Technical Summary

Technical Problem

Current CDK4/6 inhibitors used in cancer treatment face challenges such as resistance, toxicity, particularly neutropenia, and lack of targeted therapy for CDK2 dysregulation in various cancers, necessitating a compound with improved selectivity and efficacy.

Method used

Development of 7H-pyrrolo[2,3-d]pyrimidine derivatives that act as potent and selective CDK4 inhibitors, with minimal CDK6 and CDK1 inhibition, and significant CDK2 inhibitory activity, offering improved safety profiles and pharmacokinetics.

Benefits of technology

The compounds demonstrate enhanced efficacy in cancer treatment by minimizing side effects and improving therapeutic indices, as evidenced by safety in hematotoxicity assays and favorable pharmacokinetic properties.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000003_0001
    Figure IMGF000003_0001
  • Figure IMGF000004_0001
    Figure IMGF000004_0001
  • Figure IMGF000004_0002
    Figure IMGF000004_0002
Patent Text Reader

Abstract

The invention relates to compounds which inhibit Cyclin-Dependent Kinases such as CDK2 (Cyclin-Dependent Kinase 2 or Cell Division protein Kinase 2) and CDK4 (Cyclin-Dependent Kinase 4 or Cell Division protein Kinase 4), and to processes for the preparation of said compounds, pharmaceutical compositions comprising said compounds, and use of said compounds in the treatment of conditions, diseases and disorders mediated by CDK2 and / or CDK4.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] 7H-PYRROLO[2,3-D]PYRIMIDINE DERIVATIVES AS CYCLIN-DEPENDENT

[0002] KINASE INHIBITORS USEFUL FOR THE TREATMENT OF CANCER

[0003] FIELD OF THE INVENTION

[0004] The invention relates to compounds which inhibit Cyclin-Dependent Kinases such as CDK2 (Cyclin-Dependent Kinase 2 or Cell Division protein Kinase 2) and CDK4 (Cyclin-Dependent Kinase 4 or Cell Division protein Kinase 4), and to processes for the preparation of said compounds, pharmaceutical compositions comprising said compounds, and use of said compounds in the treatment of conditions, diseases and disorders mediated by CDK2 and / or CDK4.

[0005] BACKGROUND OF THE INVENTION

[0006] CDK4 is a serine / threonine kinase that acts as a key regulator of the G1 checkpoint of the cell cycle. Upon binding to cyclin D, CDK4 becomes active and phosphorylates the retinoblastoma protein, leading to its inactivation and de-repression of the E2F family of transcription factors. The E2F transcription factors then go on transcribe genes that drive the progression from the G1 phase to the S phase of the cell cycle. This critical role in regulation of cell proliferation underlies the well-established roles of CDK4 in different cancer types. In ER+ breast cancer, small molecule inhibitors like ribociclib that target CDK4 and CDK6 have become the standard of care in combination with anti-estrogens. While these inhibitors have demonstrated an overall survival benefit, they are limited by the resistance and toxicity, most notably neutropenia. A series of studies in mice as well as human cells suggest that CDK4 is the primary driver of cell cycle progression in ER+ BrCa cells and that CDK6 is the primary driver of neutropenia.

[0007] Therefore, an inhibitor with CDK4 over CDK6 selectivity has the potential for improving the therapeutic index. It is also necessary to minimize CDK1 activity in such inhibitors, as CDK1 is essential to the cell cycle.

[0008] CDK2 is a serine / threonine kinase that regulates the mammalian cell cycle. After binding to cyclin- E1 , cyclin-E2, cyclin-A1 or cyclin-A2, the activated CDK2-cyclin complex phosphorylates a variety of cellular substrates. For example, it phosphorylates and inactivates the retinoblastoma protein (pRB), thus de-represses the E2F family of transcription factors that promotes expression of cell cycle related genes. As such, CDK2 propels the cell from the G1 phase into S phase of the cell cycle, when nuclear DNA is replicated in preparation of mitosis. CDK2 and its activity are often dysregulated in human cancers. One such dysregulation mechanism involves, but not limited to, the amplification or overexpression of cyclin-E1 , which leads to hyperactivation of CDK2 and promotes cellular proliferation. Depending on lineage, dysregulation of CDK2 / E occurs in up to 40% of human cancers (cbioportal.org), including but not limited to uterine carcinosarcoma (~40%) ovarian (~20%), gastric (~12%), esophageal (~10%), endometrial (~10%), and breast cancers (~10%). Cyclin-E1 amplification and overexpression is also associated with poor prognosis across cancers. In many of these cancers, besides radiation and chemotherapy, there is no targeted therapy available to patients.

[0009] In addition to the above mentioned selectively for CDK4 over CDK6, a compound which also inhibits CDK2 is predicted to have greater efficacy on cancer cells.

[0010] Commercially marketed dual CDK4 / 6 inhibitors known in the art include: Tuojie Biotech discloses dual CDK4 / 6 inhibitors such as

[0011] (CN114790206).

[0012] Pfizer ( . Med. Chem. 2021 , 64, 13, 9056-9077) have disclosed a clinical candidate, PF-

[0013] 06873600, having the structure , which they describe as a triple CDK2 / 4 / 6 inhibitor.

[0014] W02020 / 140052 discloses CDK inhibitors such as

[0015] WO2023 / 147372 discloses CDK inhibitors such

[0016] SUMMARY OF INVENTION There is a need to provide a CDK2 / 4 inhibitor compound with improved properties and profile, including optimal efficacy and pharmacokinetics, and low toxicity. Furthermore, the compound must possess favourable physicochemical characteristics to enable formulation and manufacture at scale. Designing a compound that can deliver such an improved overall properties and profile is highly challenging.

[0017] The applicant has surprisingly found that compounds of formula (I) as described herein, are potent CDK4 inhibitors, selective for CDK4 over CDK6, and highly selective for CDK4 over CDK1. The applicant has therefore solved the problem of providing compounds with minimal CDK1 inhibition, and reduced CDK6 inhibition. It is necessary for the compound to also have significant CDK2 inhibitory activity.

[0018] Further, compounds of formula (I) as described herein show excellent safety profile in a CD34+ in-vitro hematotoxicity assay, which has been proposed as a predictive surrogate for hematological toxicity in patients (Boiron et al. 2006 Transfusion 46; Aprikyan et al. Blood 97(1)) and in certain embodiments excellent solubility and pharmacokinetics (PK) I pharmacodynamics (PD).

[0019] As such, according to a first aspect of the invention, there is hereby provided a compound according to formula (I): wherein:

[0020] A1is selected from bond, -CR4aR4b- and -CH2-CR4aR4b-*, wherein * denotes the point of connection to A2;

[0021] A2is NR5or CH(OH);

[0022] R1is selected from H, Ci-C4alkyl, Ci-C4haloalkyl, C3-C4cycloalkyl, C3-C4cyclohaloalkyl, C=C-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 R1 bgroups; each R1ais independently selected from H and Ci-C4alkyl; each R1 bis independently selected from halo, Ci-C4alkyl, and Ci-C4haloalkyl; R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-C4haloalkyl, O-Ci-C4alkyl, and O-Ci- C4haloalkyl;

[0023] R2ais H or halo; or

[0024] R2and R2ajoin together with the carbon atom to which they are attached to form C3- C4cycloalkyl or C3-C4cyclohaloalkyl;

[0025] R3is selected from H, halo, Ci-C4alkyl, and Ci-C4haloalkyl;

[0026] R4ais H or Ci-C4alkyl;

[0027] R4bis H or Ci-C4alkyl; or

[0028] R3and R4ajoin together to form a -CH2CH2- bridge and R4bis H or Ci-C4alkyl;

[0029] R5is H or Ci-C4alkyl;

[0030] R6is H or fluoro;

[0031] R7and R8are both H; or

[0032] R7and R8join together to form a -CH2CH2- bridge;

[0033] R9is selected from Ci-C4alkyl, C3-C4cycloalkyl, and NH-Ci-C4alkyl;

[0034] X is CH or N; and

[0035] Y is C, Z is N and W is CH; or

[0036] Y is N, Z is C and W is N, or a pharmaceutically acceptable salt thereof.

[0037] According to a second aspect of the invention, there is hereby provided a compound according to any one of the Examples.

[0038] According to a third aspect of the invention, there is hereby provided a compound according to any one of the synthetic intermediates described herein. According to a fourth aspect of the invention, there is hereby provided a pharmaceutical composition comprising the compound or pharmaceutically acceptable salt according to the first or the second aspect of the invention and one or more pharmaceutically acceptable carriers.

[0039] According to a fifth aspect of the invention, there is hereby provided a combination comprising the compound or pharmaceutically acceptable salt thereof according to the first or the second aspect of the invention, and one or more therapeutically active agents.

[0040] According to a sixth aspect of the invention, there is hereby provided a method of modulating CDK4 activity in a subject comprising administering to the subject a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to the first or the second aspect of the invention.

[0041] According to a seventh aspect of the invention, there is hereby provided a method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the compound or pharmaceutically acceptable thereof according to the first or the second aspect of the invention.

[0042] According to an eighth aspect of the invention, there is hereby provided a compound or pharmaceutically acceptable salt thereof according to the first or the second aspect of the invention for use as a medicament.

[0043] According to a ninth aspect of the invention, there is hereby provided a compound or pharmaceutically acceptable salt thereof according to the first or the second aspect of the invention for use in the treatment of cancer.

[0044] According to a tenth aspect of the invention, there is hereby provided use of the compound or pharmaceutically acceptable salt thereof according to the first or the second aspect of the invention in the treatment of cancer.

[0045] According to an eleventh aspect of the invention, there is hereby provided use of the compound or pharmaceutically acceptable salt thereof according to the first or the second aspect of the invention in the manufacture of a medicament for the treatment of cancer.

[0046] BRIEF DESCRIPTION OF THE DRAWINGS

[0047] Figure 1 : Shows a comparison of IV (intravenous administration) and PO (oral administration) profiles of Example 36 and Compound B in mice. Figure 2: Shows a comparison of IV (intravenous administration) and PO (oral administration) profiles of Example 5 and Compound B in mice.

[0048] DETAILED DESCRIPTION OF THE INVENTION

[0049] The invention therefore, in a first aspect, provides a compound according to formula (I): wherein:

[0050] A1is selected from bond, -CR4aR4b- and -CH2-CR4aR4b-*, wherein * denotes the point of connection to A2;

[0051] A2is NR5or CH(OH);

[0052] R1is selected from H, Ci-C4alkyl, Ci-C4haloalkyl, C3-C4cycloalkyl, C3-C4cyclohaloalkyl, CnC-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 R1 bgroups; each R1ais independently selected from H and Ci-C4alkyl; each R1 bis independently selected from halo, Ci-C4alkyl, and Ci-C4haloalkyl;

[0053] R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-C4haloalkyl, O-Ci-C4alkyl, and O-Ci- C4haloalkyl;

[0054] R2ais H or halo; or R2and R2ajoin together with the carbon atom to which they are attached to form C3- C4cycloalkyl or C3-C4cyclohaloalkyl;

[0055] R3is selected from H, halo, Ci-C4alkyl, and Ci-C4haloalkyl;

[0056] R4ais H or Ci-C4alkyl;

[0057] R4bis H or Ci-C4alkyl; or

[0058] R3and R4ajoin together to form a -CH2CH2- bridge and R4bis H or Ci-C4alkyl;

[0059] R5is H or Ci-C4alkyl;

[0060] R6is H or fluoro;

[0061] R7and R8are both H; or

[0062] R7and R8join together to form a -CH2CH2- bridge;

[0063] R9is selected from Ci-C4alkyl, C3-C4cycloalkyl, and NH-Ci-C4alkyl;

[0064] X is CH or N; and

[0065] Y is C, Z is N and W is CH; or

[0066] Y is N, Z is C and W is N, or a pharmaceutically acceptable salt thereof.

[0067] In an embodiment, R1is selected from H, Ci-C4haloalkyl, C3-C4cycloalkyl, C3-C4cyclohaloalkyl, C=C-R1a, C(=O)N(R1a)2, and 5-6 (e.g. 5) membered heteroaryl comprising 1 to 4 (e.g. 1 to 3, e.g.

[0068] 1 or 2, e.g. 1) heteroatom(s) independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 (e.g. 0-3, e.g. 0-2, e.g. 0 or 1) R1bgroups.

[0069] In an embodiment, R1is H.

[0070] In an embodiment, R1is selected from Ci-C4alkyl, Ci-C4haloalkyl, C3-C4cycloalkyl, C3- C4cyclohaloalkyl, C=C-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 R1 bgroups. In an embodiment, R1is Ci-C4alkyl.

[0071] In an embodiment, R1is CH3.

[0072] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (la): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined above.

[0073] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (1 a- 1): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined above. In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (1 a- wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined above.

[0074] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (la- 3): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined above.

[0075] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (1 a- 4): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined above.

[0076] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (1 a- 5): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined above.

[0077] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (lb): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9and X are as defined above.

[0078] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ib-

[0079] 1): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined above.

[0080] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ib-

[0081] 2): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined above.

[0082] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ib-

[0083] 3): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9and X are as defined above.

[0084] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ib- 4): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined above.

[0085] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ib- 5): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined above.

[0086] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ic): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8and R9are as defined above.

[0087] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ic-

[0088] 1): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in above.

[0089] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ic-

[0090] 2): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in above.

[0091] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ic-

[0092] 3): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8and R9are as defined above.

[0093] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ic- 4): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in above.

[0094] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Ic- 5): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in above.

[0095] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Id): wherein A1, R1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined above.

[0096] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Id-

[0097] 1): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined above.

[0098] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Id-

[0099] 2): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined above.

[0100] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Id-

[0101] 3): wherein A1, R1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined above.

[0102] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Id- 4): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined above.

[0103] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Id- 5): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined above.

[0104] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (le): wherein A2, R1, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined above.

[0105] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (le- wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined above.

[0106] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (le- wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined above.

[0107] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (le- 3): wherein A2, R1, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined above.

[0108] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (le- wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined above.

[0109] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (le-

[0110] 5): wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined above.

[0111] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (If): wherein R1, R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined above.

[0112] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (If- wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined above.

[0113] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (If- 2): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined above.

[0114] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (If- 3): wherein R1, R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined above.

[0115] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (If- 4): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined above.

[0116] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (If- 5): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined above.

[0117] In an embodiment, R3is selected from H, halo, Ci-C4alkyl and Ci-C4haloalkyl, R4ais H or Ci- C4alkyl and R4bis H or Ci-C4alkyl.

[0118] In an embodiment, R3is H or Ci-C4haloalkyl.

[0119] In an embodiment, R3is H or CF3. In an embodiment, R3is H. In an embodiment, R4ais H or CH3.

[0120] In an embodiment, R4ais H.

[0121] In an embodiment, R4bis H or CH3.

[0122] In an embodiment, R4bis H. In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (II): wherein R1, R2, R2a, R5, R6, R7, R8and R9are as defined above.

[0123] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (II- a): wherein R2, R2a, R5, R6, R7, R8and R9are as defined above. In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (II- b): wherein R2, R2a, R5, R6, R7, R8and R9are as defined above.

[0124] In an embodiment, R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R2ais H or halo. In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (II- c): wherein R1, R2, R2a, R5, R6, R7, R8and R9are as defined above.

[0125] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Il wherein R2, R2a, R5, R6, R7, R8and R9are as defined in above. in an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (II- e): wherein R2, R2a, R5, R6, R7, R8and R9are as defined in above. In an embodiment, R2ais H or fluoro.

[0126] In an embodiment, R2ais H.

[0127] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (III): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0128] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, R7, R8and R9are as defined above.

[0129] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (III- (lll-a), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0130] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined above.

[0131] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (III- b): (lll-b), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0132] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined above.

[0133] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (III- c): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, C

[0134] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, R7, R8and R9are as defined above.

[0135] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (III- (lll-d), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0136] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined above.

[0137] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (III- e): (lll-b), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0138] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined above.

[0139] In an embodiment, R7and R8are both H.

[0140] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (IV): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0141] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, and R9are as defined above.

[0142] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (IV- a):

[0143] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (IV- b):

[0144] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (IV- c): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0145] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, and R9are as defined above.

[0146] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (IV- d):

[0147] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (IV- e):

[0148] In an embodiment, R6is fluoro.

[0149] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (V): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0150] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5and R9are as defined above.

[0151] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (V- a):

[0152] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (V- b):

[0153] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (V- c): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, C

[0154] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5and R9are as defined above.

[0155] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (V- d):

[0156] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (V- e):

[0157] In an embodiment, R2is selected from H, fluoro, hydroxyl, OCH2CH3, OCHF2, OCH2F, OCH3and CH3.

[0158] In an embodiment, R2is fluoro.

[0159] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (VI): wherein R1, R5, and R9are as defined above.

[0160] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (VI- a): wherein R5and R9are as defined above. In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (VI- b): wherein R5and R9are as defined above.

[0161] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (VI- wherein R1, R5, and R9are as defined above. In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (Vici): wherein R5and R9are as defined above.

[0162] In an embodiment, the compound or pharmaceutically acceptable salt thereof has a formula (VI- e): wherein R5and R9are as defined above.

[0163] In an embodiment, R1is selected from H, Ci-C4alkyl, cyclopropyl, C CHC-CH3, C(=O)N(CH3)2 and

[0164] In an embodiment, R1is H or Ci-C4alkyl. In an embodiment, R1is H.

[0165] In an embodiment, R1is Ci-C4alkyl.

[0166] In an embodiment, R1is CH3.

[0167] In an embodiment, R5is selected from H, CH3and CH2CH3.

[0168] In an embodiment, R5is H or CH3. In an embodiment, R5is H.

[0169] In an embodiment, R5is CH3. In an embodiment, R9is CH3, cyclopropyl or NHCH3.

[0170] In an embodiment, R9is CH3or cyclopropyl.

[0171] In an embodiment, R9is CH3.

[0172] In an embodiment, R9is cyclopropyl.

[0173] According to an aspect of the invention, the compound or pharmaceutically acceptable salt thereof is selected from:

[0174] 1) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0175] 2) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0176] 3) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0177] 4) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0178] 5) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0179] 6) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0180] 7) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0181] 8) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0182] 9) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0183] 10) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0184] 11 ) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine; 12) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0185] 13) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0186] 14) 6-ethyl-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0187] 15) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0188] 16) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0189] 17) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0190] 18) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0191] 19) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0192] 20) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0193] 21) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0194] 22) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0195] 23) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0196] 24) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0197] 25) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-6-ethyl-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 26) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0198] 27) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0199] 28) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0200] 29) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0201] 30) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0202] 31 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0203] 32) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0204] 33) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1- methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0205] 34) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0206] 35) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-aminef;

[0207] 36) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0208] 37) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0209] 38) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0210] 39) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 40) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0211] 41) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0212] 42) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0213] 43) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1- methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0214] 44) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0215] 45) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0216] 46) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0217] 47) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0218] 48) (3R,4S)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0219] 49) (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0220] 50) (3R,4S)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-6-methyl-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0221] 51 ) (3S,4R)-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-6-methyl-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0222] 52) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-ethoxypiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0223] 53) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- (difluoromethoxy)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 54) N -((3 R ,4 R)- 1 -(cyclo propy Isu Ifo ny l)-3-fl uo ropi pe rid i n-4-y l)-7-(( 1 S,2S,3R,5R)-2-fluoro-8- azabicyclo[3.2.1]octan-3-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0224] 55) (3S,4R)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;

[0225] 56) (3R,4S)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;

[0226] 57) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- (fluoromethoxy)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0227] 58) 7-((3S,4S)-3-(difluoromethoxy)piperidin-4-yl)-N-((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0228] 59) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-methoxypiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0229] 60) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-methoxy-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0230] 61 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-(piperazin-1 -yl)pyrrolo[2, 1 - f][ 1 ,2,4]triazin-2-amine;

[0231] 62) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((1 S,2S,3R,5R)-2-fluoro-8- methyl-8-azabicyclo[3.2.1]octan-3-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0232] 63) 6-cyclopropyl-N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0233] 64) (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-yl)amino)-N-methylpiperidine-1 -sulfonamide;

[0234] 65) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((R)-5-azaspiro[2.5]octan-8-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0235] 66) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((S)-5-azaspiro[2.5]octan-8-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0236] 67) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-1-((3S,4R)-3-fluoropiperidin-4- yl)-1 H-pyrrolo[3,2-c]pyridin-6-amine; 68) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(4-methyl-4H-1 ,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0237] 69) 7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-N-((1 R,5S)-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0238] 70) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0239] 71) (1 S,3R,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0240] 72) (1 R,3S,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0241] 73) (1 S,3S,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0242] 74) (1 R,3R,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0243] 75) 2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-N,N-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide;

[0244] 76) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-methylpiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0245] 77) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-methylpiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0246] 78) 7-((R)-3,3-difluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0247] 79) 7-((S)-3,3-difluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0248] 80) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-4-fluoropyrrolidin-3-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0249] 81 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((2S,4S)-2- (trifluoromethyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 82) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((2R,4R)-2- (trifluoromethyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0250] 83) 7-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 84) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-

[0251] (prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; or a pharmaceutically acceptable salt thereof.

[0252] In an embodiment, the compound has the structure: pharmaceutically acceptable salt thereof. A particular advantage of this compound is surprisingly low gastrointestinal (Gl) toxicity, which could result in certain (e.g. triple) combinations being viable.

[0253] In an embodiment, the compound has the structure: ; or a pharmaceutically acceptable salt thereof.

[0254] In an embodiment, the compound has the structure: ; or a pharmaceutically acceptable salt thereof. In an embodiment, the compound has the structure: or a pharmaceutically acceptable salt thereof.

[0255] In an embodiment, the compound has the structure: acceptable salt thereof. In an embodiment, the compound has the structure: or a pharmaceutically acceptable salt thereof.

[0256] In an embodiment, the compound has the structure: ; or a pharmaceutically acceptable salt thereof. In an embodiment, the compound has the structure: or a pharmaceutically acceptable salt thereof. A particular advantage of this compound is particularly strong selectivity for CDK2 over CDK1 and CDK4 over CDK6 respectively, as well as excellent

[0257] PK properties.

[0258] According to an aspect of the invention, there is hereby provided a pharmaceutical composition comprising the compound or pharmaceutically acceptable salt thereof according to the invention and one or more pharmaceutically acceptable carriers.

[0259] According to an aspect of the invention, there is hereby provided a combination comprising the compound or pharmaceutically acceptable salt thereof according to the invention, and one or more therapeutically active agents.

[0260] According to an aspect of the invention, there is hereby provided a method of modulating CDK2 and / or CDK4 activity in a subject comprising administering to the subject a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to the invention.

[0261] According to an aspect of the invention, there is hereby provided a method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to the invention.

[0262] According to an aspect of the invention, there is hereby provided the compound or pharmaceutically acceptable salt thereof of the invention for use as a medicament.

[0263] According to an aspect of the invention, there is hereby provided the compound or pharmaceutically acceptable salt thereof of the invention for use in the treatment of cancer.

[0264] According to an aspect of the invention, there is hereby provided use of the compound or pharmaceutically acceptable salt thereof of the invention in the treatment of cancer. According to an aspect of the invention, there is hereby provided use of the compound or pharmaceutically acceptable salt thereof of the invention in the manufacture of a medicament for the treatment of cancer.

[0265] In an embodiment, the cancer is selected from breast cancer, prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer and colorectal cancer.

[0266] In an embodiment, the cancer is breast cancer.

[0267] In an embodiment, the breast cancer is ER+ breast Cancer.

[0268] In an embodiment, the breast cancer is a) HER2- breast cancer, or b) HER2+ breast cancer.

[0269] In an embodiment, the breast cancer is HER2- breast cancer.

[0270] In an embodiment, the cancer has one or more of the following features: a) CCNE1 amplification, b) CCNE2 amplification, c) CCND1 amplification, d) CDK4 amplification and e) p53 mutation.

[0271] According to an aspect of the invention, there is hereby provided a method for treating a CDK2 and / or CDK4 dependent disease or disorder or a disease or disorder that is mediated, at least in part, by CDK2 and / or CDK4, or a disease characterized by amplification or overexpression of cyclin El (CCNE1), cyclin E2 (CCNE2), CCND1 , or CDK4, or p53 mutation, in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a compound, or pharmaceutically acceptable salt thereof of the invention.

[0272] In an embodiment, the CDK2 and / or CDK4 dependent disease or disorder or the disease or disorder that is mediated, at least in part, by CDK2 and / or CDK4, is selected from breast cancer, prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer and colorectal cancer.

[0273] The invention therefore provides the following numbered embodiments. It will be recognized that features specified in each embodiment may be combined with other specified features to provide further embodiments of the present invention:

[0274] Embodiment 1 . A compound according to formula (I): wherein:

[0275] A1is selected from bond, -CR4aR4b- and -CH2-CR4aR4b-*, wherein * denotes the point of connection to A2;

[0276] A2is NR5or CH(OH);

[0277] R1is selected from H, Ci-C4alkyl, Ci-C4haloalkyl, C3-C4cycloalkyl, C3-C4cyclohaloalkyl, CnC-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 R1 bgroups; each R1ais independently selected from H and Ci-C4alkyl; each R1 bis independently selected from halo, Ci-C4alkyl, and Ci-C4haloalkyl;

[0278] R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-C4haloalkyl, O-Ci-C4alkyl, and O-Ci- C4haloalkyl;

[0279] R2ais H or halo; or

[0280] R2and R2ajoin together with the carbon atom to which they are attached to form C3- C4cycloalkyl or C3-C4cyclohaloalkyl;

[0281] R3is selected from H, halo, Ci-C4alkyl, and Ci-C4haloalkyl;

[0282] R4ais H or Ci-C4alkyl;

[0283] R4bis H or Ci-C4alkyl; or R3and R4ajoin together to form a -CH2CH2- bridge and R4bis H or Ci-C4alkyl;

[0284] R5is H or Ci-C4alkyl;

[0285] R6is H or fluoro;

[0286] R7and R8are both H; or

[0287] R7and R8join together to form a -CH2CH2- bridge;

[0288] R9is selected from Ci-C4alkyl, C3-C4cycloalkyl, and NH-Ci-C4alkyl;

[0289] X is CH or N; and

[0290] Y is C, Z is N and W is CH; or

[0291] Y is N, Z is C and W is N, or a pharmaceutically acceptable salt thereof.

[0292] Embodiment 1 a. The compound or pharmaceutically acceptable salt thereof according to embodiment 1 , wherein R1is selected from H, Ci-C4haloalkyl, C3-C4cycloalkyl, C3- C4cyclohaloalkyl, C=C-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 R1 bgroups.

[0293] Embodiment 1 b. The compound or pharmaceutically acceptable salt thereof according to Embodiment 1 a, wherein R1is H.

[0294] Embodiment 1 c. The compound or pharmaceutically acceptable salt thereof according to embodiment 1 , wherein R1is selected from Ci-C4alkyl, Ci-C4haloalkyl, C3-C4cycloalkyl, C3- C4cyclohaloalkyl, C=C-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, O and S, said 5-6 membered heteroaryl being substituted with 0-4 R1 bgroups.

[0295] Embodiment 1 d. The compound or pharmaceutically acceptable salt thereof according to Embodiment 1 c, wherein R1is Ci-C4alkyl.

[0296] Embodiment 1 e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 1 d, wherein R1is CH3. Embodiment 2. The compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 1 e, having a formula (la): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in any one of Embodiments 1 to 1e. Embodiment 2a. The compound or pharmaceutically acceptable salt thereof according to

[0297] Embodiment 2, having a formula (1 a-1 ): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in Embodiment 1.

[0298] Embodiment 2b. The compound or pharmaceutically acceptable salt thereof according to Embodiment 2, having a formula (1 a-2): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in Embodiment 1.

[0299] Embodiment 2c. The compound or pharmaceutically acceptable salt thereof according to Embodiment 2, having a formula (la-3): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in any one of Embodiments 1 to 1 e.

[0300] Embodiment 2d. The compound or pharmaceutically acceptable salt thereof according to

[0301] Embodiment 2a, having a formula (1a-4): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in Embodiment 1.

[0302] Embodiment 2e. The compound or pharmaceutically acceptable salt thereof according to

[0303] Embodiment 2b, having a formula (1a-5): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in Embodiment 1 .

[0304] Embodiment 3. The compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 1 e, having a formula (lb): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9and X are as defined in any one of Embodiments 1 to 1 e.

[0305] Embodiment 3a. The compound or pharmaceutically acceptable salt thereof according to

[0306] Embodiment 3, having a formula (lb-1 ): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined in Embodiment 1 .

[0307] Embodiment 3b. The compound or pharmaceutically acceptable salt thereof according to

[0308] Embodiment 3, having a formula (lb-2): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined in Embodiment 1 .

[0309] Embodiment 3c. The compound or pharmaceutically acceptable salt thereof according to Embodiment 3, having a formula (I b-3): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9and X are as defined in any one of Embodiments 1 to 1 e.

[0310] Embodiment 3d. The compound or pharmaceutically acceptable salt thereof according to

[0311] Embodiment 3a, having a formula (I b-4) : wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined in Embodiment 1 .

[0312] Embodiment 3e. The compound or pharmaceutically acceptable salt thereof according to

[0313] Embodiment 3b, having a formula (lb-5): wherein A1, A2, R2, R2a, R3, R6, R7, R8, R9and X are as defined in Embodiment 1

[0314] Embodiment 4. The compound or pharmaceutically acceptable salt thereof according to

[0315] Embodiment 1 , having a formula (Ic): wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8and R9are as defined in Embodiment 1 .

[0316] Embodiment 4a. The compound or pharmaceutically acceptable salt thereof according to

[0317] Embodiment 4, having a formula (lc-1): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in

[0318] Embodiment 1 .

[0319] Embodiment 4b. The compound or pharmaceutically acceptable salt thereof according to

[0320] Embodiment 4, having a formula (lc-2): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in

[0321] Embodiment 1 .

[0322] Embodiment 4c. The compound or pharmaceutically acceptable salt thereof according to

[0323] Embodiment 4, having a formula (I c-3) : wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8and R9are as defined in Embodiment 1 .

[0324] Embodiment 4d. The compound or pharmaceutically acceptable salt thereof according to

[0325] Embodiment 4a, having a formula (lc-4): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in

[0326] Embodiment 1 .

[0327] Embodiment 4e. The compound or pharmaceutically acceptable salt thereof according to

[0328] Embodiment 4b, having a formula (lc-5): wherein A1, A2, R2, R2a, R3, R6, R7, R8and R9are as defined in

[0329] Embodiment 1 .

[0330] Embodiment 5. The compound or pharmaceutically acceptable salt thereof according to

[0331] Embodiment 1 , having a formula (Id): wherein A1, R1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in Embodiment 1 .

[0332] Embodiment 5a. The compound or pharmaceutically acceptable salt thereof according to

[0333] Embodiment 5, having a formula (Id-1 ): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in

[0334] Embodiment 1 .

[0335] Embodiment 5b. The compound or pharmaceutically acceptable salt thereof according to

[0336] Embodiment 5, having a formula (Id-2): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in Embodiment 1 .

[0337] Embodiment 5c. The compound or pharmaceutically acceptable salt thereof according to

[0338] Embodiment 5, having a formula (Id-3): wherein A1, R1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in Embodiment 1 .

[0339] Embodiment 5d. The compound or pharmaceutically acceptable salt thereof according to

[0340] Embodiment 5a, having a formula (Id-4): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in

[0341] Embodiment 1 .

[0342] Embodiment 5e. The compound or pharmaceutically acceptable salt thereof according to

[0343] Embodiment 5b, having a formula (Id-5): wherein A1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in

[0344] Embodiment 1 .

[0345] Embodiment 6. The compound or pharmaceutically acceptable salt thereof according to

[0346] Embodiment 1 , having a formula (le): wherein A2, R1, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in Embodiment 1.

[0347] Embodiment 6a. The compound or pharmaceutically acceptable salt thereof according to

[0348] Embodiment 6, having a formula (le-1): wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in Embodiment 1.

[0349] Embodiment 6b. The compound or pharmaceutically acceptable salt thereof according to

[0350] Embodiment 6, having a formula (I e-2): wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in Embodiment 1.

[0351] Embodiment 6c. The compound or pharmaceutically acceptable salt thereof according to

[0352] Embodiment 6, having a formula (I e-3): wherein A2, R1, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in Embodiment 1.

[0353] Embodiment 6d. The compound or pharmaceutically acceptable salt thereof according to

[0354] Embodiment 6a, having a formula (le-4): wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in Embodiment 1.

[0355] Embodiment 6e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 6b, having a formula (le-5): wherein A2, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in Embodiment 1.

[0356] Embodiment 7. The compound or pharmaceutically acceptable salt thereof according to Embodiment 1 , having a formula (If): wherein R1, R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in Embodiment 1.

[0357] Embodiment 7a. The compound or pharmaceutically acceptable salt thereof according to

[0358] Embodiment 7, having a formula (lf-1): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in Embodiment 1.

[0359] Embodiment 7b. The compound or pharmaceutically acceptable salt thereof according to

[0360] Embodiment 7, having a formula (lf-2): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in Embodiment 1.

[0361] Embodiment 7c. The compound or pharmaceutically acceptable salt thereof according to

[0362] Embodiment 7, having a formula (lf-3): wherein R1, R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in Embodiment 1.

[0363] Embodiment 7d. The compound or pharmaceutically acceptable salt thereof according to

[0364] Embodiment 7a, having a formula (lf-4): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in Embodiment 1.

[0365] Embodiment 7e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 7b, having a formula (lf-5): wherein R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in Embodiment 1.

[0366] Embodiment 8. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R3is selected from H, halo, Ci-C4alkyl and Ci- C4haloalkyl, R4ais H or Ci-C4alkyl and R4bis H or Ci-C4alkyl.

[0367] Embodiment 9. The compound or pharmaceutically acceptable salt thereof according to Embodiment 8, wherein R3is H or Ci-C4haloalkyl. Embodiment 10. The compound or pharmaceutically acceptable salt thereof according to Embodiment 9, wherein R3is H or CF3.

[0368] Embodiment 11. The compound or pharmaceutically acceptable salt thereof according to Embodiment 10, wherein R3is H.

[0369] Embodiment 12. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R4ais H or CH3.

[0370] Embodiment 13. The compound or pharmaceutically acceptable salt thereof according to Embodiment 12, wherein R4ais H.

[0371] Embodiment 14. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R4bis H or CH3.

[0372] Embodiment 15. The compound or pharmaceutically acceptable salt thereof according to Embodiment 14, wherein R4bis H.

[0373] Embodiment 16. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, having a formula (II): wherein R1, R2, R2a, R5, R6, R7, R8and R9are as defined in

[0374] Embodiment 1 .

[0375] Embodiment 16a. The compound or pharmaceutically acceptable salt thereof according to Embodiment 16, having a formula (ll-a): wherein R2, R2a, R5, R6, R7, R8and R9are as defined in

[0376] Embodiment 1 . Embodiment 16b. The compound or pharmaceutically acceptable salt thereof according to

[0377] Embodiment 16, having a formula (ll-b): wherein R2, R2a, R5, R6, R7, R8and R9are as defined in

[0378] Embodiment 1 . Embodiment 16c. The compound or pharmaceutically acceptable salt thereof according to Embodiment 16, having a formula (ll-c): wherein R1, R2, R2a, R5, R6, R7, R8and R9are as defined in

[0379] Embodiment 1 .

[0380] Embodiment 16d. The compound or pharmaceutically acceptable salt thereof according to Embodiment 16a, having a formula (ll-d): wherein R2, R2a, R5, R6, R7, R8and R9are as defined in

[0381] Embodiment 1 .

[0382] Embodiment 16e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 16b, having a formula (ll-e): wherein R2, R2a, R5, R6, R7, R8and R9are as defined in

[0383] Embodiment 1 .

[0384] Embodiment 17. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R2ais H or halo.

[0385] Embodiment 18. The compound or pharmaceutically acceptable salt thereof according to Embodiment 17, wherein R2ais H or fluoro.

[0386] Embodiment 19. The compound or pharmaceutically acceptable salt thereof according to Embodiment 18, wherein R2ais H.

[0387] Embodiment 20. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, having a formula (III): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0388] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, R7, R8and R9are as defined in

[0389] Embodiment 1 .

[0390] Embodiment 20a. The compound or pharmaceutically acceptable salt thereof according to

[0391] Embodiment 20, having a formula (lll-a): (lll-a), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0392] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined in

[0393] Embodiment 1 .

[0394] Embodiment 20b. The compound or pharmaceutically acceptable salt thereof according to

[0395] Embodiment 20, having a formula (lll-b): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0396] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined in

[0397] Embodiment 1 .

[0398] Embodiment 20c. The compound or pharmaceutically acceptable salt thereof according to

[0399] Embodiment 20, having a formula (lll-c): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0400] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, R7, R8and R9are as defined in

[0401] Embodiment 1 .

[0402] Embodiment 20d. The compound or pharmaceutically acceptable salt thereof according to

[0403] Embodiment 20a, having a formula (lll-d): (lll-d), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0404] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined in

[0405] Embodiment 1 .

[0406] Embodiment 20e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 20b, having a formula (lll-e): (lll-b), wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0407] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, R7, R8and R9are as defined in

[0408] Embodiment 1 .

[0409] Embodiment 21 . The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R7and R8are both H.

[0410] Embodiment 22. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, having a formula (IV): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0411] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, and R9are as defined in

[0412] Embodiment 1 . Embodiment 22a. The compound or pharmaceutically acceptable salt thereof according to

[0413] Embodiment 22, having a formula (IV-a): 1.

[0414] Embodiment 22b. The compound or pharmaceutically acceptable salt thereof according to Embodiment 22, having a formula (IV-b): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0415] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, and R9are as defined in Embodiment 1.

[0416] Embodiment 22c. The compound or pharmaceutically acceptable salt thereof according to Embodiment 22, having a formula (IV-c): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0417] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5, R6, and R9are as defined in Embodiment 1 . Embodiment 22d. The compound or pharmaceutically acceptable salt thereof according to

[0418] Embodiment 22a, having a formula (IV-d): 1.

[0419] Embodiment 22e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 22b, having a formula (IV-e): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0420] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5, R6, and R9are as defined in Embodiment 1.

[0421] Embodiment 23. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R6is fluoro.

[0422] Embodiment 24. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, having a formula (V):

[0423] wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0424] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5and R9are as defined in Embodiment 1.

[0425] Embodiment 24a. The compound or pharmaceutically acceptable salt thereof according to Embodiment 24, having a formula (V-a): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0426] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5and R9are as defined in Embodiment 1.

[0427] Embodiment 24b. The compound or pharmaceutically acceptable salt thereof according to

[0428] Embodiment 24, having a formula (V-b): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0429] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5and R9are as defined in Embodiment 1.

[0430] Embodiment 24c. The compound or pharmaceutically acceptable salt thereof according to

[0431] Embodiment 24, having a formula (V-c): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0432] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R1, R5and R9are as defined in Embodiment

[0433] 1.

[0434] Embodiment 24d. The compound or pharmaceutically acceptable salt thereof according to Embodiment 24a, having a formula (V-d): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0435] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5and R9are as defined in Embodiment 1.

[0436] Embodiment 24e. The compound or pharmaceutically acceptable salt thereof according to

[0437] Embodiment 24b, having a formula (V-e): wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-

[0438] C4haloalkyl, O-Ci-C4alkyl and 0-Ci-C4haloalkyl and R5and R9are as defined in Embodiment 1.

[0439] Embodiment 25. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R2is selected from H, fluoro, hydroxyl, OCH2CH3, OCHF2, OCH2F, OCH3 and CH3. Embodiment 26. The compound or pharmaceutically acceptable salt thereof according to

[0440] Embodiment 25, wherein R2is fluoro. Embodiment 27. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, having a formula (VI): wherein R1, R5, and R9are as defined in Embodiment 1 .

[0441] Embodiment 27a. The compound or pharmaceutically acceptable salt thereof according to Embodiment 27, having a formula (Vl-a): wherein R5and R9are as defined in Embodiment 1 .

[0442] Embodiment 27b. The compound or pharmaceutically acceptable salt thereof according to

[0443] Embodiment 27, having a formula (Vl-b): wherein R5and R9are as defined in Embodiment 1 . Embodiment 27c. The compound or pharmaceutically acceptable salt thereof according to

[0444] Embodiment 27, having a formula (Vl-c): wherein R1, R5, and R9are as defined in Embodiment 1 .

[0445] Embodiment 27d. The compound or pharmaceutically acceptable salt thereof according to

[0446] Embodiment 27a, having a formula (Vl-d): wherein R5and R9are as defined in Embodiment 1 . Embodiment 27e. The compound or pharmaceutically acceptable salt thereof according to Embodiment 27b, having a formula (Vl-e): wherein R5and R9are as defined in Embodiment 1 .

[0447] Embodiment 28. The compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18 , 19, 20, 21 , 22, 23, 24, 25, 26 and 27, wherein R1is selected from H, Ci-C4alkyl, cyclopropyl, C CHC-CH3,

[0448] Embodiment 29. The compound or pharmaceutically acceptable salt thereof according to Embodiment 28, wherein R1is H or Ci-C4alkyl. Embodiment 30. The compound or pharmaceutically acceptable salt thereof according to Embodiment 29, wherein R1is H.

[0449] Embodiment 31 . The compound or pharmaceutically acceptable salt thereof according to Embodiment 29, wherein R1is Ci-C4alkyl.

[0450] Embodiment 32. The compound or pharmaceutically acceptable salt thereof according to Embodiment 31 , wherein R1is CH3.

[0451] Embodiment 33. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R5is selected from H, CH3and CH2CH3.

[0452] Embodiment 34. The compound or pharmaceutically acceptable salt thereof according to Embodiment 33, wherein R5is H or CH3.

[0453] Embodiment 34a. The compound or pharmaceutically acceptable salt thereof according to Embodiment 34, wherein R5is H.

[0454] Embodiment 34b. The compound or pharmaceutically acceptable salt thereof according to Embodiment 34, wherein R5is CH3.

[0455] Embodiment 35. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments, wherein R9is CH3, cyclopropyl or NHCH3.

[0456] Embodiment 36. The compound or pharmaceutically acceptable salt thereof according to Embodiment 35, wherein R9is CH3or cyclopropyl.

[0457] Embodiment 36a. The compound or pharmaceutically acceptable salt thereof according to Embodiment 36, wherein R9is CH3.

[0458] Embodiment 36b. The compound or pharmaceutically acceptable salt thereof according to Embodiment 36, wherein R9is cyclopropyl.

[0459] Embodiment 37. The compound or pharmaceutically acceptable salt thereof according to Embodiment 1 , selected from:

[0460] 1) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0461] 2) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 3) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0462] 4) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0463] 5) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0464] 6) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0465] 7) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0466] 8) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0467] 9) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0468] 10) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0469] 11 ) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0470] 12) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0471] 13) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0472] 14) 6-ethyl-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0473] 15) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0474] 16) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 17) N -((3 R ,4 R)- 1 -(cyclo propy Is u Ifony l)-3-fl u o ropi pe rid i n-4-y l)-7-((3S , 4S)-3-fl uo ro- 1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0475] 18) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0476] 19) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoroazepan-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0477] 20) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0478] 21) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0479] 22) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0480] 23) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0481] 24) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0482] 25) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-6-ethyl-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0483] 26) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0484] 27) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0485] 28) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0486] 29) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0487] 30) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 31 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoroazepan-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0488] 32) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0489] 33) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1- methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0490] 34) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0491] 35) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-aminef;

[0492] 36) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0493] 37) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0494] 38) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0495] 39) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0496] 40) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin-4- yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0497] 41) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4-yl)-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0498] 42) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0499] 43) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1- methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0500] 44) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 45) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0501] 46) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0502] 47) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0503] 48) (3R,4S)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0504] 49) (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0505] 50) (3R,4S)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-6-methyl-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0506] 51 ) (3S,4R)-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-6-methyl-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1-methylpiperidin-3-ol;

[0507] 52) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-ethoxypiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0508] 53) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- (difluoromethoxy)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0509] 54) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((1 S,2S,3R,5R)-2-fluoro-8- azabicyclo[3.2.1]octan-3-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0510] 55) (3S,4R)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;

[0511] 56) (3R,4S)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;

[0512] 57) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- (fluoromethoxy)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0513] 58) 7-((3S,4S)-3-(difluoromethoxy)piperidin-4-yl)-N-((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 59) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-methoxypiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0514] 60) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-methoxy-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0515] 61 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-(piperazin-1 -yl)pyrrolo[2, 1 - f][ 1 ,2,4]triazin-2-amine;

[0516] 62) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((1 S,2S,3R,5R)-2-fluoro-8- methyl-8-azabicyclo[3.2.1]octan-3-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0517] 63) 6-cyclopropyl-N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0518] 64) (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-yl)amino)-N-methylpiperidine-1 -sulfonamide;

[0519] 65) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((R)-5-azaspiro[2.5]octan-8-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0520] 66) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((S)-5-azaspiro[2.5]octan-8-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0521] 67) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-1-((3S,4R)-3-fluoropiperidin-4- yl)-1 H-pyrrolo[3,2-c]pyridin-6-amine;

[0522] 68) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(4-methyl-4H-1 ,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0523] 69) 7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-N-((1 R,5S)-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0524] 70) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0525] 71) (1 S,3R,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0526] 72) (1 R,3S,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol; 73) (1 S,3S,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0527] 74) (1 R,3R,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;

[0528] 75) 2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-N,N-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide;

[0529] 76) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-methylpiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0530] 77) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-methylpiperidin-4-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0531] 78) 7-((R)-3,3-difluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0532] 79) 7-((S)-3,3-difluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine;

[0533] 80) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-4-fluoropyrrolidin-3-yl)- 7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0534] 81 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((2S,4S)-2- (trifluoromethyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0535] 82) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((2R,4R)-2- (trifluoromethyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0536] 83) 7-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;

[0537] 84) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4-yl)-6- (prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; or a pharmaceutically acceptable salt thereof.

[0538] Embodiment 38. The compound according to Embodiment 1 , having the structure:

[0539] pharmaceutically acceptable salt thereof. A particular advantage of this compound is surprisingly low gastrointestinal (Gl) toxicity, which could result in certain (triple) combinations being viable.

[0540] Embodiment 39. The compound according to Embodiment 1 , having the structure:

[0541] Embodiment 41 . The compound according to Embodiment 1 , having the structure: pharmaceutically acceptable salt thereof. Embodiment 42. The compound according to Embodiment 1 , having the structure: Embodiment 44. The compound according to Embodiment 1 , having the structure: antage of this compound is particularly strong selectivity for CDK2 over CDK1 and CDK4 over CDK6 respectively, as well as excellent PK properties. Embodiment 46. A pharmaceutical composition comprising the compound or pharmaceutically acceptable salt thereof according to any one of the preceding Embodiments and one or more pharmaceutically acceptable carriers.

[0542] Embodiment 47. A combination comprising the compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45, and one or more therapeutically active agents.

[0543] Embodiment 48. A method of modulating CDK2 and / or CDK4 activity in a subject comprising administering to the subject a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45.

[0544] Embodiment 49. A method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45.

[0545] Embodiment 50. The compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45 for use as a medicament.

[0546] Embodiment 51 . The compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45 for use in the treatment of cancer.

[0547] Embodiment 52. Use of the compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45 in the treatment of cancer.

[0548] Embodiment 53. Use of the compound or pharmaceutically acceptable salt thereof according to any one of Embodiments 1 to 45 in the manufacture of a medicament for the treatment of cancer.

[0549] Embodiment 54. The method according to Embodiment 49, the compound or pharmaceutically acceptable salt thereof for use according to Embodiment 51 , or the use according to Embodiment 52 or Embodiment 53, wherein the cancer is selected from breast cancer, prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer and colorectal cancer.

[0550] Embodiment 55. The method according to Embodiment 49 or Embodiment 54, the compound or pharmaceutically acceptable salt thereof for use according to Embodiment 51 or Embodiment 54, or the use according to any one of Embodiments 52 to 54, wherein the cancer is breast cancer. Embodiment 56. The method according to Embodiment 55, the compound or pharmaceutically acceptable salt thereof for use according to Embodiment 55, or the use according to Embodiment 55, wherein the breast cancer is ER+ breast Cancer.

[0551] Embodiment 57. The method according to Embodiment 55 or Embodiment 56, the compound or pharmaceutically acceptable salt thereof for use according to Embodiment 55 or Embodiment 56, or the use according to Embodiment 55 or Embodiment 56, wherein the breast cancer is a) HER2- breast cancer, or b) HER2+ breast cancer.

[0552] Embodiment 58. The method according to Embodiment 57, the compound or pharmaceutically acceptable salt thereof for use according to Embodiment 57, or the use according to Embodiment 57, wherein the breast cancer is HER2- breast cancer.

[0553] Embodiment 59. The method according to any one of Embodiments 49 and 52 to 58, the compound or pharmaceutically acceptable salt thereof for use according to any one of Embodiments 51 and 54 to 58, or the use according to any one of Embodiments 52 to 58, wherein the cancer has one or more of the following features: a) CCNE1 amplification, b) CCNE2 amplification, c) CCND1 amplification, d) CDK4 amplification and e) p53 mutation.

[0554] Embodiment 60. A method for treating a CDK2 and / or CDK4 dependent disease or disorder or a disease or disorder that is mediated, at least in part, by CDK2 and / or CDK4, or a disease characterized by amplification or overexpression of cyclin El (CCNE1), cyclin E2 (CCNE2), CCND1 , or CDK4, or p53 mutation, in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a compound, or pharmaceutically acceptable salt thereof, according to any one of Embodiments 1 to 45.

[0555] Embodiment 61 . The method according to Embodiment 60, wherein the CDK2 and / or CDK4 dependent disease or disorder or the disease or disorder that is mediated, at least in part, by CDK2 and / or CDK4, is selected from breast cancer, prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer and colorectal cancer.

[0556] Definitions

[0557] For the purpose of interpreting this specification, the following definitions will apply unless specified otherwise and when appropriate, terms used in the singular will also include the plural and vice versa. It must be noted that as used herein and in the appended claims, the singular forms "a", "an" and ’’the" include the plural unless the context clearly dictates otherwise. Thus, for example, reference to "the compound" includes reference to one or more compounds, and so forth.

[0558] As used herein, the term “substituent” refers to a radical group which replaces a hydrogen atom in a given molecule.

[0559] As used herein, the term “alkyl” refers to a straight or branched hydrocarbon chain radical consisting solely of carbon and hydrogen atoms, containing no unsaturation, and which is attached to the rest of the molecule by a single bond. For instance, Ci-C4alkyl contains from 1 to 4 carbon atoms. Examples of C1-C4alkyl include, but are not limited to, methyl (Me), ethyl (Et), n-propyl, 1 -methylethyl ( / so-propyl), n-butyl and f-butyl.

[0560] As used herein, the term “halogen”, “halo”, “hal”, etc. refers to fluorine, chlorine, bromine or iodine. Halogen-substituted groups and moieties, such as alkyl substituted by halogen (haloalky I) can be mono-, poly- or per-halogenated. Fluoro and chloro are generally preferred halo substituents.

[0561] As used herein, the term “haloalkyl” refers to an alkyl radical as defined herein, wherein one or more of the hydrogen atoms of said alkyl has been replaced with a halogen atom. Particularly said one or more halogen atom(s) are each fluorine atom(s), in which case the “haloalkyl” is a “fluoroalkyl”. For instance, Ci-C4haloalkyl contains from 1 to 4 carbon atoms (and 1 or more halogen atoms).

[0562] As used herein, the term “cycloalkyl” refers to a saturated carbocyclic ring radical. C3-C4cycloalkyl for instance, is any such ring radical containing 3 to 4 carbon atoms, and is particularly monocyclic i.e. cyclopropyl or cyclobutyl. However, the cycloalkyl (e.g. C3-C4cycloalkyl) can also be a bridged bicyclic ring system. As used herein, the term “cyclohaloalkyl” refers to a cycloalkyl radical as defined herein, wherein one or more of the hydrogen atoms of said cycloalkyl has been replaced with a halogen atom. Particularly said one or more halogen atom(s) are each fluorine atom(s), in which case the “cyclohaloalkyl” is a “cyclofluoroalkyl”. As with cycloalkyls, a halocycloalkyl can be a fused or bridged bicyclic ring system.

[0563] The term “5-6 membered heteroaryl” is a monocyclic aromatic ring radical containing 5 or 6 ring atoms which, unless otherwise stated, comprises 1 , 2, 3 or 4 heteroatoms independently selected from nitrogen, oxygen and sulfur in the ring radical.

[0564] The term “-CH2CH2- bridge” as used herein refers to two substitutents on different and non- adjacent ring atoms joining together to form -CH2CH2-. ,

[0565] Depending on the choice of the starting materials and procedures, the compounds can be present in the form of one of the possible stereoisomers or as mixtures thereof, for example as pure optical isomers, or as stereoisomer mixtures, such as racemates and diastereoisomer mixtures, depending on the number of asymmetric carbon atoms. The present invention is meant to include all such possible stereoisomers, including racemic mixtures, diasteriomeric mixtures and optically pure forms. Optically active (R)- and (S)- stereoisomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. If the compound contains a double bond, the substituent may be E or Z configuration. If the compound contains a disubstituted cycloalkyl, the cycloalkyl substituent may have a cis- or trans-configuration. All tautomeric forms are also intended to be included.

[0566] As used herein, the terms “salt” or “salts” refers to an acid addition or base addition salt of a compound of the present invention. “Salts” include in particular “pharmaceutical acceptable salts”. The term “pharmaceutically acceptable salts” refers to salts that retain the biological effectiveness and properties of the compounds of this invention and, which typically are not biologically or otherwise undesirable. In many cases, the compounds of the present invention are capable of forming acid and / or base salts by virtue of the presence of amino and / or carboxyl groups or groups similar thereto. When both a basic group and an acid group are present in the same molecule, the compounds of the present invention may also form internal salts, e.g., zwitterionic molecules.

[0567] Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids.

[0568] Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.

[0569] Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, sulfosalicylic acid, and the like.

[0570] Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.

[0571] Inorganic bases from which salts can be derived include, for example, ammonium salts and metals from columns I to XII of the periodic table. In certain embodiments, the salts are derived from sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, and copper; particularly suitable salts include ammonium, potassium, sodium, calcium and magnesium salts.

[0572] Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like. Certain organic amines include isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine and tromethamine.

[0573] In another aspect, the present invention provides compounds of the present invention in acetate, ascorbate, adipate, aspartate, benzoate, besylate, bromide / hydrobromide, bicarbonate / carbonate, bisulfate / sulfate, camphorsulfonate, caprate, chloride / hydrochloride, chlortheophyllonate, citrate, ethandisulfonate, fumarate, gluceptate, gluconate, glucuronate, glutamate, glutarate, glycolate, hippurate, hydroiodide / iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulphate, mucate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate / hydrogen phosphate / dihydrogen phosphate, polygalacturonate, propionate, sebacate, stearate, succinate, sulfosalicylate, sulfate, tartrate, tosylate trifenatate, trifluoroacetate or xinafoate salt form.

[0574] In another aspect, the present invention provides compounds of the present invention in acetate, ascorbate, adipate, aspartate, benzoate, besylate, bromide / hydrobromide, bicarbonate / carbonate, bisulfate / sulfate, camphorsulfonate, caprate, chloride / hydrochloride, chlortheophyllonate, citrate, ethandisulfonate, fumarate, gluceptate, gluconate, glucuronate, glutamate, glutarate, glycolate, hippurate, hydroiodide / iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulphate, mucate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate / hydrogen phosphate / dihydrogen phosphate, polygalacturonate, propionate, sebacate, stearate, succinate, sulfosalicylate, sulfate, tartrate, tosylate trifenatate, trifluoroacetate or xinafoate salt form.

[0575] In another aspect, the present invention provides compounds according to any one of embodiments 1 to 45, in sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, copper, isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine or tromethamine salt form.

[0576] Any formula given herein is also intended to represent unlabelled forms as well as isotopically labelled forms of the compounds. Isotopically labelled compounds have structures depicted by the formulae given herein except that one or more atoms are replaced by an atom having a selected atomic mass or mass number. Isotopes that can be incorporated into compounds of the invention include, for example, isotopes of hydrogen.

[0577] Further, incorporation of certain isotopes, particularly deuterium (i.e.,2H or D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements or an improvement in therapeutic index or tolerability. It is understood that deuterium in this context is regarded as a substituent of a compound of the present invention. The concentration of deuterium, may be defined by the isotopic enrichment factor. The term "isotopic enrichment factor" as used herein means the ratio between the isotopic abundance and the natural abundance of a specified isotope. If a substituent in a compound of this invention is denoted as being deuterium, such compound has an isotopic enrichment factor for each designated deuterium atom of at least 3500 (52.5% deuterium incorporation at each designated deuterium atom), at least 4000 (60% deuterium incorporation), at least 4500 (67.5% deuterium incorporation), at least 5000 (75% deuterium incorporation), at least 5500 (82.5% deuterium incorporation), at least 6000 (90% deuterium incorporation), at least 6333.3 (95% deuterium incorporation), at least 6466.7 (97% deuterium incorporation), at least 6600 (99% deuterium incorporation), or at least 6633.3 (99.5% deuterium incorporation). It should be understood that the term “isotopic enrichment factor” can be applied to any isotope in the same manner as described for deuterium.

[0578] Other examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as3H,11C,13C,14C,15N,18F,31P,32P,35S,36CI,123l,124l,125l respectively. Accordingly it should be understood that the invention includes compounds that incorporate one or more of any of the aforementioned isotopes, including for example, radioactive isotopes, such as3H and14C, or those into which non-radioactive isotopes, such as2H and13C are present. Such isotopically labelled compounds are useful in metabolic studies (with14C), reaction kinetic studies (with, for example2H or3H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients. In particular, an18F or labeled compound may be particularly desirable for PET or SPECT studies. Isotopically-labeled compounds of the present invention can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using an appropriate isotopically-labeled reagents in place of the non-labeled reagent previously employed.

[0579] PHARMACEUTICAL COMPOSITION

[0580] As used herein, the term “pharmaceutical composition” refers to a compound of the invention, or a pharmaceutically acceptable salt and / or tautomer thereof, together with at least one pharmaceutically acceptable carrier, in a form suitable for oral or parenteral administration.

[0581] As used herein, the term "pharmaceutically acceptable carrier" refers to a substance useful in the preparation or use of a pharmaceutical composition and includes, for example, suitable diluents, solvents, dispersion media, surfactants, antioxidants, preservatives, isotonic agents, buffering agents, emulsifiers, absorption delaying agents, salts, drug stabilizers, binders, excipients, disintegration agents, lubricants, wetting agents, sweetening agents, flavoring agents, dyes, and combinations thereof, as would be known to those skilled in the art (see, for example, Remington The Science and Practice of Pharmacy, 22ndEd. Pharmaceutical Press, 2013, pp. 1049-1070).

[0582] The term "a therapeutically effective amount" of a compound of the present invention refers to an amount of the compound of the present invention that will elicit the biological or medical response of a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, slow or delay disease progression, or prevent a disease, etc. In one non-limiting embodiment, the term “a therapeutically effective amount” refers to the amount of the compound of the present invention that, when administered to a subject, is effective to (1) at least partially alleviate, inhibit, prevent and / or ameliorate a condition, or a disorder or a disease (i) mediated by CDK4 and / or CDK2, or (ii) associated with CDK4 and / or CDK2 activity, or (iii) characterized by activity (normal or abnormal) of CDK4 and / or CDK2; or (2) reduce or inhibit the activity of CDK4 and / or CDK2; or (3) reduce or inhibit the expression of CDK4 and / or CDK2. In another non-limiting embodiment, the term “a therapeutically effective amount” refers to the amount of the compound of the present invention that, when administered to a cell, or a tissue, or a non-cellular biological material, or a medium, is effective in at least partially reducing or inhibiting the activity of CDK4 and / or CDK2; or at least partially reducing or inhibiting the expression of CDK4 and / or CDK2. It has been argued, e.g. in Patel et al, Mol Cancer Res; 16(3) March 2018, that additional CDK2 inhibition compensates for resistance to treatment with a CDK4 / 6 inhibitor.

[0583] As used herein, the term “subject” refers to primates (e.g., humans, male orfemale), dogs, rabbits, guinea pigs, pigs, rats and mice. In certain embodiments, the subject is a primate. In yet other embodiments, the subject is a human.

[0584] As used herein, the term “inhibit”, "inhibition" or “inhibiting” refers to the reduction or suppression of a given condition, symptom, or disorder, or disease, or a significant decrease in the baseline activity of a biological activity or process.

[0585] As used herein, the term “treat”, “treating" or "treatment" of any disease or disorder refers to alleviating or ameliorating the disease or disorder (i.e., slowing or arresting the development of the disease or at least one of the clinical symptoms thereof); or alleviating or ameliorating at least one physical parameter or biomarker associated with the disease or disorder, including those which may not be discernible to the patient. As used herein, the term “prevent”, “preventing” or “prevention” of any disease or disorder refers to the prophylactic treatment of the disease or disorder; or delaying the onset or progression of the disease or disorder.

[0586] As used herein, a subject is “in need of” a treatment if such subject would benefit biologically, medically, or in quality of life from such treatment.

[0587] As used herein, the term “a”, “an”, “the” and similar terms used in the context of the present invention (especially in the context of the claims) are to be construed to cover both the singular and plural unless otherwise indicated herein or clearly contradicted by the context.

[0588] All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. "such as”) provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed.

[0589] Any asymmetric atom (e.g., carbon or the like) of the compound(s) of the present invention can be present in racemic or enantiomerically enriched, for example the ( / ?)-, (S)- or (Reconfiguration. In certain embodiments, each asymmetric atom has at least 50 % enantiomeric excess, at least 60 % enantiomeric excess, at least 70 % enantiomeric excess, at least 80 % enantiomeric excess, at least 90 % enantiomeric excess, at least 95 % enantiomeric excess, or at least 99 % enantiomeric excess in the ( / ?)- or (S)- configuration. Substituents at atoms with unsaturated double bonds may, if possible, be present in cis- (Z)- or trans- (E)- form.

[0590] Accordingly, as used herein a compound of the present invention can be in the form of one of the possible stereoisomers, rotamers, atropisomers, tautomers or mixtures thereof, for example, as substantially pure geometric (cis or trans) stereoisomers, diastereomers, optical isomers (antipodes), racemates or mixtures thereof.

[0591] Any resulting mixtures of stereoisomers can be separated on the basis of the physicochemical differences of the constituents, into the pure or substantially pure geometric or optical isomers, diastereomers, racemates, for example, by chromatography and / or fractional crystallization.

[0592] Any resulting racemates of compounds of the present invention or of intermediates can be resolved into the optical antipodes by known methods, e.g., by separation of the diastereomeric salts thereof, obtained with an optically active acid or base, and liberating the optically active acidic or basic compound. In particular, a basic moiety may thus be employed to resolve the compounds of the present invention into their optical antipodes, e.g., by fractional crystallization of a salt formed with an optically active acid, e.g., tartaric acid, dibenzoyl tartaric acid, diacetyl tartaric acid, di-O, O -p- toluoyl tartaric acid, mandelic acid, malic acid or camphor-10-sulfonic acid. Racemic compounds of the present invention or racemic intermediates can also be resolved by chiral chromatography, e.g., high pressure liquid chromatography (HPLC) using a chiral adsorbent.

[0593] All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. "such as”) provided herein is intended merely to better illustrate the invention and does not pose a limitation on the scope of the invention otherwise claimed.

[0594] The compounds of the present application can be prepared by those skilled in the art of organic synthesis using commercially available starting materials, compounds known in the literature, or from readily prepared intermediates, by employing standard synthetic methods and procedures either known to those skilled in the art, or which will be apparent to the skilled chemist in light of the teachings herein.

[0595] The compounds of Formula (I) may be prepared by methods as set forth in Examples below. In the Examples described below, it is well understood that protecting groups for sensitive or reactive groups are employed where necessary in accordance with general principles of chemistry. Protecting groups are manipulated according to standard methods of organic synthesis as described for example in Protective Groups in Organic Synthesis, 3rd edition, John Wiley & Sons: New York, 1999 or Protecting Groups, 3rd edition, Thieme, Stuttgart, 2004. Protective groups are removed at a convenient stage of the compound synthesis using methods that are readily apparent to those skilled in the art.

[0596] Those skilled in the art will recognize if a stereocentre exists in the compounds disclosed herein. Resolution of the final product, an intermediate, or a starting material may be affected by any suitable method known in the art. See, for example, "Stereochemistry of Organic Compounds" by E. L. Eliel, S. H. Wilen, and L. N. Mander (Wiley-lnterscience, 1994).

[0597] The invention further includes any variant of the present processes, in which an intermediate product obtainable at any stage thereof is used as starting material and the remaining steps are carried out, or in which the starting materials are formed in situ under the reaction conditions, or in which the reaction components are used in the form of their salts or optically pure material. Compounds of the invention and intermediates can also be converted into each other according to methods generally known to those skilled in the art. In another aspect, the present invention provides a pharmaceutical composition comprising a compound of the present invention, or a pharmaceutically acceptable salt and / or tautomer thereof, and a pharmaceutically acceptable carrier. In a further embodiment, the composition comprises at least two pharmaceutically acceptable carriers, such as those described herein. The pharmaceutical composition can be formulated for particular routes of administration such as oral administration, parenteral administration (e.g. by injection, infusion, transdermal or topical administration), and rectal administration. Topical administration may also pertain to inhalation or intranasal application. The pharmaceutical compositions of the present invention can be made up in a solid form (including, without limitation, capsules, tablets, pills, granules, powders or suppositories), or in a liquid form (including, without limitation, solutions, suspensions or emulsions). Tablets may be either film coated or enteric coated according to methods known in the art. Typically, the pharmaceutical compositions are tablets or gelatin capsules comprising the active ingredient together with one or more of: a) diluents, e.g., lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and / or glycine; b) lubricants, e.g., silica, talcum, stearic acid, its magnesium or calcium salt and / or polyethyleneglycol; for tablets also c) binders, e.g., magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethylcellulose and / or polyvinylpyrrolidone; if desired d) disintegrants, e.g., starches, agar, alginic acid or its sodium salt, or effervescent mixtures; and e) absorbents, colorants, flavors and sweeteners.

[0598] METHODS OF USE OF THE INVENTION

[0599] The compounds of formula (I), in free form or in pharmaceutically acceptable salt form and / or tautomeric form, exhibit valuable pharmacological properties, for example CDK4 and / or CDK2 modulating properties, for example as indicated in in vitro tests as provided in the next sections, and are therefore indicated for therapy or for use as research chemicals, e.g. as tool compounds.

[0600] Compounds of the invention may be useful in the treatment, or prevention of cancer. In an embodiment, the cancer is selected from prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer, colorectal cancer and breast cancer (e.g. ER+ breast cancer, e.g. ER+ / HER2- breast cancer), lung cancer and endometrial cancer. Thus, as a further aspect, the present invention provides the use of a compound of formula (I), (in particular, according to any one of embodiments 1 to 45), or a pharmaceutically acceptable salt and / or tautomer thereof, in therapy . I n a further embodiment, the therapy is treatment of a disease, disorder or condition which may be treated by inhibition of CDK4 and / or CDK2. In another embodiment, the cancer is selected from prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer, colorectal cancer and breast cancer (e.g. ER+ breast cancer, e.g. ER+ / HER2- breast cancer), lung cancer and endometrial cancer.

[0601] Thus, as a further aspect, the present invention provides a compound of formula (I), (in particular according to any one of embodiments 1 to 45), or a pharmaceutically acceptable salt and / or tautomer thereof, for use in therapy. In a further embodiment, the therapy is selected from a disease which may be treated by inhibition of CDK4 and / or CDK2. In another embodiment, the cancer is selected from prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer, colorectal cancer and breast cancer (e.g. ER+ breast cancer, e.g. ER+ / HER2- breast cancer), lung cancer and endometrial cancer.

[0602] In another aspect, the invention provides a method of treating, or preventing a disease which is treated by inhibiting CDK4 and / or CDK2 comprising administration of a therapeutically effective amount of a compound of any one of formula (I) (in particular according to any one of embodiments 1 to 45), or a pharmaceutically acceptable salt and / or tautomer thereof. In a further embodiment, the cancer is selected from prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer, colorectal cancer and breast cancer (e.g. ER+ breast cancer, e.g. ER+ / HER2- breast cancer), lung cancer and endometrial cancer.

[0603] Thus, as a further aspect, the present invention provides the use of a compound of any one of formula (I) (in particular, according to any one of embodiments 1 to 45), or a pharmaceutically acceptable salt and / or tautomer thereof, for the manufacture of a medicament. In a further embodiment, the medicament is for treatment, or prevention of a disease, which may be treated by inhibition of CDK4 and / or CDK2. In another embodiment, the cancer is selected from prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer, colorectal cancer and breast cancer (e.g. ER+ breast cancer, e.g. ER+ / HER2- breast cancer), lung cancer and endometrial cancer.

[0604] The pharmaceutical composition or combination of the present invention may, for example, be in unit dosage of about 1-1000 mg of active ingredient(s) for a subject of about 50-70 kg. The therapeutically effective dosage of a compound, the pharmaceutical composition, or the combinations thereof, is dependent on the species of the subject, the body weight, age and individual condition, the disorder or disease or the severity thereof being treated. A physician, clinician or veterinarian of ordinary skill can readily determine the effective amount of each of the active ingredients necessary to prevent, treat or inhibit the progress of the disorder or disease.

[0605] COMBINATION PRODUCT AND COMBINATION THERAPY OF THE INVENTION

[0606] “Combination” refers to either a fixed combination in one dosage unit form, or a combined administration where a compound of the present invention and a combination partner (e.g. another drug as explained below, also referred to as “therapeutic agent” or “co-agent”) may be administered independently at the same time or separately within time intervals, especially where these time intervals allow for the combination partners to have a cooperative, e.g. synergistic effect. The single components may be packaged in a kit or separately. One or both of the components (e.g. powders or liquids) may be reconstituted or diluted to a desired dose prior to administration. The terms “co-administration” or “combined administration” or the like as utilized herein are meant to encompass administration of the selected combination partner to a single subject in need thereof (e.g. a patient), and are intended to include treatment regimens in which the agents are not necessarily administered by the same route of administration or at the same time. The term “pharmaceutical combination” as used herein means a product that results from the mixing or combining of more than one therapeutic agent and includes both fixed and nonfixed combinations of the therapeutic agents. The term “fixed combination” means that the therapeutic agents, e.g. a compound of the present invention and a combination partner, are both administered to a patient simultaneously in the form of a single entity or dosage. The term “nonfixed combination” means that the therapeutic agents, e.g. a compound of the present invention and a combination partner, are both administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific time limits, wherein such administration provides therapeutically effective levels of the two compounds in the body of the patient. The latter also applies to cocktail therapy, e.g. the administration of three or more therapeutic agents.

[0607] The term “pharmaceutical combination” as used herein refers to either a fixed combination in one dosage unit form, or non-fixed combination or a kit of parts for the combined administration where two or more therapeutic agents may be administered independently at the same time or separately within time intervals, especially where these time intervals allow for the combination partners to have a cooperative, e.g. synergistic effect. The term "combination therapy" refers to the administration of two or more therapeutic agents to treat a therapeutic condition or disorder described in the present disclosure. Such administration encompasses co-administration of these therapeutic agents in a substantially simultaneous manner, such as in a single capsule having a fixed ratio of active ingredients. Alternatively, such administration encompasses co-administration in multiple, or in separate containers (e.g. tablets, capsules, powders, and liquids) for each active ingredient. Powders and / or liquids may be reconstituted or diluted to a desired dose prior to administration. In addition, such administration also encompasses use of each type of therapeutic agent in a sequential manner, either at approximately the same time or at different times. In either case, the treatment regimen will provide beneficial effects of the drug combination in treating the conditions or disorders described herein.

[0608] The compounds of the present invention may be administered either simultaneously with, or before, or after, one or more other therapeutic agent. The compounds of the present invention may be administered separately, by the same or different route of administration, or together in the same pharmaceutical composition as the other agents. A therapeutic agent is, for example, a chemical compound, peptide, antibody, antibody fragment or nucleic acid, which is therapeutically active or enhances the therapeutic activity when administered to a patient in combination with a compound of the invention.

[0609] In one embodiment, the therapy is the treatment, or prevention of a disease or condition mediated by CDK4 and / or CDK2. Products provided as a combined preparation include a composition comprising a compound of formula (I) a pharmaceutically acceptable salt and / or tautomer thereof, and the other therapeutic agent(s) together in the same pharmaceutical composition, or a compound of formula (I) or a pharmaceutically acceptable salt and / or tautomer thereof, and the other therapeutic agent(s) in separate form, e.g. in the form of a kit.

[0610] In one embodiment, the invention provides a pharmaceutical combination comprising a compound of formula (I) (in particular, according to any one of embodiments 1 to 45), or a pharmaceutically acceptable salt and / or tautomer thereof, and another therapeutic agent(s). Optionally, the pharmaceutical combination may comprise a pharmaceutically acceptable carrier, as described above.

[0611] In one embodiment, the invention provides a kit comprising two or more separate pharmaceutical compositions, at least one of which contains a compound of formula (I) (in particular, according to any one of embodiments 1 to 45), or a pharmaceutically acceptable salt and / or tautomer thereof. In one embodiment, the kit comprises means for separately retaining said compositions, such as a container, divided bottle, or divided foil packet. An example of such a kit is a blister pack, as typically used for the packaging of tablets, capsules and the like.

[0612] EXAMPLES

[0613] The disclosure is further illustrated by the following examples and synthetic methods, which are not to be construed as limiting this disclosure in scope or spirit to the specific procedures herein described. It is to be understood that the examples are provided to illustrate certain embodiments and that no limitation to the scope of the disclosure is intended thereby. It is to be further understood that resort may be had to various other embodiments, modifications, and equivalents thereof which may suggest themselves to those skilled in the art without departing from the spirit of the present disclosure and / or scope of the appended claims.

[0614] The compounds of the present invention can be produced by organic synthesis methods known to one of ordinary skill in the art as shown in the following examples. All starting materials, building blocks, reagents, acids, bases, dehydrating agents, solvents, and catalysts utilized to synthesise the compounds of the present invention are either commercially available or can be produced by organic synthesis methods known to one of ordinary skill in the art. In all of the methods it is understood that protecting groups for sensitive or reactive groups may be employed where necessary in accordance with general principles of chemistry. Protecting groups are manipulated according to standard methods of organic synthesis (T. W. Green and P. G. M. Wuts (2014) Protective Groups in Organic Synthesis, 5th edition, John Wiley & Sons). These groups are removed at a convenient stage of the compound synthesis using methods that are readily apparent to those skilled in the art. Unless otherwise noted, reagents and solvents were used as received from commercial suppliers.

[0615] The chemical names were generated using ChemDraw Professional v22.0.0.22 from PerkinElmer.

[0616] Temperatures are given in degrees Celsius. As used herein, unless specified otherwise, the term “room temperature” or “ambient temperature” means a temperature of from 15°C to 30°C, such as from 20°C to 30°C, such as from 20°C to 25°C. If not mentioned otherwise, all evaporations are performed under reduced pressure, typically between about 15 mm Hg and 100 mm Hg (= 20 - 133 mbar). The structure of final products, intermediates and starting materials is confirmed by standard analytical methods, e.g., microanalysis and spectroscopic characteristics, e.g., MS, IR, NMR. Abbreviations used are those conventional in the art.

[0617] All starting materials, building blocks, reagents, acids, bases, dehydrating agents, solvents, and catalysts utilized to synthesize the compounds of the present invention are either commercially available or can be produced by organic synthesis methods known to one of ordinary skill in the art.

[0618] LIST OF ABBREVIATIONS

[0619] ACN: Acetonitrile

[0620] BrettPhosPdG3: [(2-Di-cyclohexylphosphino-3,6-dimethoxy-2',4',6 - triisopropyl-1 ,1 '-biphenyl)-2- (2'-amino-1 ,1 ' -biphenyl)]palladium(l I) methanesulfonate methanesulfonate

[0621] CS2CO3: Caesium carbonate

[0622] CMBP: 2-(tributyl-l5-phosphaneylidene) acetonitrile

[0623] DCM: Dichloroethane

[0624] DIPEA: N,N-Diisopropylethylamine

[0625] DMAP: 4-4-(Dimethylamino)pyridine

[0626] DMF: Dimethylformamide

[0627] DMSO: Dimethyl sulfoxide

[0628] EtOAc: Ethyl acetate

[0629] H2: Hydrogen gas

[0630] HATU: Hexafluorophosphate azabenzotriazole tetramethyl uranium

[0631] HCI: Hydrogen chloride

[0632] H2O2: Hydrogen peroxide

[0633] HPLC: High-performance liquid chromatography

[0634] LC-MS: Liquid chromatography-mass spectrometry

[0635] LiHMDS: Lithium bis (trimethylsilyl)amide

[0636] L-Selectride: Lithium tri-sec-butylborohydride

[0637] MeOH: Methanol

[0638] N2: Nitrogen gas

[0639] NaBH4: Sodium borohydride

[0640] NaCNBH3: Sodium cyanoborohydride

[0641] NaO’Bu: Sodium tert-butoxide

[0642] Pd / C: Palladium on carbon

[0643] SFC: Supercritical fluid chromatography Selectfluor-ll: N-Chloromethyl-N-fluorotriethylenediammonium bis(tetrafluoroborate) 1-

[0644] Chloromethyl-4-fluoro-1 ,4-diazoniabicyclo[2.2.2]octane bis(tetrafluoroborate)

[0645] STAB: Sodium triacetoxyborohydride

[0646] TBAF: Tetra-n-butylammonium fluoride

[0647] TEA: Triethyl amine

[0648] TFA: Trifluoro acetic acid

[0649] THF: Tetrahydrofuran

[0650] TLC: thin layer chromatography

[0651] TMSCI: Chlorotrimethylsilane

[0652] INTEMEDIATES AND EXAMPLES lnt-1 and lnt-2: cis-racemic tert-butyl-4-(benzylamino)-5-fluoro-2,2-dimethylpiperidine-1- carboxylate and trans-racemic tert-butyl-4-(benzylamino)-5-fluoro-2,2-dimethylpiperidine- 1 -carboxylate:

[0653] (Cis-racemic) (Trans-racemic)

[0654] Step-1 : Synthesis of tert-butyl 2,2-dimethyl-4-((trimethylsilyl)oxy)-3,6-dihydro pyridine- 1(2H)-carboxylate:

[0655] To a stirred solution of fe / t-butyl 2,2-dimethyl-4-oxopiperidine-1-carboxylate (5000 mg, 22 mmol) in Tetra hydrofuran (THF) (85 mL) at -78 °C was added Lithium bis (trimethylsilyl)amide (LiHMDS) (1 M in THF) (32.9 mL, 33 mmol) and continued stirring at the same temperature for 1 hour. Chlorotrimethylsilane (TMSCI) (6.1 mL, 48 mmol) was added, and the reaction mixture was continued stirring for another 4 hours at -78 °C. Progress of the reaction was monitored by TLC. After completion of the reaction, the reaction mixture was quenched with saturated aqueous Ammonium chloride solution and extracted with Ethyl acetate (2 x 100 mL). The combined organic extract was washed with saturated aqueous Sodium bicarbonate solution, brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude tertbutyl 2,2-dimethyl-4-((trimethylsilyl)oxy)-3,6-dihydro pyridine-1(2H)-carboxylate (8000 mg, 76 % yield). It was used in the next step directly without further purification.1H NMR (400 MHz, CDCI3): 5 4.84 (t, J = 4.0 Hz, 1 H), 3.90-3.88 (m, 2H), 2.1-2.04 (s, 2H), 1 .46 (s, 9H), 1 .43 (s, 6H), 0.21 (s, 9H).

[0656] Step-2: Synthesis of tert-butyl 5-fluoro-2,2-dimethyl-4-oxopiperidine-1-carboxylate:

[0657] To a stirred solution of tert-butyl 2,2-dimethyl-4-((trimethylsilyl)oxy)-3,6-dihydro pyridine- 1(2H)-carboxylate (8000 mg, 26.75 mmol) in Acetonitrile (ACN) (80 mL) at 0 °C was added Selectfluor-I I (8500 mg, 26.75 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC. After completion of the reaction, the reaction mixture was diluted with water and extracted with Ethyl acetate (2 x 100 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by Redi-Sep pre-packed silica gel column (80 g) and eluted with 0 - 20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tertbuty 5-fluoro-2,2-dimethyl-4-oxopiperidine-1 -carboxylate (4200 mg, 64 % yield) as a paleyellow liquid.1H NMR (400 MHz, CDCI3): 5 4.86-4.71 (m, 1 H), 4.22-4.16 (m, 1 H), 4.04-3.99 (m, 1 H), 2.65 (d, J = 14.4 Hz, 2H), 1.54 (s, 3H), 1.49 (s, 9H), 1.46 (s, 3H).

[0658] Step-3: Synthesis of cis-racemic tert-butyl-4-(benzylamino)-5-fluoro-2,2- dimethylpiperidine-1 -carboxylate (lnt-1) and trans-racemic tert-butyl-4-(benzylamino)-5- fluoro-2,2-dimethylpiperidine-1 -carboxylate (lnt-2):

[0659] To a stirred solution of tert-butyl 5-fluoro-2,2-dimethyl-4-oxopiperidine-1-carboxylate (3500 mg, 14.28 mmol) in Tetrahydrofuran (30 mL) at 0 °C were added Benzylamine (2330 mg, 21.42 mmol) and Titanium (IV) isopropoxide (6080 mg, 21 .42 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours before it was quenched with water and extracted with Ethyl acetate. The organic layer was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude imine intermediate. It was dissolved in Methanol (MeOH) and Sodium cyanoborohydride (NaCNBH3) (2700 mg, 42.84 mmol) was added at 0 °C. The resulting reaction mixture was stirred at ambient temperature for 4 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate (2 x 40 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by silica gel (230-400 mesh) column chromatography and eluted with 5 - 25 % Ethyl acetate in Petroleum ether. Fractions eluted at 7 - 8 % Ethyl acetate in Petroleum ether were pooled and concentrated to give lnt-1 (Peak-1) (1400 mg, 29 % yield). Fractions eluted at 12 - 15% Ethyl acetate in Petroleum ether were pooled and concentrated to give lnt-2 (Peak-2) (1600 mg, 33 % yield). The relative stereochemistry of lnt-1 and lnt-2 was assigned based on VT-NOE and HSQC analysis. lnt-1 (Peak-1):1H NMR (400 MHz, CDCI3): 6 7.36-7.27 (m, 5H), 4.88-4.75 (m, 1 H), 4.31-4.23 (m, 1 H), 3.90 (d, J = 12.8 Hz, 1 H), 3.83 (d, J = 14.4 Hz, 1 H), 3.18-3.04 (m, 1 H), 2.85-2.72 (m, 1 H), 1 .8-1 .73 (m, 1 H), 1 .59 (s, 3H), 1 .57-1 .66 (m, 1 H), 1 .45 (s, 9H), 1 .23 (s, 3H). LC-MS (m / z): 337.41 [M+H]+. (Two protons overlapped with residual water in CDCI3). lnt-2 (Peak-2):1H NMR (400 MHz, CDCI3): 6 7.32-7.27 (m, 5H), 4.59-4.40 (m, 1 H), 3.85 (s, 2H), 3.80-3.61 (m, 2H), 3.11 -2.99 (m, 1 H), 2.70-2.62 (m, 1 H), 1.46 (s, 9H), 1.44 (s, 3H), 1.41 (s, 3H). LC-MS (m / z): 337.41 [M+H]+. (Two protons overlapped with residual water in CDCI3). lnt-4: (3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-amine: lnt-4

[0660] Step-1 : Synthesis of tert-butyl (3R,4R)-4-(((benzyloxy)carbonyl)amino)-3-fluoropiperidine- 1 -carboxylate:

[0661] To a solution of fe / t-butyl (3R,4R)-4-amino-3-fluoropiperidine-1 -carboxylate (35000 mg, 160 mmol) in Dichloromethane (DCM) (525 mL) was added N,N-Diisopropylethylamine (DIPEA) (62100 mg, 481 mmol, 83.8 mL). Benzyl-chloroformate (30000 mg, 176 mmol, 25.0 mL) was added dropwise at 0 °C with stirring. The reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (500 mL) and extracted with Dichloromethane (DCM) (2 x 300 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by silica gel column chromatography and eluted with 0 - 100 % of Ethyl acetate in Petroleum ether to afford tert-butyl (3R,4R)-4-(((benzyloxy)carbonyl)amino)-3-fluoropiperidine-1 -carboxylate (56000 mg, 99 % yield) as a colorless oil.1H NMR (400 MHz, DMSO-cfe): 6 7.45 - 7.59 (m, 1 H) 7.29 - 7.39 (m, 5 H) 4.99 - 5.11 (m, 2 H) 4.19 - 4.39 (m, 1 H) 3.84 - 3.99 (m, 1 H) 3.59 - 3.77 (m, 2 H) 2.94 - 3.21 (m, 2 H) 1 .72 - 1 .87 (m, 1 H) 1 .39 (s, 10 H).

[0662] Step-2: Synthesis of Benzyl ((3R,4R)-3-fluoropiperidin-4-yl)carbamate (lnt-3):

[0663] To a solution of afford tert-butyl (3R,4R)-4-(((benzyloxy)carbonyl)amino)-3-fluoropiperidine- 1 -carboxylate (56000 mg, 158 mmol) in Dichloromethane (DCM) (560 mL) was added a solution of HCI in 1 ,4-Dioxane (4 M, 79.4 mL). The reaction mixture was stirred at ambient temperature for3 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to give Benzyl ((3R,4R)-3-fluoropiperidin-4- yl)carbamate (lnt-3) (42000 mg, 91.5 % yield) as an HCI salt. It was used in the next step as it is.1H NMR (400 MHz, DMSO-cfe): 6 9.31 - 9.55 (m, 1 H) 7.72 - 7.85 (m, 1 H) 7.28 - 7.43 (m, 5 H) 4.99 - 5.12 (m, 2 H) 4.58 - 4.83 (m, 1 H) 3.81 - 3.94 (m, 1 H) 3.38 - 3.50 (m, 1 H) 3.11 - 3.24 (m, 2 H) 2.94 - 3.05 (m, 1 H) 1 .93 - 2.09 (m, 1 H) 1 .63 - 1 .78 (m, 1 H).

[0664] Step-3: Synthesis of Benzyl ((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)carbamate:

[0665] To a solution of lnt-3 (42000 mg, 145 mmol) and Triethyl amine (TEA) (44100 mg, 436 mmol, 60.7 mL) in Dichloromethane (DCM) (420 mL) at 0 °C was added Methanesulfonyl chloride (MsCI) (20800 mg, 181 mmol, 14.0 mL). The reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by LC-MS. After completion, the reaction mixture was cooled to 0 °C with an ice bath and quenched with water (200 mL). It was transferred to a separatory funnel containing saturated aqueous Sodium bicarbonate solution (500 mL). Organic layer was separated. The aqueous layer was extracted with Dichloromethane (DCM) (2 x 500 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by reversed-phase HPLC (column: Kromasil Eternity XT 250*80mm*10um; mobile phase: [water (ammonia hydroxide v / v)-ACN]; B%: 38%-58%,20min). Fraction collected were pooled, concentrated under reduced pressure, and lyophilized to afford Benzyl ((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)carbamate (36000 mg, 74.9 % yield) as a white solid.1H NMR (400 MHz, DMSO-cfe): 6 7.57 (br d, =8.20 Hz, 1 H) 7.29 - 7.40 (m, 5 H) 5.04 (s, 2 H) 4.35 - 4.58 (m, 1 H) 3.61 - 3.79 (m, 2 H) 3.34 - 3.44 (m, 1 H) 2.95 - 3.11 (m, 2 H) 2.92 (s, 3 H) 1 .92 (br dd, =9.24, 4.83 Hz, 1 H) 1.46 - 1.60 (m, 1 H). LC-MS (m / z): 353.0 [M+23]+.

[0666] Step-4: Synthesis of (3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-amine (lnt-4):

[0667] Three batches of the following reaction were run in parallel:

[0668] To a solution of Benzyl ((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)carbamate (12000 mg, 36.3 mmol) in Ethyl acetate (240 mL) and Methanol (120 mL) was added Palladium on carbon (Pd / C) (2400 mg, 36.3 mmol, 10% wt) under N2atmosphere. The suspension was degassed and backfilled with Hydrogen gas (H2) for 3 times. The reaction mixture was stirred under H2(15 Psi) at ambient temperature for 12 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was filtered through Celite pad and the filtrate was concentrated in vacuo to give (3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-amine (Int- 4) (20010 mg, 93.5 % yield, 3 batches in total) as an off-white solid.1H NMR (400 MHz, DMSO- d6) 54.17 - 4.42 (m, 1 H) 3.47 - 3.67 (m, 1 H) 3.29 - 3.40 (m, 1 H) 3.00 - 3.06 (m, 1 H) 2.96 (dt, =12.08, 2.77 Hz, 1 H) 2.88 - 2.93 (m, 3 H) 2.80 - 2.88 (m, 1 H) 1.71 - 1.99 (m, 2 H) 1.33 - 1.49 (m, 1 H). LC-MS (m / z): 197.0 [M+1]+. lnt-5: (3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-amine:

[0669] Step-1 : Synthesis of Benzyl ((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4- yl)carbamate:

[0670] A stirred solution of lnt-3 (100000 mg, 346 mmol) and Triethyl amine (289 mL, 2083 mmol) in Dichloromethane (2000 mL) at 0 °C was added Cyclopropanesulfonyl chloride (58400 mg, 415 mmol). The mixture was allowed to warm to ambient temperature and stirred for 5 hours. The progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with Dichloromethane and washed with water. The organic layer was dried over anhydrous Sodium sulphate and concentrated under reduced pressure to give the crude product. It was triturated with Methanol and dried under reduced pressure to afford Benzyl ((3R,4R)-1- (cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)carbamate (104000 mg, 84 % yield) as a white solid.1H NMR (400 MHz, CDCI3): 5 7.36 - 7.32 (m, 5 H) 5.10 - 5.18 (m, 3 H) 4.52 -4.31 (m, 1 H) 4.05 - 3.62 (m, 3 H) 3.10 - 2.90 ( m, 2 H) 2.45 - 2.10 (m, 2 H) 1.70 - 1.51 (m, 1 H) 1.25 -1.15 (m, 2 H) 1.10 - 0.95 (m, 2 H).

[0671] Step-2: Synthesis of (3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-amine (lnt-5):

[0672] In a parr-shaker containing a stirred solution of Benzyl ((3R,4R)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)carbamate (70000 mg, 196.40 mmol) in Methanol (700 mL) and Tetrahydrofuran (700 mL) was added 10 % Palladium on carbon (Pd / C) (21000 mg, 19.7 mmol) and 20 % Palladium hydroxide (7000 mg, 9.97 mmol). The whole reaction mixture was shaken under a hydrogen atmosphere at 60 PSi at ambient temperature for 18 hours. The progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through a plug of Celite pad, and the bed was washed with Methanol. The filtrate was concentrated under reduced pressure to give the crude product. It was purified by column chromatography (silica gel 100:200 mesh, eluent: 0 - 10 % Methanol: Dichloromethane) to afford (3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-amine (lnt-5) (37000 mg, 84 % yield) as a pale-yellow gummy.1H NMR (400 MHz, DMSO-d6): 5 4.35 - 4.15 (m, 1 H) 3.72 - 3.60 (m, 1 H) 3.45 - 3.38 (m, 1 H) 3.15 - 2.91 (m, 2 H) 2.90 - 2.85 (m, 1 H) 2.68 - 2.55 (m, 1 H) 1.90 - 1.70 (m, 3 H) 1.48 - 1.31 (m, 1 H) 1.10 - 0.90 (m, 4 H). lnt-12: cis-racemic tert-butyl 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoroazepane- 1 -carboxylate and lnt-13: trans-racemic tert-butyl 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin- 7 -yl)-3-fluoroaze pane-1 -carboxylate:

[0673] Step-1 : Synthesis of 1 -(tert-butyl) 4-ethyl 6-fluoro-5-oxoazepane-1 ,4-dicarboxylate:

[0674] To a stirred solution of tert-butyl 3-fluoro-4-oxopiperidine-1 -carboxylate (12000 mg, 55.23 mmol) in Diethyl ether (40 mL) at -78 °C was added Boron trifluoride etherate dropwise (8620 mg, 7.61 mL, 60.76 mmol), followed by Ethyl 2-diazoacetate (5630 mg, 55.23 mmol). The reaction mixture was stirred at -78 °C for 30 minutes and then allowed to warm to 0 °C and stirred for 1 hour. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice water and extracted with Diethyl ether (2 x 50 mL). The combined organic extract was dried over anhydrous Sodium sulphate and concentrated under reduced pressure to give the crude product. It was purified by Flash column chromatography using neutral alumina and eluted with 0 -30 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford 1 -(tert-butyl) 4-ethyl 6-fluoro-5-oxoazepane- 1,4-dicarboxylate (6000 mg, 20 % yield) as a pale yellow liquid. NMR shows there are some impurities in the material. It was used in the next step directly without further purification.1H NMR (400 MHz, CDCI3): 5 5.18-5.05 (d, J = 1 H), 4.21-4.20 (q, J = 5Hz 2H), 3.64-3.83 (m, 1 H), 3.56- 3.47 (m, 2H), 2.52-2.64 (m, 2H), 1.64-2.04 (m, 2H), 1.36 (s, 9H), 1.16 (t, 3H).

[0675] Step-2: Synthesis of tert-butyl 3-fluoro-4-oxoazepane-1-carboxylate:

[0676] To a stirred solution of 1 -(tert-butyl) 4-ethyl 6-fluoro-5-oxoazepane-1,4-dicarboxylate (12200 mg, 40.22 mmol) in DMSO (20 mL) at ambient temperature was added Sodium chloride (23500 mg, 402.2 mmol) and water (7.24 mL). The reaction mixture was stirred at 130 °C for 6 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature. It was diluted with ice water and extracted with Ethyl acetate (2 x 100 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Flash column chromatography using neutral alumina and eluted with 10 - 40 % Ethyl acetate in Petroleum ether. Fraction collected were pooled and concentrated to afford tert-butyl 3-fluoro- 4-oxoazepane-1 -carboxylate (4120 mg, 35 % yield) as a pale-yellow liquid. NMR shows there are some impurities in the material. It was used in the next step directly without further purificaioin.1H NMR (400 MHz, CDCI3) 5: 5.1-4.9 (m, 1 H), 4.3-4.45 (m, 1 H), 3.71-3.82 (m, 1 H), 3.42-3.65 (m, 1 H), 3.41-3.56 (m, 2H), 3.12-3.24 (m, 1 H), 1.86-1.87 (m, 2H), 1 .49 -1 ,52(s, 9H).

[0677] Step-3: Synthesis of tert-butyl 3-fluoro-4-hydroxyazepane-1-carboxylate (lnt-14):

[0678] To a stirred solution of tert-butyl 3-fluoro-4-oxoazepane-1-carboxylate (4100 mg, 17.73 mmol) in Tetra hydrafu ran (20 mL) and Methanol (5 mL) at 0°C was added Sodium borohydride (NaBH4) (2230 mg, 60 % wt, 35.46 mmol). The reaction mixture was stirred at 0 °C for 10 minutes and then allowed to warm to ambient temperature and stirred for 6 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water and extracted with Ethyl acetate (2 x 100 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Flash column chromatography using neutral alumina and eluted with 0 - 40 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl 3-fluoro-4-hydroxyazepane-1 -carboxylate (lnt-14) (2200 mg, 32 % yield) as a pale-yellow liquid.1H NMR (400 MHz, CDCI3): 6 4.41-4.51 (m, 2H), 4.11- 4.14 (m, 1 H), 3.24-3.28 (m, 1 H), 3.21-3.45 (m, 2H), 3.12-3.24 (m, 2H), 1.87-1.86 (m, 2H), 1.52- 1.49 (s, 9H). LC-MS (m / z): 178.18 [M-56]+.Step-4: Synthesis of lnt-12 and lnt-13:

[0679] To a stirred solution of lnt-14 (2200 mg, 9.43 mmol) in Toluene (15 mL) at ambient temperature was added 2-chloro-7H-pyrrolo[2,3-d]pyrimidine (1440 mg, 9.43 mmol) and 2-(tributyl-l5- phosphaneylidene) acetonitrile (CMBP) (4550 mg, 18.86 mmol). The reaction mixture was stirred at 110 °C for 12 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water and extracted with Ethyl acetate (2 x 50 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by normal phase flash column chromatography using silica gel (230-400 mesh) and eluted with 0 - 20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to give the mixture of lnt-12 and lnt-13. It was separated by reverse phase flash column chromatography and eluted with 0 - 80 % of Acetonitrile in water, with 0.1 % formic acid as modifier. Fractions collected from the two peaks were pooled, concentrated under reduced pressure, and lyophilized respectively to afford cis-racemic lnt-12 (peak-1) (1200 mg, 31.8 % yield) and trans-racemic lnt-13 (peak-2) (300 mg, 6.4 % yield) as off-white solid. The relative stereochemistry of lnt-12 and lnt-13 was assigned based on VT-NOE and HSQC analysis. lnt-12 (peak-1):

[0680] 1H NMR (400 MHz, CDCI3): 5 8.04 (s, 1 H), 7.35 (d, 4Hz, 1 H), 6.57 (d, J = 4Hz, 1 H), 5.00-5.12 (m, 2H), 3.69-3.78 (m, 3H), 3.32-3.39 (m, 1 H), 2.44-2.50 (m, 1 H), 1.90-2.00 (m, 3H), 1.5 (s, 9H). LC- MS (m / z): 369.34 [M+H]+. lnt-13 (peak-2):

[0681] 1H NMR (400 MHz, CDCI3): 5 8.79 (s, 1 H), 7.19-7.23 (m, 1 H), 6.58 (d, J = 4Hz, 1 H), 4.65-4.98 (m, 2H), 3.54-3.67 (m, 3H), 3.32-3.39 (m, 1 H), 1.88-2.22 (m, 4H), 1.5 (s, 9H). LC-MS (m / z): 369.34 [M+H]+. lnt-15: tert-butyl (3R,4S)-4-(2-chloro-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluoropiperidine-1 -carboxylate:

[0682] Step-1 : Synthesis of tert-butyl (3R,4S)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate:

[0683] To a stirred solution of 2,4-dichloro-5-iodopyrimidine (1000 mg, 3.64 mmol) and tert-butyl (3R,4S)-4-amino-3-fluoropiperidine-1 -carboxylate (794 mg, 3.64 mmol) in Ethanol (15 mL) was slowly added N,N-Diisopropylethylamine (1410 mg, 10.91 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. Water was added and the crude material was extracted with Ethyl acetate. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was triturated with Petroleum ether and stirred for 15 minutes. The solid obtained was filtered, washed with Petroleum ether, and dried under reduced pressure to afford tert-butyl (3R,4S)-4-((2-chloro-5-iodopyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate (1500 mg, 61 % yield) as an off-white solid. LC-MS (m / z): 457.09, 459.09 [M, M+2]+. Step-2: Synthesis of tert-butyl (3R,4S)-4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate:

[0684] To a stirred solution of tert-butyl (3R,4S)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (700 mg, 1 .53 mmol) in Dimethylformamide (DMF) (5 mL) was added tributyl(prop-1-yn-1-yl)stannane (706 mg, 2.14 mmol) and purged with Argon gas for 2 minutes. Copper (I) iodide (29 mg, 0.15 mmol) and Bis(triphenylphosphine)palladium(ll) dichloride (107 mg, 0.15 mmol) were added and the reaction mixture was again purged with Argon gas for 2 minutes and stirred at 70 °C for 30 minutes. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature and filtered through Celite pad. The celite pad was washed with Ethyl acetate. The filtrate was washed with water. The separated organic layer was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean column chromatography using silica gel (100-200 mesh) and eluted with 10 - 20 % Ethyl acetate Petroleum ether to afford tert-butyl (3R,4S)-4-((2-chloro-5-(prop- 1-yn-1-yl)pyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (400 mg, 67 % yield) as a brown solid. LC-MS (m / z): 369.24, 371.22 [M, M+2]+.

[0685] Step-3: Synthesis of tert-butyl (3R,4S)-4-(2-chloro-6-methyl-7H-pyrrolo[2,3-d] pyrimidin-7- yl)-3-fluoropiperidine-1 -carboxylate (lnt-15):

[0686] To a stirred solution of tert-butyl (3R,4S)-4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate (360 mg, 0.98 mmol) in Tetra hydrofuran (5 mL) was added 1 M solution of Tetra-n-butylammonium fluoride (TBAF) in Tetrahydrofuran (0.98 mL, 0.98 mmol) dropwise. The resulting reaction mixture was stirred at 65 °C for 30 minutes. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was diluted with water and extracted with Ethyl acetate. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean column chromatography using silica gel (100-200 mesh) and eluted with 10 - 20 % Ethyl acetate in Petroleum etherto afford tert-butyl (3R,4S)-4-(2-chloro-6-methyl- 7H-pyrrolo[2,3-d] pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (lnt-15) (200 mg, 46 % yield) as a pale brown solid. LC-MS (m / z): 369.3, 371.36 [M, M+2]+. Example 1 : N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine and Example 2: N-((3R,4R)-3- fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2-dimethylpiperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine: i) 4M HCI in dioxane, DCM RT, 2 h ii) SFC separation

[0687] Steps-6&7 Example 2

[0688] Cis-racemic Peak-2

[0689] Step-1 : Synthesis of cis-racemic tert-butyl 4-amino-5-fluoro-2,2-dimethylpiperidine-1- carboxylate:

[0690] To a stirred solution of lnt-1 (2000 mg, 5.94 mmol) in Methanol (20 mL) at ambient temperature under Nitrogen atmosphere was added 10 % Palladium hydroxide on carbon (220 mg) and 20 % Palladium on carbon (620 mg). The suspension was degassed under reduced pressure and purged with Hydrogen gas for three times. The resulting reaction mixture was stirred under Hydrogen atmosphere (1 atm) at ambient temperature for 6 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with Methanol and filtered through Celite pad. The Celite pad was washed with Methanol and the filtrate was concentrated under reduced pressure to give the crude cis-racemic tert-butyl 4- amino-5-fluoro-2,2-dimethylpiperidine-1 -carboxylate (1600 mg, crude) as a colourless liquid. The material was used in the next step directly without further purification. LC-MS (m / z): 247.23 [M+H]+.

[0691] Step-2: Synthesis of cis-racemic tert-butyl 4-((2-chloro-5-iodopyrimidin-4-yl)amino)-5- fluoro-2,2-dimethylpiperidine-1 -carboxylate:

[0692] To a stirred solution of cis-racemic tert-butyl 4-amino-5-fluoro-2,2-dimethylpiperidine-1- carboxylate (1600 mg, 6.49 mmol) in Ethanol (30 mL) at ambient temperature was added 2,4- dichloro-5-iodopyrimidine (1780 mg, 6.49 mmol) and N,N-Diisopropylethylamine (DIPEA) (3.39 mL, 19.49 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, solvent was removed under reduced pressure to give the crude material. It was diluted with water and extracted with Ethyl acetate (2 x 35 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the cis- racemic tert-butyl 4-((2-chloro-5-iodopyrimidin-4-yl)amino)-5-fluoro-2,2- dimethylpiperidine-1 -carboxylate (2000 mg, 57 % yield) as pale-yellow solid. The material was used in the next step without further purification. LC-MS (m / z): 485.07, 487.04 [M, M+2]+.

[0693] Step-3: Synthesis of cis-racemic tert-butyl 4-((2-chloro-5-((trimethylsilyl)ethynyl)pyrimidin- 4-yl)amino)-5-fluoro-2,2-dimethylpiperidine-1 -carboxylate:

[0694] To a stirred solution of cis-racemic tert-butyl 4-((2-chloro-5-iodopyrimidin-4-yl)amino)-5- fluoro-2,2-dimethylpiperidine-1 -carboxylate (2000 mg, 4.12 mmol) in Tetra hydrofuran (20 mL) at ambient temperature was added Ethynyltrimethylsilane (486 mg, 4.95 mmol), Copper (I) iodide (78.58 mg, 0.41 mmol), Tetrakis(triphenylphosphine)palladium (0) (47.68 mg, 0.041 mmol) and Triethylamine (2.88 mL, 20.63 mmol). The resulting reaction mixture was stirred at 60 °C under Nitrogen atmosphere for 16 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water, and extracted with Ethyl acetate (2 x 25 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the cis-racemic tert-butyl 4-((2-chloro-5-((trimethylsilyl)ethynyl)pyrimidin-4-yl)amino)-5- fluoro-2,2-dimethylpiperidine-1 -carboxylate (1200 mg, 63 % yield). The material was used in the next step directly without further purification. LC-MS (m / z): 455.51 , 457.52 [M, M+2]+. Step-4: Synthesis of cis-racemic tert-butyl 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-5- fluoro-2,2-dimethylpiperidine-1 -carboxylate (lnt-6):

[0695] To a stirred solution of cis-racemic tert-butyl 4-((2-chloro-5- ((trimethylsilyl)ethynyl)pyrimidin-4-yl)amino)-5-fluoro-2,2-dimethylpiperidine-1 - carboxylate (1200 mg, 2.64 mmol) in Acetonitrile (12 mL) at ambient temperature was added Caesium carbonate (Cs2CO3) (687 mg, 2.11 mmol). The resulting reaction mixture was stirred at 70 °C for 16 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water, and extracted with Ethyl acetate (2 x 25 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by Redi-Sep pre-packed silica gel column (40 g) and eluted with 0 - 20% Ethyl acetate in Petroleum ether to afford cis-racemic tert-butyl 4-(2-chloro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-5-fluoro-2,2-dimethylpiperidine-1 -carboxylate (lnt-6) (300 mg, 30 % yield). LC-MS (m / z): 383.41 , 385.43 [M, M+2]+.

[0696] Step-5: Synthesis of cis-racemic tert-butyl 5-fluoro-4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2- dimethylpiperidine-1 -carboxylate:

[0697] A microwave vial was charged with lnt-6 (350 mg, 0.94 mmol), lnt-4 (215 mg, 1.00 mmol), BrettPhosPdG3 (83 mg, 0.091 mmol), Sodium tert-butoxide (219 mg, 2.20 mmol) and Tetrahydrofuran (15 mL) at ambient temperature. The vial was sealed and purged with Nitrogen for 10 minutes. The resulting reaction mixture was stirred at 90 °C under microwave irradiation for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad, and the filtrate was concentrated under reduced pressure at below 45 °C to give the crude product. It was purified by flash column chromatography (silica gel) and eluted with 50 - 70 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated to afford cis-racemic tert-butyl 5-fluoro-4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2- dimethylpiperidine-1 -carboxylate (420 mg, 85 % yield) as pale yellow solid. LC-MS (m / z): 543.64 [M+H]+. Steps-6 and Step-7: Synthesis of Example 1 and Example 2:

[0698] To a stirred solution of cis-racemic tert-butyl 5-fluoro-4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-2,2- dimethylpiperidine-1-carboxylate (1100 mg, 2.0 mmol) in Dichloromethane (5.5 mL) at 0 °C was added a 4M solution of HCI in 1 ,4-Dioxane (18 mL). The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure, basified with saturated aqueous Sodium bicarbonate solution, and extracted with 10 % Methanol in Dichloromethane (2 x 50 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography and eluted with 80 - 90 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to give a mixture of Example 1 and Example 2 (750 mg, 84 % yield).

[0699] This mixture obtained above was subjected to SFC purification under the condition as described below. Peaks collected for each isomer were pooled, concentrated under reduced pressure, and lyophilized respectively to afford Example 1 (Peak-1 : retention time: 4.07 min) (290 mg, 32 % yield) and Example 2 (Peak-2: retention time: 7.33 minutes) (310 mg, 35 % yield). Absolute stereochemistry of gem-dimethyl F-piperidine of the two isomers was assigned arbitrarily.

[0700] Example 1 (Peak-1):

[0701] 1H NMR (400 MHz, DMSO-d6): 5 8.55 (s, 1 H), 7.15-7.14 (m, 1 H), 7.04 (d, J = 7.6 Hz, 1 H), 6.35 (d, J = 3.6 Hz, 1 H), 4.93-4.65 (m, 3H), 4.22 (br s, 1 H), 3.70-3.62 (m, 1 H), 3.46-3.43 (m, 1 H), 3.24- 3.17 (m, 1 H), 3.12-3.06 (m, 3H), 2.94 (s, 3H), 2.09-1.99 (m, 2H), 1.85-1.81 (m, 1 H), 1.70-1.58 (m, 2H), 1.16 (s, 3H), 1.15 (s, 3H). LC-MS (m / z): 443.34 [M+H]+.

[0702] Example 2 (Peak-2):

[0703] 1H NMR (400 MHz, DMSO-d6): 5 8.55 (s, 1 H), 7.15-7.14 (m, 1 H), 7.03 (d, J = 8.0 Hz, 1 H), 6.35 (d, J = 3.6 Hz, 1 H), 4.96-4.64 (m, 3H), 4.28-4.27 (br s, 1 H), 3.67-3.60 (m, 1 H), 3.46-3.43 (m, 1 H), 3.25-3.17 (m, 1 H), 3.13-3.05 (m, 3H), 2.94 (s, 3H), 2.07-1.99 (m, 2H), 1.84-1.82 (m, 1 H), 1.70- 1.58 (m, 2H), 1.16 (s, 3H), 1.15 (s, 3H). LC-MS (m / z): 443.30 [M+H]+.

[0704] SFC separation condition: Column / Dimensions: Lux; Amylose-3 (250X30X5p), Chiralpak AS-H (250X10X5p), % CO2: 75%, % Co solvent: 25% (0.5% Methanolic Ammonia in MeOH), Total Flow: 100 g / min, Back Pressure: 100.0 bar, Temperature: 30.0 °C, Wavelength: 236 nm, Stack time: 13.0 min, Loadability: 46 mg / injection, Solubility: 10 ml of MeOH+ACN+DCM.

[0705] The following compounds were synthesized by following the similar procedure as shown in Example 1 and Example 2. The relative stereochemistry of the gem-di-methyl-F-piperidine was known, the absolute stereochemistry of the structures was assigned arbitrarily.

[0706] Example 5: N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropipe ridin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2 -amine:

[0707] Example 5

[0708] Step-1 : Synthesis of tert-butyl (3S,4R)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (lnt-35):

[0709] To a stirred solution of 2,4-dichloro-5-iodopyrimidine (30000 mg, 109.1 mmol) and tert-butyl (3R,4S)-4-amino-3-fluoropiperidine-1-carboxylate (23820 mg, 109.1 mmol) in Ethanol (100 mL) at 0 °C was added N,N-Diisopropylethylamine (DIPEA) (57.0 mL, 327.4 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (300 mL) and extracted with Ethyl acetate (2 x 300 mL). The combined organic extract was washed with the Brine (300 mL), dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude material. It was triturated with Petroleum ether and stirred for 10 minutes. The solid was filtered, washed with Petroleum ether, and dried under reduced pressure to afford tert-butyl (3R,4S)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3-fluoropiperidine-1- carboxylate lnt-35) (32000 mg, 54 % yield) as an off-white solid.1H NMR (400 MHz, CDCI3): 5 8.31 (s, 1 H), 5.66 (d, J = 7.6 Hz, 1 H), 4.81-4.22 (m, 4H), 3.09-2.86 (m, 2H), 1.88-1.81 (m, 2H), 1.48 (s, 9H). LC-MS (m / z): 457.28, 459.30 [M, M+2]+.

[0710] Step-2: Synthesis of tert-butyl (3S,4R)-4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate:

[0711] A stirred solution of tert-butyl (3R,4S)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (26000 mg, 56.9 mmol), Copper (I) iodide (2169 mg, 11.4 mmol), Triethylamine (11520 mg, 15.9 mL, 113.9 mmol) and Potassium fluoride (6616 mg, 113.9 mmol) in Dimethylformamide (DMF) (208 mL) was purged with Nitrogen gas for 5 minutes. [1 ,1 - Bis (diphenylphosphino)ferrocene]dichloro palladium^ I) Complex with Dichloromethane (2325 mg, 2.8 mmol) was added. The mixture was purged with Nitrogen for 3 minutes, followed by the addition of trimethyl(prop-1-ynyl)silane (6391 mg, 8.5 mL, 56.9 mmol). The resulting reaction mixture was stirred at ambient temperature for 6 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was filtered through a Celite pad, and the Celite pad was washed with DMF (100 mL). The filtrate was diluted with ice water and stirred for 10 minutes. The precipitation formed was filtered, washed with water, and dried under reduced pressure to give tert-butyl (3R,4S)-4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (20000 mg, 52 % yield) as an off-white solid.1H NMR (400 MHz, CDCI3): 5 8.64 (s, 1 H), 6.28 (d, J = 0.8 Hz, 1 H), 5.25 (d, J = 10.4 Hz, 1 H), 4.79-4.49 (m, 3H), 3.32-2.58 (m, 3H), 1 .86 (s, 3H), 1 .87-1 .83 (m, 1 H), 1 .56 (s, 9H). LC-MS (m / z): 369.17, 371 .18 [M, M+2]+. Step-3: Synthesis of tert-butyl (3R,4S)-4-(2-chloro-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-7- yl)-3-fluoropiperidine-1 -carboxylate (lnt-7):

[0712] To a stirred solution of tert-butyl (3R,4S)-4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate (20000 mg, 54.22 mmol) in Tetra hydrofuran (THF) (50 mL) at ambient temperature was added Tetra-n-butylammonium fluoride trihydrate (34216 mg, 108.45 mL, 1 .000 mmolar, 108.45 mmol). The resulting reaction mixture was stirred at 70 °C for 3 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (200 mL) and extracted with Ethyl acetate (2 x 200 mL). The combined organic extract was washed with Brine (200 mL), dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by the Combi- flash column chromatography and eluted with 20 - 30 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated to afford fert-butyl(3R,4S)-4-(2-chloro-6- methyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine -1 -carboxylate (lnt-7) (10500 mg, 39 % yield) as an off-white solid.1H NMR (400 MHz, CDCI3): 5 8.67 (s, 1 H), 6.28 (d, J = 0.8 Hz, 1 H), 5.31-5.20 (m, 1 H), 4.79-4.49 (m, 3H), 3.49-3.18 (m, 1 H), 2.97-2.87 (m, 2H), 2.58 (s, 3H), 1.87-1.84 (m, 1 H), 1.55 (s, 9H). LC-MS (m / z): 369.17, 371.18 [M, M+2]+.

[0713] Step-4: Synthesis of tert-butyl (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)amino)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1- carboxylate:

[0714] To a stirred solution of lnt-7 (10000 mg, 27.11 mmol) and lnt-5 (7232 mg, 32.53 mmol) in Tetra hydrofuran (10 mL) was added Sodium tert-butoxide (5211 mg, 54.22 mmol) and purged with Nitrogen for 5 minutes. BrettPhosPdG3 (1229 mg, 1.36 mmol) was added. The reaction mixture was purged with Nitrogen for 3 minutes and then stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with Ethyl acetate (100 mL) and filtered through Celite pad. The celite pad was washed with Ethyl acetate (100 mL). The combined filtrate was concentrated under reduced pressure to give the crude material. It was diluted with water (200 mL) and extracted with Ethyl acetate (2 x 200 mL). The combined organic extract was washed with Brine (200 mL), dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by column chromatography and eluting with 30 - 50 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford the desired product, which containing trace of Palladium catalyst. The product obtained above was dissolved in Dichloromethane (10V) and Si-thiourea was added (2 times) and stirred for 16 hours at ambient temperature. The solution was filtered and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-(((3S,4S)-1- (cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin- 7-yl)-3-fluoropiperidine-1-carboxylate (10560 mg, 70 % yield) as an off-white solid.1H NMR (400 MHz, CDCI3): 5 8.45 (s, 1 H), 8.38 (s, 1 H), 6.07 (d, J = 0.8 Hz, 1 H), 5.32 (s, 1 H), 4.91-4.11 (m, 6H), 3.85-3.74 (m, 1 H), 3.56-3.55 (m, 1 H), 3.38-3.30 (m, 2H), 3.28-2.95 (m, 3H), 2.46-2.33 (m, 4H), 1.85-1.71 (m, 2H), 1.49 (s, 9H), 1.27-1.18 (m, 2H), 1.05-1.01 (m, 2H). LC-MS (m / z): 555.48 [M+H]+.

[0715] Step-5: Synthesis of N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)- 3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2 -amine (Example 5):

[0716] To a stirred solution of tert-butyl (3S,4R)-4-(2-(((3S,4S)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)amino)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1- carboxylate (14800 mg, 26.68 mmol) in Dichloromethane (150 mL) at ambient temperature was added a 4M solution of Hydrochloric acid in 1 ,4-Dioxane (7783 mg, 53.37 mL, 213.50 mmol). The resulting reaction mixture was stirred at ambient temperature for 4 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was triturated with Ethyl acetate (40 mL) and stirred for 10 minutes. The solid was filtered and washed with Ethyl acetate (20 mL) to give the crude product. It was neutralized to pH around 7 by adding saturated aqueous Sodium bicarbonate solution and stirred for 6 hours. The precipitation formed was filtered, washed water (50 mL), and dried under vacuum to afford N-((3S,4S)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine (Example 5) (10400 mg, 86 % yield) as an off-white solid.1H NMR (400 MHz, DMSO-d6): 5 8.37 (s, 1 H), 6.86 (d, J = 7.6 Hz, 1 H), 6.09 (d, J = 1.2 Hz, 1 H), 4.84-4.55 (m, 3H), 4.15 (br s, 1 H), 3.73-3.72 (m, 1 H), 3.51-3.48 (m, 1 H), 3.31-3.16 (m, 4H), 3.15-3.96 (m, 1 H), 2.88-2.75 (m, 1 H), 2.66-2.60 (m, 2H), 2.41 (s, 3H), 2.07-2.04 (m, 2H), 1.73-1.66 (m, 2H), 1.04-0.93 (m, 4H). LC-MS (m / z): 455.27 [M+H]+. Absolute stereochemistry was confirmed using single crystal X-ray diffraction.

[0717] The following compounds were synthesized by following the similar synthetic sequence as described in step-4 and step-5 in Example 5:

[0718] As mentioned in the above table, TFA was used in the deprotection of Boc group for Example 57. The experimental procedure is: To the Boc-protected intermediate (0.35 mmol) in Dichloromethane (4 mL) at 0 °C was added TFA (0.5 mL). The reaction mixture was stirred at ambient temperature for 1 hour. Solvent was removed under reduced pressure and the residue was purified by prep-HPLC as described in the general procedure.

[0719] Example 36: N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine:

[0720] Exampie 36

[0721] Step-1 : Synthesis of tert-butyl (3S,4R)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (lnt-35):

[0722] To a stirred solution of tert-butyl (3S,4R)-4-amino-3-fluoropiperidine-1-carboxylate (10000 mg, 45.81 mmol) in 1 ,4-Dioxane (100 mL) at ambient temperature under Argon atmosphere was added Triethylamine (12.7 mL, 91.6 mmol) and 2,4-dichloro-5-iodopyrimidine (13850 mg, 50.4 mmol). The resulting reaction mixture was stirred at ambient temperature for 10 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, solvent was removed under reduced pressure to give the crude residue. It was dissolved in Ethyl acetate, washed with water and brine, dried over anhydrous Sodium sulfate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by silica gel column chromatography (100-200 mesh) and eluted with 15 - 20 % Ethyl acetate in Petroleum ether to afford tert-butyl (3S,4R)-4- ((2-chloro-5-iodopyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (lnt-35) (16200 mg, 77.5 % yield) as a pale brown solid. LC-MS (m / z): 457.20, 459.11 [M, M+2]+. Step-2: Synthesis of tert-butyl (3S,4R)-4-((2-chloro-5-((trimethylsilyl)ethynyl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate:

[0723] A mixture of lnt-35 (5900 mg, 12.91 mmol), Copper (I) Iodide (Cui) (240 mg, 1.29 mmol), Triethylamine (9.3 mL, 64.5 mmol) and Tetrakis (triphenylphosphine)palladium (0) (150 mg, 0.12 mmol) in dry Tetra hydrofuran (THF) (10 mL) was purged with Argon gas for 5 minutes and Ethynyltrimethylsilane (1390 mg, 14.2 mmol) was added. The resulting reaction mixture was heated at 60 °C for 6 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad. The filtrate was washed with water, brine, dried over anhydrous Sodium sulfate, filtered, and concentrated under reduced pressure to give the crude tert-butyl (3S,4R)-4-((2-chloro-5-((trimethylsilyl)ethynyl)pyrimidin- 4-yl)amino)-3-fluoropiperidine-1 -carboxylate (5500 mg, crude). It was used in the next step as it is. LC-MS fm / z): 427.12, 429.12 [M, M+2]+.

[0724] Step-3: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluoropiperidine-1 -carboxylate (lnt-20):

[0725] To a stirred solution of tert-butyl (3S,4R)-4-((2-chloro-5-((trimethylsilyl)ethynyl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate (5500 mg, 12.8 mmol) in Acetonitrile (55 mL, 10V) was added Cesium carbonate (2090 mg, 6.44 mmol). The resulting reaction mixture was stirred at 60 °C for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad and the Celite pad was washed Ethyl acetate (2 x 50 mL). The combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by silica gel column chromatography (100-200 mesh) and eluted with 25 - 35 % Ethyl acetate in Petroleum ether to afford tert-butyl (3S,4R)-4-(2-chloro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (lnt-20) (2000 mg, 44 % yield in two steps) as an off-white solid.1H-NMR (400 MHz, CDCI3): 5 8.82 (s, 1 H), 7.48-7.42 (m, 1 H), 6.60 (d, J = 4.0 Hz, 1 H), 5.12-4.35 (m, 4H), 3.28-2.88 (m, 2H), 2.48-2.33 (m, 1 H), 1.89-1.72 (m, 1 H), 1.44 (s, 9H). LC-MS (m / z). 355.30, 357.32 [M, M+2]+.

[0726] Step-4: Synthesis of tert-butyl (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1- carboxylate:

[0727] To a stirred solution of lnt-20 (12000 mg, 33.80 mmol) and lnt-5 (12000 mg, 54.08 mmol) in Tetra hydrofuran (THF) (120 mL) was added Sodium tert-butoxide (4870 mg, 50.70 mmol) and BrettPhosPdG3 (920 mg, 1.01 mmol). The reaction mixture was purged with Nitrogen gas for 2 minutes and then stirred at ambient temperature for 5 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad, and the filtrate was concentrated under reduced pressure to give the crude product. It was purified by column chromatography using silica gel (100-200 mesh) and eluted with 40 - 60 % Ethyl acetate in Petroleum ether to afford tert-butyl (3S,4R)-4-(2-(((3R,4R)-1- (cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluoropiperidine-1 -carboxylate (12500 mg, 81.5 % yield) as a brown solid.

[0728] The material obtained above was dissovled in Dichloromethane (DCM) (125 mL) and Si-thiourea (25000 mg) was added. The resulting solution was stirred at ambient temperature 4 hours and filtered through Celite pad. The Celite pad was washed with Dichloromethane. The combined filtrate was concentrated under reduced pressure to dryness. The material obtained was treated again with Si-thiourea as described above and filtered. The filtrate was concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1- carboxylate (12100 mg, 79.0 % yield) as a pale brown solid. LC-MS (m / z): 541.49 [M+H]+.

[0729] Step-5: Synthesis of N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)- 3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidin-2-amine (Example 36):

[0730] To a stirred solution of tert-butyl (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1- carboxylate (30650 mg, 56.69 mmol) in Dichloromethane (DCM) (300 mL) at 0 °C was added 4M Hydrogen chloride (HCI) solution in 1 ,4-Dioxane (150 mL). The reaction was stirred at ambient temperature for 5 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated to half of its volume and basified to pH ~ 8 - 9 by adding saturated aqueous Sodium bicarbonate solution. The mixture was stirred at ambient temperature for 1 hour. Solid formed was filtered, washed with water, and dried under vacuum to give the desired product. It was dissolved in Acetonitrile I water (1 :1 , v / v), concentrated to dryness under reduced pressure, followed by washing with n-pentane and dried under vacuum to afford

[0731] N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin-4- yl)-7H-pyrrolo[2,3-d] pyrimidin-2-amine (Example 36) (20700 mg, 80.5 % yield) as an off-white solid.1H-NMR (400 MHz, DMSO-d6): 5 8.55 (s, 1 H), 7.16-7.14 (m, 1 H), 7.06 (d, J = 8.0 Hz, 1 H), 6.35 (d, J = 3.6 Hz, 1 H), 4.83-4.66 (m, 3H), 4.25 (br s, 1 H), 3.80-3.65 (m, 1 H), 3.55-3.45 (m, 1 H), 3.30-3.05 (m, 4H), 2.90-2.75 (m, 1 H), 2.70-2.60 (m, 2H), 2.25-2.05 (m, 3H), 1.75-1.60 (m, 2H), 1.05-0.95 (m, 4H). LC-MS (m / z)-. 441.36 [M+H]+. Absolute stereochemistry was confirmed using single crystal X-ray diffraction.

[0732] The following intermediates were synthesized by following the similar synthetic sequence as described in lnt-7:

[0733] lnt-23: cis-racemic tert-butyl 4-(2-chloro-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- hydroxypiperidine-1 -carboxylate:

[0734] Step-1 : Synthesis of cis-racemic tert-butyl 4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- hydroxypiperidine-1 -carboxylate:

[0735] To a solution of 2,4-dichloro-5-iodopyrimidine (2000 mg, 7.27 mmol), cis-racemic tert-butyl 4- amino-3-hydroxypiperidine-1 -carboxylate (1574 mg, 7.27 mmol) in Ethanol (20 mL) at ambient temperature was added Triethylamine (3.8 mL, 21.83 mmol) and the reaction mixture was continued stirring at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, solvent was removed under reduced pressure to give the crude product. It was purified using SepaBean T instrument (Silica gel: 100-200 mesh size, snap size-100 g, Eluents: Petroleum ether-Ethyl acetate (0-100 %)) to afford cis-racemic tert-butyl 4- ((2-chloro-5-iodopyrimidin-4-yl)amino)-3-hydroxypiperidine-1 -carboxylate (2400 mg, 56 % yield) as a white solid. LC-MS (m / z): 455.30, 457.18 [M, M+2]+. Step-2: Synthesis of cis-racemic tert-butyl 4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-hydroxypiperidine-1 -carboxylate:

[0736] To a stirred solution of cis-racemic tert-butyl 4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- hydroxypiperidine-1 -carboxylate (1000 mg, 2.20 mmol) in Dimethylformamide (DMF) (2 mL) at ambient temperature was added Tributyl(prop-1-yn-1-yl)stannane (1086 mg, 3.30 mmol). The resulting reaction mixture was purged with Nitrogen for 10 minutes. PdCI2(PPh3)2 (154 mg, 0.22 mmol) was added, and the reaction mixture was heated under microwave irradiation at 160 °C for 20 minutes. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite and the filtrate was concentrated under reduced pressure to give the crude product. It was purified using SepaBean machine T instrument (Neutral alumina snap size-50 g, Eluents: Petroleum ether-Ethyl acetate (0 - 100%)) to afford cis-racemic tert-butyl 4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4-yl)amino)-3-hydroxypiperidine-1- carboxylate (450 mg, 47 % yield) as brown gummy solid. LC-MS (m / z): 367.52, 369.51 [M, M+2]+.

[0737] Step-3: Synthesis of cis-racemic tert-butyl 4-(2-chloro-6-methyl-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-hydroxypiperidine-1 -carboxylate (lnt-23):

[0738] To a stirred solution of cis-racemic tert-butyl 4-((2-chloro-5-(prop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-hydroxypiperidine-1 -carboxylate (300 mg, 0.82 mmol) in Tetra hydrofuran (THF) (3 mL) at ambient temperature was added Tetra-n-butylammonium fluoride (TBAF) (214 mg, 0.82 mmol) and the resulting reaction mixture was heated at 60 °C for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water (20 mL), and extracted with Ethyl acetate (2 x 20 mL). The combined organic extract was concentrated under reduced pressure to give the crude product. It was purified using SepaBean machine T instrument (Silica gel: 100-200 mesh size, snap size-25 g, Eluents: Petroleum ether-Ethyl acetate (0 - 100 %)) to afford cis-racemic tert-butyl 4-(2-chloro-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-hydroxypiperidine-1- carboxylate (lnt-23) (250 mg, 67 % yield) as a white solid. LC-MS (m / z): 367.34, 369.40 [M, M+2]+. lnt-25: tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-ethoxypiperidine-1 - carboxylate:

[0739] Step-1 : Synthesis of tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- ethoxypiperidine-1 -carboxylate (lnt-25):

[0740] To a solution of lnt-24 (120 mg, 0.34 mmol) in Tetra hydrofuran (THF) (1 .2 mL) at 0 °C was added Sodium hydride (60 % dispersion in mineral oil) (31 mg, 1.29 mmol). The reaction mixture was stirred at 0 °C for 5 minutes and lodoethane (58 mg, 0.37 mmol) was added at the same temperature. The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate (2 x 10 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude compound. It was purified by silica gel flash column chromatography and eluted with 25 % Ethyl acetate in Petroleum-ether to afford tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-ethoxypiperidine-1 -carboxylate (lnt- 25) (60 mg, 47 % yield) as white gummy liquid. LC-MS (m / z): 381.23, 383.2 [M, M+2]+. The following intermediates were synthesized by following the similar procedure as described in lnt-25: lnt-26: tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-

[0741] (difluoromethoxy)piperidine-l -carboxylate: lnt-24 lnt-26

[0742] Step-1 : Synthesis of tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- (difluoromethoxy)piperidine-l -carboxylate (lnt-26):

[0743] To a stirred solution of lnt-24 (300 mg, 0.85 mmol) in Acetonitrile (3 mL) at ambient temperature was added 2,2-difluoro-2-(fluorosulfonyl) acetic acid (91 mg, 0.51 mmol) and Copper(l) iodide (32 mg, 0.17 mmol). The resulting reaction mixture was stirred at 50 °C for 3 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, quenched with saturated Sodium bicarbonate solution and extracted with Ethyl acetate (2 x 25 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by silica gel flash column chromatography and eluted with 5 - 10 % Ethyl acetate in Petroleum ether to afford tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-(difluoromethoxy) piperidine-1 -carboxylate (lnt-26) (100 mg, 29 % yield).

[0744] LC-MS (m / z): 403.19, 405.17 [M, M+2]+. lnt-28: tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-

[0745] (fluoro methoxy)piperidine-1 -carboxylate: Step-1 : Synthesis of tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- (fluoromethoxy)piperidine-l -carboxylate (lnt-28):

[0746] To a solution of lnt-24 (200 mg, 0.56 mmol) in Tetra hydrofuran (THF) (2 mL) at 0 °C was added Sodium hydride (60 % dispersion in mineral oil) (34 mg, 0.85 mmol). The reaction mixture was stirred at 0 °C for 5 minutes. Fluoroiodomethane (100 mg, 0.37 mmol) was added, and the reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was quenched with water and the extracted with Ethyl acetate (2 x 10 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by flash chromatography and eluted with 25 % Ethyl acetate in Petroleum-ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4S)-4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-

[0747] (fluoromethoxy)piperidine-l -carboxylate (lnt-28) (200 mg, 91 % yield). LC-MS f / n / z): 385.43, 387.44 [M, M+2]+. lnt-33: tert-butyl (3S,4R)-4-(6-chloro-1 H-pyrrolo[3,2-c]pyridin-1-yl)-3-fluoropiperidine-1- carboxylate:

[0748] Step-1 : Synthesis of tert-butyl (3S,4R)-4-(6-chloro-1 H-pyrrolo[3,2-c]pyridin-1 -yl)-3- fluoropiperidine-1 -carboxylate (lnt-33):

[0749] To a stirred solution of 6-chloro-1 H-pyrrolo[3,2-c]pyridine (200 mg, 1.31 mmol) in Toluene (2 mL) at ambient temperature was added tert-butyl (3S,4S)-3-fluoro-4-hydroxypiperidine-1 -carboxylate (344 mg, 1.57 mmol) and (Cyanomethylene) tributylphosphorane (474 mg, 1.97 mmol). The resulting reaction mixture was stirred at 110 °C for 6 hours. Progress of the reaction by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water, and extracted with Ethyl acetate (2 x 20 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 40 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(6-chloro-1 H-pyrrolo[3,2- c]pyridin-1-yl)-3-fluoropiperidine-1 -carboxylate (lnt-33) (300 mg, 65 % yield). LC-MS m / z)’. 354.4, 356.4 [M, M+2]+. lnt-34: 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidine:

[0750] Step-1 : Synthesis of 2-chloro-7-((3R,4S)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidine hydrochloride:

[0751] To a solution of lnt-20 (5000 mg, 14.09 mmol) in Dichloromethane (25 mL) at ambient temperature was added 4M HCI solution in 1 ,4-Dioxane (25 mL). The resulting reaction mixture was stirred at same temperature for 2 hours. Progress of the reaction was monitored by LC-MS and TLC. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was triturated with Diethyl ether, decanted, and dried under vacuum to give 2-chloro-7-((3R,4S)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidine hydrochloride (3900 mg, 95 % yield). The material was used in the next step directly without further purification. LC-MS (m / z). 255.26, 257.27 [M, M+2]+.

[0752] Step-2: Synthesis of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidine (lnt-34):

[0753] To a solution of 2-chloro-7-((3R,4S)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidine hydrochloride (10000 mg, 39.26 mmol) in 1 ,2-dichloroethane (100 mL) and Methanol (80 mL) at ambient temperature was added Triethyl amine (27.5 mL, 196.30 mmol) and Paraformaldehyde (3530 mg, 117.80 mmol). The resulting reaction mixture was stirred for 1 hour. Sodium triacetoxyborohydride (83220 mg, 392.60 mmol) was added in two portions and the reaction mixture was stirred at ambient temperature for 24 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water and extracted with Dichloromethane (3 x 120 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 30 - 40 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated to afford 2-chloro- 7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidine (lnt-34) (8000 mg, 87 % yield). LC-MS (m / z). 269.05, 271.06 [M, M+2]+. lnt-37: tert-butyl (3R,4S)-3-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-4-fluoropyrrolidine-1- carboxylate:

[0754] Step-1 : Synthesis of tert-butyl (3R,4S)-3-((2-chloro-5-iodopyrimidin-4-yl)amino)-4- fluoropyrrolidine-1 -carboxylate:

[0755] To a stirred solution of tert-butyl (3R,4S)-3-amino-4-fluoropyrrolidine-1 -carboxylate (2000 mg, 9.79 mmol) in Ethanol (20 mL) at 0 °C was added Diisopropylethylamine (DIPEA) (3780 mg, 29.37 mmol) drop-wise, followed by 2,4-dichloro-5-iodopyrimidine (2690 mg, 9.79 mmol). The resulting reaction mixture was stirred at ambient temperature for 12 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude product. It was purified by SepaBean flash column chromatography using silica gel (230-400 mesh) and eluted with 5 - 10 % Ethyl acetate in Petroleum ether to afford tert-butyl (3R,4S)-3-((2-chloro-5-iodopyrimidin-4-yl)amino)-4- fluoropyrrolidine-1 -carboxylate (1800 mg, 56 % yield) as a white solid. LC-MS (m / z) 443.12, 445.14 [M, M+2]+.

[0756] Step-2: Synthesis of tert-butyl (3R,4S)-3-((2-chloro-5-((trimethylsilyl)ethynyl) pyrimidin-4- yl)amino)-4-fluoropyrrolidine-1 -carboxylate:

[0757] To a stirred solution of tert-butyl (3R,4S)-3-((2-chloro-5-iodopyrimidin-4-yl)amino)-4- fluoropyrrolidine-1 -carboxylate (1800 mg, 4.67 mmol) in Tetrahydrofuran (THF) (18 mL) at ambient temperature were added Copper (I) Iodide (77 mg, 0.41 mmol) and Triethylamine (2050 mg, 23.35 mmol) and purged with Nitrogen for 5 minutes. Tetrakis(triphenylphosphine)palladium(0) (47 mg, 0.041 mmol) and TMS-acetylene (0.4 g, 4.07 mmol) were added. The reaction mixture was again purged with Nitrogen for 3 minutes and then stirred at 70 °C for 7 hours. Progress of the reaction was monitored by LC-MS and TLC. After completion, the reaction mixture was allowed to cool to ambient temperature and filtered through a Celite pad. The Celite pad was washed with Ethyl acetate (20 mL). The combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (230-400 mesh) and eluted with 10 - 20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3R,4S)-3-((2-chloro-5-((trimethylsilyl) ethynyl)pyrimidin-4- yl)amino)-4-fluoropyrrolidine-1 -carboxylate 5 (1100 mg. 66 % yield) as an off-white solid. LC- MS (m / z): 413.37, 415.50 [M, M+2]+.

[0758] Step-3: Synthesis of tert-butyl (3R,4S)-3-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-4- fluoropyrrolidine-1 -carboxylate (lnt-37):

[0759] To a solution of tert-butyl (3R,4S)-3-((2-chloro-5-((trimethylsilyl) ethynyl)pyrimidin-4- yl)amino)-4-fluoropyrrolidine-1 -carboxylate (1100 mg, 2.66 mmol) in Acetonitrile (11 mL) at ambient temperature was added Caesium carbonate (0.6 g, 1.86 mmol). The reaction mixture was stirred and heated at 70 °C for 6 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with Ethyl acetate (30 mL), and filtered through Celite pad. The celite pad was washed with Ethyl acetate (30 mL), and the combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (230- 400 mesh) and eluted with 10 - 20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3R,4S)-3-(2-chloro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-4-fluoropyrrolidine-1 -carboxylate (lnt-37) (600 mg, 66 % yield) as a yellow gummy solid. LC-MS (m / z)'. 341 .12, 343.13 [M, M+2]+. lnt-38: cis-racemic tert-butyl 4-hydroxy-2-(trifluoromethyl)piperidine-1 -carboxylate: Boc F F

[0760] (Cis-racemic)

[0761] !nt-38

[0762] To a stirred solution of te / t-butyl 4-oxo-2-(trifluoromethyl)piperidine-1 -carboxylate (1000 mg, 3.74 mmol) in Methanol (20 mL) at 0 °C was added Sodium borohydride (300 mg, 7.48 mmol) portionwise. The resulting reaction mixture was stirred at the same temperature for an hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, solvent was completely removed under reduced pressure, and the resulting crude reaction mixture was diluted with Ethyl acetate (200 mL) and washed with saturated Ammonium chloride solution (2 x 50 mL). The organic extract was dried over anhydrous Sodium sulfate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (100-200 mesh) and eluted with 15 % Ethyl acetate in Petroleum ether to afford cis-racemic tert-butyl 4-hydroxy-2-(trifluoromethyl)piperidine-1 -carboxylate

[0763] (lnt-38) (600 mg, 59 % yield) as a brown solid. LCMS (m / z): 214.02 [M+H-’Bu]+.

[0764] lnt-39: (3S,4S)-4-fluoro-1 -(methylsulfonyl)pyrrolidin-3-amine: p-

[0765] (Chiral pure) Step-1

[0766] Step-3

[0767] Step-1 : Synthesis of tert-butyl (3S,4S)-3-(((benzyloxy)carbonyl)amino)-4-fluoro pyrrolidine- 1 -carboxylate:

[0768] To a stirred solution of tert-butyl (3S,4S)-3-amino-4-fluoropyrrolidine-1 -carboxylate (2000 mg, 9.792 mmol) and Potassium carbonate (1759 mg, 1.3 Eq, 12.73 mmol) in Tetrahydrofuran (THF) (20 mL) and water (4 mL) at ambient temperature was added Benzyl chloroformate (2004 mg, 1.677 mL, 11.75 mmol) drop-wise. The resulting reaction mixture was stirred at ambient temperature for 3 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water and extracted with Ethyl acetate. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give tert-butyl (3S,4S)-3-(((benzyloxy) carbonyl)amino)-4- fluoropyrrolidine-1 -carboxylate (3300 mg, 99 % yield) as an off-white solid. It was used in the next step directly without further purification. LC-MS (m / z)-. 339.26 [M+H]+.

[0769] Step-2: Synthesis of benzyl((3S,4S)-4-fluoropyrrolidin-3-yl)carbamate:

[0770] To a stirred solution of tert-butyl (3S,4S)-3-(((benzyloxy)carbonyl)amino)-4-fluoropyrrolidine- 1-carboxylate (3200 mg, 9.457 mmol) in Dichloromethane (DCM) (20 mL) at ambient temperature was added 4M HCI solution in 1 ,4-dioxane (16 mL, 5V). The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was stirred with 20 % Ethyl acetate in Petroleum ether for 15 minutes and filtered. The solid obtained was washed with Petroleum ether and dried under vacuum to give benzyl ((3S,4S)-4-fluoropyrrolidin-3-yl)carbamate hydrochloride (2200 mg, 97 % yield) as an off-white solid. LC-MS (m / z): 239.10 [M+H]+.

[0771] Step-3: Synthesis of benzyl((3S,4S)-4-fluoro-1-(methylsulfonyl)pyrrolidin-3-yl) carbamate:

[0772] To a stirred solution of Sodium carbonate (4893 mg, 46.17 mmol) and benzyl ((3S,4S)-4- fluoropyrrolidin-3-yl)carbamate hydrochloride (2200 mg, 9.23 mmol) in Ethyl acetate (28.0 mL) and water (5.6 mL) at ambient temperature was added Methanesulfonyl chloride (1586 mg, 1.08 mL, 13.85 mmol) drop-wise. The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water and extracted with Ethyl acetate. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was stirred with 30 % Ethyl acetate in Petroleum ether for 15 minutes and filtered. Solid obtained was washed with 30 % Ethyl acetate in Petroleum ether dried under vacuum to give benzyl ((3S,4S)-4-fluoro-1- (methylsulfonyl)pyrrolidin-3-yl)carbamate (2800 mg, 96 % yield) as a white solid. It was used in the next step directly without further purification. LC-MS (m / z):317.09 [M+H]+.

[0773] Step-4: Synthesis of (3S,4S)-4-fluoro-1-(methylsulfonyl)pyrrolidin-3-amine (lnt-39):

[0774] To a stirred solution of benzyl ((3S,4S)-4-fluoro-1-(methylsulfonyl)pyrrolidin-3-yl)carbamate (2800 mg, 8.851 mmol) in Methanol (30.0 mL) and Ethyl acetate (9.0 mL) in a parr-shaker vessel at ambient temperature was added Palladium on carbon (1000 mg, 10 % Wt, 0.939 mmol) and Palladium hydroxide (400 mg, 20 % Wt, 0.569 mmol). The resulting reaction mixture in parrshaker vessel was degassed, backfilled with Hydrogen, and shaken at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad, and the Celite pad was washed with 10 % Methanol in Dichloromethane, followed by 10 % Methanol in Tetra hydrofuran. The combined filtrate was concentrated under reduced pressure to give the crude product. It was triturated with Ethyl acetate and stirred for 15 minutes. After filtration, solid obtained was washed with Ethyl acetate in Petroleum ether, and dried under vacuum to give (3S,4S)-4-fluoro-1- (methylsulfonyl)pyrrolidin-3-amine (lnt-39) (1500 mg, 92 % yield) as an off-white solid. LC-MS (m / z): 183.05 [M+H]+ I nt-40 : (3R,4R)-4-fluoro-1 -(methylsulfonyl)pyrrolidin-3-amine:

[0775] I nt-40 lnt-40 was synthesized by following the similar procedure as described in lnt-39. Starting with tert-butyl (3R,4R)-3-amino-4-fluoropyrrolidine-1 -carboxylate (2000 g, 9.792 mmol), the synthetic sequence afforded (3R,4R)-4-fluoro-1-(methylsulfonyl)pyrrolidin-3-amine (1250 mg, 70 % overall yield in four steps) as an off-white solid. LC-MS (m / z): 182.97 [M+H]+. lnt-41 : trans-racemic (1 R,5S)-2-fluoro-8-(methylsulfonyl)-8-azabicyclo[3.2.1]octan-3- amine: Step-1 : Synthesis of trans-racemic tert-butyl (1 R,5S)-3-(benzylamino)-2-fluoro-8- azabicyclo[3.2.1]octane-8-carboxylate:

[0776] To a stirred solution of tert-butyl (1 R,5S)-2-fluoro-3-oxo-8-azabicyclo[3.2.1]octane-8-carboxylate (4000 mg, 16.44 mmol), Benzyl amine (2640 mg, 24.66 mmol) and Acetic acid (1480 mg, 24.66 mmol) in Dichloromethane (DCM) (80 mL) at 0 °C under Nitrogen atmosphere was added Sodium triacetoxyborohydride (5230 mg, 24.66 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was quenched with 10 % aqueous Sodium carbonate solution (40 mL) and extracted with Dichloromethane (2 x 25 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (100-200 mesh) and eluted with 10 - 15 % Ethyl acetate in Petroleum ether to afford trans- racemic tert-butyl (1 R,5S)-3-(benzylamino)-2-fluoro-8-azabicyclo[3.2.1]octane-8- carboxylate (1020 mg, 19 % yield) as an off-white solid. LC-MS (m / z) 335.28 [M+H]+.

[0777] Step-2: Synthesis of trans-racemic tert-butyl (1R,5S)-3- (benzyl((benzyloxy)carbonyl)amino)-2-fluoro-8-azabicyclo[3.2.1]octane-8-carboxylate:

[0778] To a stirred solution of trans-racemic tert-butyl (1R,5S)-3-(benzylamino)-2-fluoro-8- azabicyclo[3.2.1]octane-8-carboxylate (1000 mg, 3.0 mmol) in 1 ,4-Dioxane (10 mL) and Water (2.0 mL) at 0 °C was added Sodium carbonate (480 mg, 4.5 mmol) and stirred for 15 minutes. Benzyl chloroformate (CbzCI) (640 mg, 3.7 mmol) was added, and the reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water (30 mL) and extracted with Ethyl acetate (2 x 25 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (100-200 mesh) and eluted with 15 - 20 % Ethyl acetate in Petroleum ether to afford trans-racemic tert-butyl (1 R,5S)-3- (benzyl((benzyloxy)carbonyl)amino)-2-fluoro-8-azabicyclo[3.2.1]octane-8-carboxylate (1100 mg, 78 % yield) as a colorless liquid. LC-MS (m / z) 413.23 [M+H-fBu]+.

[0779] Step-3: Synthesis of trans-racemic benzyl benzyl((1 R,5S)-2-fluoro-8- azabicyclo[3.2.1]octan-3-yl)carbamate hydrochloride:

[0780] To a stirred solution of trans-racemic tert-butyl (1 R,5S)-3- (benzyl((benzyloxy)carbonyl)amino)-2-fluoro-8-azabicyclo[3.2.1]octane-8-carboxylate

[0781] (1100 mg, 2.35 mmol) in Dichloromethane (DCM) (11 mL) at 0 °C was added 4M HCI solution in 1 ,4-Dioxane (11 mL). The resulting reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was triturated with Diethylether, decanted, and dried under vacuum to give trans-racemic benzyl benzyl((1 R,5S)- 2-fluoro-8-azabicyclo[3.2.1]octan-3-yl)carbamate hydrochloride (904 mg, 94 % yield) as an off-white solid. It was used in the next step directly without further purification. LC-MS (m / z)-.

[0782] 369.24 [M+H]+.

[0783] Step-4: Synthesis of trans-racemic benzyl benzyl((1 R,5S)-2-fluoro-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)carbamate:

[0784] To a stirred solution of trans-racemic benzyl benzyl((1 R,5S)-2-fluoro-8- azabicyclo[3.2.1]octan-3-yl)carbamate hydrochloride (900 mg, 2.44 mmol) in Dichloromethane (DCM) (18 mL) at 0 °C was added Triethylamine (1.02 mL, 7.33 mmol) and stirred for 15 minutes. Methanesulfonyl chloride (420 mg, 3.66 mmol) was added, and the resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with Dichloromethane (50 mL) and washed with 10 % aqueous Sodium bicarbonate solution (15 mL). The organic layer was separated, washed with Brine (5 mL), filtered, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (100-200 mesh) and eluted with 15 - 20 % Ethyl acetate in Petroleum ether to afford trans-racemic benzyl benzyl((1R,5S)- 2-fluoro-8-(methylsulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)carbamate (680 mg, 62 % yield) as a pale brown liquid. LC-MS (m / z)'. 447.24 [M+H]+.

[0785] Step-5: Synthesis of trans-racemic (1R,5S)-2-fluoro-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-amine (lnt-41):

[0786] To a stirred solution of trans-racemic benzyl benzyl((1R,5S)-2-fluoro-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)carbamate (480 mg, 1.075 mmol) in Methanol (14.4 mL) and Ethyl acetate (14.4 mL) was added 10 % Palladium on carbon (Pd / C) (240 mg, 50 % w / w) and 20 % Palladium hydroxide (Pd(OH)2) (48 mg, 10 % w / w). The resulting reaction mixture was degassed and stirred at ambient temperature under Hydrogen pressure (80 psi) for 24 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through a plug of Celite, and the filtrate was concentrated under reduced pressure to give the crude material. It was dissolved in Ethanol (3.4 mL) and Acetic acid (1 .4 mL). T o this solution, 10 % Palladium on carbon (Pd / C) (120 mg, 50 % w / w) and 20 % Palladium hydroxide (24 mg, 10 % w / w) were added. The reaction vessel was degassed and fitted with a Hydrogen ballon. It was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through a plug of Celite, and the filtrate was concentrated under reduced pressure to give the crude product. It was basified with saturated aqueous Sodium bicarbonate solution and extracted with 10 % Methanol in Dichloromethane. The organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give trans-racemic (1 R,5S)-2-fluoro-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-amine (lnt-41) (200 mg, 83 % yield) as a pale brown liquid. It was used in the next step directly without further purification. LC-MS (m / z)-. 223.02 [M+H]+. lnt-42: (3R,4R)-4-fluoro-1 -(methylsulfonyl)piperidin-3-amine:

[0787] Step-1 : Synthesis of tert-butyl ((3R,4R)-4-fluoro-1-(methylsulfonyl)piperidin-3- yl)carbamate:

[0788] To a stirred solution of tert-butyl ((3R,4R)-4-fluoropiperidin-3-yl)carbamate (230 mg, 1.05 mmol) in Dichloromethane (DCM) (4.6 mL) at 0 °C was added Triethylamine (0.441 mL, 3.16 mmol) and Methanesulfonyl chloride (0.0985 mL, 1.26 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by ELSD- MS and TLC. After completion, the reaction mixture was quenched with water (50 mL) and the extracted with Dichloromethane (2 x 50 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude tert-butyl ((3R,4R)-4-fluoro-1-(methylsulfonyl)piperidin-3-yl)carbamate (260 mg, 82 % yield). It was used in the next step directly without further purification. ELSD-MS (m / z)-. 241 .09 [M+H-’Bu]+.

[0789] Step-2: Synthesis of (3R,4R)-4-fluoro-1-(methylsulfonyl)piperidin-3-amine (lnt-42):

[0790] To a stirred solution of tert-butyl ((3R,4R)-4-fluoro-1-(methylsulfonyl) piperidin-3- yl)carbamate (250 mg, 0.84 mmol) in 1 ,4-Dioxane (2.5 mL) at 0 °C was added 4M HCI in dioxane (2.1 mL, 8.436 mmol). The resulting reaction mixture was stirred at ambient temperature for 3 hours. After completion, volatiles were removed under reduced pressure to give the crude material. It was triturated with Diethyl ether, decanted, and dried under vacuum to give (3R,4R)- 4-fluoro-1 -(methylsulfonyl)piperidin-3-amine hydrochloride (lnt-42) (175 mg, 88 % yield). The material was used in the next step without further purification. ELSD-MS (m / z): 197.06 [M+H]+.

[0791] Example 7: N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2 -amine:

[0792] Paraformaldehyde

[0793] Step-1 : Synthesis of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3- d]pyrimidine (lnt-8):

[0794] To a solution of lnt-7 (600 mg, 1 .627 mmol) in Dichloromethane (10 mL) at 0 °C was added a 4M solution of HCI in 1 ,4-Dioxane (4 mL, 16.270 mmol) and stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, solvent was removed under reduced pressure to give the crude material. It was neutralized with saturated aqueous Sodium bicarbonate solution and extracted with 10 % Methanol in Dichloromethane. The organic extract was dried over anhydrous Sodium sulphate and concentrated under reduced pressure to give 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3- d]pyrimidine (lnt-8) (420 mg, 90 % yield) as white gummy solid. It was used in the next step directly without further purification. LC-MS (m / z): 269.12, 271.14 [M, M+2]+. Step-2: Synthesis of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-methyl-7H- pyrrolo[2,3-d]pyrimidine (lnt-9):

[0795] To a solution of lnt-8 (400 mg, 1.48 mmol) in Dichloroethane (DCE) (15 mL) and Methanol (7.5 mL) at ambient temperature was added Triethylamine (1 mL, 7.44 mmol), followed by Paraformaldehyde (447 mg, 14.90 mmol). The reaction mixture was stirred for 2 hours. Sodium triacetoxyborohydride (946 mg, 4.47 mmol) was added, and the reaction was stirred at ambient temperature for overnight. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude product. It was purified using flash chromatography (Silica gel: 100-200 mesh size, snap size- 50g, Eluents: Dichloromethane-Methanol (0 - 15 %)). Fractions collected were pooled and concentrated to afford 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-methyl-7H- pyrrolo[2,3-d]pyrimidine (lnt-9) (283 mg, 63 % yield) as a white solid. LC-MS (m / z): 283.37, 285.39 [M, M+2]+.

[0796] Step-3: Synthesis of N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3- fluoro-1-methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine (Example 7):

[0797] To a stirred solution of lnt-9 (140 mg, 0.495 mmol) in THF (5 mL) in a microwave vessel at ambient temperature was added lnt-4 (145 mg, 0.743 mmol) and Sodium fe / f-butoxide (142 mg, 1.485 mmol). It was purged with Nitrogen gas for 10 minutes and then BrettPhosPdG3 (45 mg, 0.0495 mmol) was added. The reaction mixture was heated at 90 °C for 1 hour under microwave irradiation. Progress of the reaction was monitored by LC-MS. After completion, the reaction mixture was diluted with water (15 mL) and filtered through Celite pad. The filtrate was extracted with Ethyl acetate (2 x 15 mL). The combined organic extract was concentrated under reduced pressure to give the crude product as brown gummy solid. It was purified by prep HPLC purification under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford N-((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-6-methyl-7H- pyrrolo[2,3-d]pyrimidin-2-amine (Example 7) (16 mg, 7 % yield) as a white solid.1H NMR (400 MHz, DMSO-ds): 6 8.38 (s, 1 H), 6.86 (d, J = 8.0 Hz, 1 H), 6.10 (s, 1 H), 4.82-4.59 (m, 3H), 4.16 (br s, 1 H), 3.68-3.60 (m, 1 H), 3.44-3.40 (m, 1 H), 3.26-3.08 (m, 4H), 3.00-2.97 (m, 1 H), 2.94 (s, 3H), 2.40 (s, 3H), 2.33-2.13 (m, 5H), 2.10-2.05 (m, 1 H), 1.79 (d, J = 10.4 Hz, 1 H), 1.68-1.61 (m, 1 H). LC-MS (m / z): 443.28 [M+H]+. Prep-HPLC condition: Mobile phase A: 10 mM ABC, Mobile phase B: Acetonitrile, Column: X- BRIDGE [19-250] 5 pm, Flow: 19 ml / min, Method: (T / % of B): - 0 / 10, 2 / 30, 10 / 40, 12 / 40, 12.01 / 100, Solubility:- ACN+H2O+THF, Temperature: Ambient.

[0798] The following compounds were synthesized by following the similar procedure as described in Example 7. Example 8: N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- fluoropipe ridin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2 -amine:

[0799] Step-1 : Synthesis of 2-chloro-7-((3S,4S)-3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3- d]pyrimidine (lnt-11):

[0800] To a solution of lnt-10 (450 mg, 1.22 mmol) in Dichloromethane (5 mL) at 0 °C was added a 4M solution of HCI in 1 ,4-Dioxane (5 mL). The reaction was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC. After completion, solvent was removed under reduced pressure to give the crude material. It was neutralized with saturated aqueous Sodium bicarbonate solution and extracted with 10 % Methanol in Dichloromethane. The organic extract was dried over anhydrous sodium sulphate and concentrated under reduced pressure to give 2- chloro-7-((3S,4S)-3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidine (lnt-11) (300 mg, 91 % yield) as gummy solid. The material was used in the next step directly without further purification. LC-MS (m / z): 269.38, 271.40 [M, M+2]+.

[0801] Step-2: Synthesis of N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)- 3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2 -amine (Example 8):

[0802] To a solution of lnt-11 (90 mg, 0.335 mmol) in THF (4 mL) in a microwave vessel at ambient temperature was added lnt-5 (90 mg, 0.402 mmol) and Sodium tert-butoxide (48 mg, 0.501 mmol). The reaction mixture was purged with Nitrogen gas for 10 minutes and then BrettPhosPdG3 (30 mg, 0.0334 mmol) was added. The reaction mixture was heated at 90 °C for 1 hour under microwave irradiation. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water (20 mL) and passed through Celite pad. The filtrate was extracted with Ethyl acetate (2 x 20 mL). The combined organic extract was concentrated under reduced pressure to give the crude product. It was purified by Prep. HPLC under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford N-((3R,4R)-1-(cyclopropylsulfonyl)-3- fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3- d]pyrimidin-2-amine (Example 8) (10 mg, 6.5% yield) as a white solid.1H NMR (400 MHz, DMSO-ds): 5 8.39 (s, 1 H), 6.89-6.85 (m, 1 H), 6.08 (d, J = 1 .2 Hz, 1 H), 5.51-5.30 (m, 1 H), 4.80- 4.52 (m, 1 H), 4.29-4.10 (m, 2H), 3.74-3.68 (m, 1 H), 3.53-3.50 (m, 1 H), 3.36 (br s, 1 H), 3.27-3.26 (m, 1 H), 3.21-3.16 (m, 1 H), 2.98-2.95 (m, 1 H), 2.68-2.50 (m, 3H), 2.33-2.31 (m, 4H), 2.10-2.07 (m, 1 H), 1.81-1.78 (m, 1 H), 1.69-1.66 (m, 1 H), 1.05-0.94 (m, 4H). LC-MS (m / z): 455.31 [M+H]+. Prep-HPLC condition: Mobile phase A: 10 mM Ammonium bicarbonate (Aq), Mobile phase B: Acetonitrile: MeOH (70:30), Column: XselectcT PHENYL (150*19) mm, 5p, Flow: 16 ml / min, Method: (T / % of B): 0 / 20, 2 / 20, 10 / 60, Solubility: ACN+THF+H2O, Temperature: Ambient.

[0803] The following compounds were synthesized by following the similar synthetic sequence as described in Example 8. Example 32 and Example 33: mixture of Example 11 and Example 12 Example 32 Example 33

[0804] C s-Racemfc

[0805] To a stirred solution of cis-racemic N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7- (3-fluoroazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine hydrochloride (a mixture of Example 11 and Example 12) (250 mg, 0.54 mmol) in Methanol (5 mL) at ambient temperature was added Paraformaldehyde (162 mg, 5.38 mmol) and Acetic acid ( 0.031 mL, 0.54 mmol) and stirred for 1 hour. Sodium cyanoborohydride (101 mg, 1.61 mmol) was added, and the reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was quenched with saturated Sodium bicarbonate solution (40 mL) and extracted with 10 % Methanol in Dichloromethane (3 x 100 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC under the condition described below to give the cis-racemic N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4- yl)-7-(3-fluoro-1-methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine (80 mg, 33 % yield) as a white solid.

[0806] The cis-racemic material obtained above (80 mg, 0.18 mmol) was subjected to SFC chiral separation under the condition described below. Fractions collected from each isomer were pooled, concentrated, and lyophilized respectively to afford N-((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1-methylazepan-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-amine (Example 32, Peak-1) (28 mg, 12 % yield) and N-((3R, 4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1-methylazepan-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-amine (Example 33, Peak-2) (19 mg, 8 % yield) as white solid.

[0807] Prep-HPLC purification condition: Mobile phase A: 10 mM Ammonium bicarbonate, Mobile phase B:- Acetonitrile, Column:- X-SELECT CSH (19*150 mm), 5U, Mobile phase conditions (% Of B)- 0 / 40, 2 / 40, 10 / 45, 11 / 45, 11.1 / 100, 15 / 100, 15.1 / 40, 19 / 40, Solubility:- ACN-THF-WATER, Flow- 15 mL / minute.

[0808] SFC separation condition: Column / Dimensions: CHIRAL PAK OJ-H (250x30) mm; 5 pm, %CO2: 75%, %Co-solvent : 25%, (0.5% Methanolic ammonia in MeOH), Total Flow: 20 g / min, Back Pressure: 130 bar, Temperature: 30 °C, Wavelength: 236 nm, Stack time: 9.0 mins, Loadability: 2.8 g / inj, Solubility: 12 ml of ACN+MeOH, No of Injection: 35, Instrument details: Make / Model: SEPIATEC-50.

[0809] Example 32 (Peak-1):1H-NMR (400 MHz, DMSO-cfe): 6 8.54 (s, 1 H), 7.13-7.12 (m, 1 H), 7.05 (d, J = 8.0 Hz, 1 H), 6.35 (d, J = 3.6 Hz, 1 H), 5.04-4.85 (m, 2H), 4.80-4.65 (m, 1 H), 4.25 (br s, 1 H), 3.70-3.59 (m, 1 H), 3.49-3.40 (m, 1 H), 3.28-3.20 (m, 1 H), 3.15-2.98 (m, 2H), 2.94 (s, 3H), 2.78- 2.71 (m, 1 H), 2.68-2.54 (m, 2H), 2.39-2.32 (m, 4H), 2.07-2.05 (m, 1 H), 1 .84-1 .64 (m, 4H). LC-MS (m / z)'. 443.31 [M+H]+. SFC retention time: 2.105 minutes

[0810] Example 33 (Peak-2):1H-NMR (400 MHz, DMSO-cfe): 6 8.54 (s, 1 H), 7.13-7.12 (m, 1 H), 7.05 (d, J = 8.0 Hz, 1 H), 6.35 (d, J = 4.0 Hz, 1 H), 5.05-4.65 (m, 3H), 4.25 (br s, 1 H), 3.70-3.60 (m, 1 H), 3.44-3.42 (m, 1 H), 3.27-3.22 (m, 1 H), 3.15-2.98 (m, 5H), 2.78-2.71 (m, 1 H), 2.69-2.54 (m, 2H), 2.39-2.32 (m, 4H), 2.08-2.06 (m, 1 H), 1.84-1.65 (m, 4H). LC-MS (m / z): 443.31 [M+H]+.SFC retention time 2.865 minutes

[0811] Example 42:

[0812] Step-1 : Synthesis A / -((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro- 1-methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2 -amine (Example 42):

[0813] To a stirred solution of Example 41 (350 mg, 0.82 mmol) in 1 ,2-Dichloroethane (DCE) (4.8 mL) and Methanol (2.4 mL) was added Triethylamine (0.57 mL, 4.08 mmol) and stirred for 1 hour. The reaction mixture was cooled to 0 °C, Paraformaldehyde (245 mg, 8.16mmol) and Sodium triacetoxyborohydride (692 mg, 3.27 mmol) was added. The resulting reaction mixture was stirred at ambient temperature for 6 hours. The progress of the reaction was monitored by TLC and LC- MS. After completion, the reaction mixture was diluted with water and extracted with Dichloromethane. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by Combi Flash column chromatography and eluted with 10 % Methanol in Dichloromethane. Fractions collected were pooled and concentrated under reduced pressure to afford N-((3R,4R)- 3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1-methylpiperidin-4-yl)-6-methyl- 7H-pyrrolo[2,3-d]pyrimidin-2-amine (Example 42) (51 mg, 14 % yield) as an off white solid.

[0814] 1H NMR (400 MHz, DMSO-d6): 5 8.39 (s, 1 H), 6.88 (d, J = 7.6 Hz, 1 H), 6.09 (d, J = 1 .2 Hz, 1 H), 5.67-5.54 (m, 1 H), 4.81-4.64 (m, 1 H), 4.17-4.09 (m, 2H), 3.67-3.60 (m, 1 H), 3.44-3.37 (m, 1 H), 3.26-3.19 (m, 2H), 3.13-3.07 (m, 1 H), 2.94 (s, 3H), 2.84-2.81 (m, 2H), 2.32 (s, 3H), 2.29 (s, 3H), 2.13-2.07 (m, 3H), 1.81-1.77 (m, 1 H), 1.69-1.63 (m, 1 H). LC-MS (m / z): 443.31 [M+H]+. The following compounds were synthesized by following the similar procedure as described in Example 42:

[0815] Example 61 : N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7 -(piperazin-1- yl)pyrrolo[2,1-f][1,2,4]triazin-2-amine: Step-1 : Synthesis of 7-bromo-N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4- yl)pyrrolo[2,1-f][1,2,4]triazin-2-amine:

[0816] A mixture of 7-bromo-2-(methylsulfonyl)pyrrolo[2,1-f][1 ,2,4]triazine (400 mg, 1.44 mmol), (3R,4R)- 1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-amine (483 mg, 2.17 mmol), and Potassium carbonate (1000 mg, 7.24 mmol) in Dimethyl sulfoxide (DMSO) (4 mL) was purged with Nitrogen for 10 minutes and then heated at 120 °C for 30 minutes. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, quenched with water, and extracted with Ethyl acetate. The combined organic extract was dried over anhydrous Sodium sulphate and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography using silica gel (100-200 mesh) and eluting with 60 - 70 % Ethyl acetate in Petroleum ether to afford 7-bromo-N-((3R,4R)- 1 -(cyclopropyl sulfonyl)-3-fluoropiperidin-4-yl)pyrrolo[2,1 -f][1 ,2,4]triazin-2-amine (190 mg, 27 % yield) as a yellow solid. LC-MS (m / z): 417.85, 419.85 [M, M+2]+.

[0817] Step-2: Synthesis of tert-butyl 4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoro piperidin-4- yl)amino)pyrrolo[2,1 -f][1 ,2,4]triazin-7-yl)piperazine-1 -carboxylate:

[0818] A stirred solution of 7-bromo-N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4- yl)pyrrolo[2, 1 -f][1 ,2,4]triazin-2-amine (110 mg, 0.63 mmol) and tert-butyl piperazine-1 -carboxylate (73 mg, 0.39 mmol) in Tetra hydrofuran (THF) (2 mL) was purged with Argon gas for 5 minutes. Sodium tert-butoxide (38 mg, 0.39 mmol) was added, and the reaction mixture was purged again with Argon gas for 10 minutes. BrettPhosPdG3 (24 mg, 0.026 mmol) was added, and the resulting reaction mixture was stirred at 90 °C for 5 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water, and extracted with Ethyl acetate. The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by SepaBean Flash column chromatography using silica gel (230-400 mesh) and eluting with 50 - 70 % Ethyl acetate in Petroleum ether to afford tert-butyl 4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)pyrrolo[2,1- f][1 ,2, 4]triazin-7-yl)piperazine-1 -carboxylate (70 mg, 21 % yield) as a pale yellow solid. LC-MS (m / z): 524.35 [M+H]+.

[0819] Step-3: Synthesis of N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7- (piperazin-1 -yl)pyrrolo[2,1 -f] [1 ,2,4]triazin-2-amine (Example 61 ): To a stirred solution of tert-butyl 4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4- yl)amino)pyrrolo[2,1-f][1 ,2,4]triazin-7-yl)piperazine-1-carboxylate (70 mg, 0.13 mmol) in Dichloromethane (DCM) (2 mL) at ambient temperature was added a 4M solution of Hydrogen chloride (HCI) in 1 ,4-Dioxane (2 mL). The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, volatiles were removed under reduced pressure to give the crude product. It was purified by prep-HPLC purification under the condition described below to afford N- ((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-(piperazin-1-yl)pyrrolo [2,1- f][ 1 ,2,4]triazin-2-amine (Example 61) (15 mg, 25 % yield) as a yellow solid.

[0820] 1H NMR (400 MHz, 400 MHz, DMSO-cfe): 6 8.55 (s, 1 H), 6.89 (d, J = 7.6 Hz, 1 H), 6.67 (d, J = 4.4

[0821] Hz, 1 H), 6.21 (d, J = 4.8 Hz, 1 H), 4.85-4.72 (m, 1 H), 3.98-3.97 (m, 1 H), 3.70-3.65 (m, 1 H), 3.52-

[0822] 3.49 (m, 1 H), 3.28-3.26 (m, 1 H), 3.17-3.12 (m, 5H), 2.89-2.87 (m, 4H), 2.67-2.61 (m, 1 H), 2.12-

[0823] 2.09 (m, 1 H), 1.71-1.68 (m, 1 H), 1.04-0.93 (m, 4H). LC-MS (m / z): 424.30 [M+H]+.

[0824] Prep-HPLC separation condition: Mobile phase A: 10 mM Ammonium bicarbonate (Aq), Mobile phase B: Acetonitrile, Column: YMC C18 PACKED [19-250] 5 Um, Flow: 20 ml / min, Method: (T / % of B):- 0 / 15, 2 / 25, 10 / 35, 14.6 / 35, 14.61 / 100, 18 / 100, 18.01 / 15, 22 / 15, Solubility: ACN+Water+THF, Temperature: Ambient.

[0825] Example 64: (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-yl)amino)-N-methylpiperidine-1 -sulfonamide: 4M HCI in dioxane

[0826] BrettphosPdG3, NaOtBu 0 "C-RT, 1 h

[0827] Step-4

[0828] THF, 80 °C, 1 h

[0829] Step-3

[0830] Step-1 : Synthesis of 2-chloro-7-((3R,4S)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidine:

[0831] To a stirred solution of lnt-20 (2000 mg, 5.63 mmol) in Dichloromethane (DCM) (20 mL) at 0° C was added a 4 M Hydrogen chloride (HCI) solution in 1 ,4-Dioxane (20 mL). The reaction mixture was stirred at ambient temperature for 4 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to give 2-chloro- 7-((3S,4R)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidine as an HCL salt (2000 mg, 72 % yield). It was used in the next step directly without further purification. LC-MS (m / z): 255, 257 [M, M+2]+.

[0832] Step-2: Synthesis of 2-chloro-7-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidine (lnt-31):

[0833] To a solution of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidine (2000 mg, 7.87 mmol) in Dichloroethane (DCE) (20 mL) and Methanol (MeOH) (10 mL) at 0°C was added Triethyl amine (TEA) (5.2 mL, 39.37 mmol) and Paraformaldehyde (2360 mg, 78.74 mmol) and stirred for 20 minutes at the same temperature. Sodium triacetoxyborohydride (STAB) (5000 mg, 23.62 mmol) was added. The reaction mixture was stirred at ambient temperature for 48 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was diluted with water and extracted with Ethyl acetate (2 x 50 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give 2-chloro- 7-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidine (lnt-31) as an off- white solid (1200 mg, 56 % yield). It was used in the next step without furhter purification. LC-MS (m / z): 269.11 , 271.13 [M, M+2]+.

[0834] Step-3: Synthesis of tert-butyl (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1-methyl piperidin- 4-yl)-7H-pyrrolo[2,3-d] pyrimidin-2-yl) amino) piperidine-1 -carboxylate:

[0835] A solution of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidine (400 mg, 1.49 mmol), tert-butyl (3R,4R)-4-amino-3-fluoropiperidine-1-carboxylate (488 mg, 2.23 mmol) in Tetrahydrofuran (THF) (12 mL) at ambient temperature was purged with Argon gas for 10 minutes. Sodium tert-butoxide (214 mg, 2.23 mmol) and BrettPhosPdG3 (134 mg, 0.149 mmol) were added, and the resulting reaction mixture was stirred under Argon atmosphere at 80 °C for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature and filtered. The filtrate was concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (100-200 mesh) and eluted with 0 - 5% Methanol in Dichloromethane to afford tert-butyl (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-yl)amino) piperidine-1 -carboxylate (500 mg, 53 % yield) as a pale brown liquid. LC-MS (m / z): 451 .44 [M+H]+.

[0836] Step-4: Synthesis of 7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N-((3R,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidin-2-amine:

[0837] To a stirred solution of tert-butyl (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4- yl)-7H-pyrrolo[2,3-d]pyrimidin-2-yl)amino) piperidine-1 -carboxylate (500 mg, 1.10 mmol) in Dichloromethane (DCM) (5 mL) at 0 °C was added 4M HCI solution in 1 ,4-Dioxane (5 mL). The resulting reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude product. It was triturated with 20 % Ethyl acetate in Petroleum ether, decanted, and dried under reduced pressure to afford 7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-N-((3R,4R)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2- amine hydrochloride (450 mg, 88 % yield) as a pale brown solid. LC-MS (m / z): 351.47 [M+H]+.

[0838] Step-5: Synthesis of (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H- pyrrolo[2,3-d] pyrimidin-2-yl) amino)-N-methylpiperidine-1 -sulfonamide (Example 64):

[0839] To a stirred solution of 7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N-((3R,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine hydrochloride (170 mg, 0.44 mmol) in Dichloromethane (DCM) (6.8 mL) at 0 °C was added Triethylamine (0.3 mL, 2.20 mmol), followed by Methylsulfamoyl chloride (22 mg, 0.44 mmol). The reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was slowly quenched with ice water and extracted with Dichloromethane. The organic layer was separated, washed with Brine, dried over anhydrous Sodium sulphate, and concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC purification under the separation condition described below. Fraction collected were pooled, concentrated, and lyophilized to afford (3R,4R)-3-fluoro-4-((7-((3S,4R)-3- fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidin-2-yl) amino)-N- methylpiperidine-1 -sulfonamide (Example 64) (24 mg, 12 % yield) as an off-white solid.1H- NMR (400 MHz, DMSO-cfe): 6 8.54 (s, 1 H), 7.16 (dd, J = 3.6 Hz, 2.4 Hz, 2H), 7.04 (d, J = 8.0 Hz, 1 H), 6.35 (d, J = 3.6 Hz, 1 H), 4.94-4.81 (m, 1 H), 4.67-4.64 (m, 2H), 4.20 (br s, 1 H), 3.70-3.55 (m, 1 H), 3.45-3.35 (m, 1 H), 3.20-2.90 (m, 4H), 2.53 (s, 3H), 2.45-2.35 (m, 1 H), 2.25 (s, 3H), 2.32-2.16 (m, 2H), 2.05-1 .95 (m, 1 H), 1 .80-1 .75 (m, 1 H), 1 .65-1 .55 (m, 1 H). LC-MS (m / z): 444.27 [M+H]+.

[0840] Prep-HPLC condition: Mobile phase A: 10 mM Ammonium bicarbonate (Aq), Mobile phase B: Acetonitrile, Column: X BRIDGE C18 (19*150) 5U, Flow: 15 ml / min, Method: (T / % of B):- 0 / 20, 2 / 30, 8 / 35, 8.7 / 100, 12 / 100, 12.01 / 20, 15 / 20, Solubility: ACN+Water+THF, Temperature: Ambient.

[0841] Example 68: N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2- amine: Step-1 : tert-butyl (3S,4R)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3-fluoropiperidine-1- carboxylate:

[0842] To a stirred solution of tert-butyl (3S,4R)-4-amino-3-fluoropiperidine-1 -carboxylate (23820 mg, 109.1 mmol) in Ethanol (375 mL) at 0 °C was added Diisopropyl ethyl amine (DIPEA) (47.5 mL, 272.9 mmol) and 2,4-dichloro-5-iodopyrimidine (25000 mg, 91 .0 mmol). The reaction mixture was stirred at ambient temperature for 12 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate. The organic extract was washed with the Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 10 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced vacuum pressure to afford tert-butyl (3S,4R)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (27000 mg, 65 % yield). LC-MS (7n / z : 457.24, 459.26 [M, M+2]+.

[0843] Step-2: tert-butyl (3S,4R)-4-((2-chloro-5-(3,3-diethoxyprop-1-yn-1-yl)pyrimidin-4-yl)amino)- 3-fluoropiperidine-1 -carboxylate:

[0844] To a stirred solution of tert-butyl (3S,4R)-4-((2-chloro-5-iodopyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (15000 mg, 32.85 mmol) in Tetrahydrofuran (THF) (150 mL) at ambient temperature was added Triethylamine (13.7 mL, 98.54 mmol) and purged with Nitrogen for 10 minutes. Cuprous iodide (625 mg, 3.28 mmol) was added, followed by Tetrakis(triphenylphosphine)palladium(0) (759 mg, 0.66 mmol) and Propynal diethyl acetal (4631 mg, 36.13 mmol). The reaction mixture was stirred at 70 °C for 12 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature, quenched with water, and extracted with Ethyl acetate (2 x 100 mL). The organic extract was washed with the Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 13 % Ethyl acetate in Hexane. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-((2-chloro-5-(3,3- diethoxyprop-1-yn-1-yl)pyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (12000 mg, 80 % yield). LC-MS (7n / z : 457.35, 459.36 [M, M+2]+.

[0845] Step-3: tert-butyl (3S,4R)-4-(2-chloro-6-(diethoxymethyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)- 3-fluoropiperidine-1 -carboxylate: To a stirred solution of tert-butyl (3S,4R)-4-((2-chloro-5-(3,3-diethoxyprop-1-yn-1- yl)pyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (12000 mg, 26.26 mmol in Acetonitrile (120 mL) at ambient temperature was added Caesium carbonate (Cs2CO3) (8557 mg, 26.26 mmol). The reaction mixture was stirred at 70 °C for 12 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature, quenched with water, and extracted with Ethyl acetate (2 x 100 mL). The organic extract was washed with the Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 15 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced vacuum pressure to give tert-butyl (3S,4R)-4-(2-chloro- 6-(diethoxymethyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (10000 mg, 83 % yield). LC-MS fm / z): 457.2, 459.18 [M, M+2]+.

[0846] Step-4: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-formyl-7H-pyrrolo[2,3-d] pyrimidin-7- yl)-3-fluoropiperidine-1 -carboxylate:

[0847] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-(diethoxymethyl)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (10000 mg, 21.88 mmol) in Tetrahydrofuran (THF) (50 mL) and water (50 mL) at ambient temperature was added Acetic acid (30 mL). The resulting reaction mixture was stirred at 70 °C for 3 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water, and extracted with Ethyl acetate (3 x 150 mL). The combined organic extract was washed sequentially with water (100 mL), aqueous saturated Sodium bicarbonate solution and Brine. The organic layer was separated, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give tert-butyl (3S,4R)-4-(2-chloro-6-formyl-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine- 1 -carboxylate (8000 mg, 83.5 % yield, crude). It was used in the next step directly without further purification. LC-MS (m / z) 383.18, 385.19 [M, M+2]+.

[0848] Step-5: Synthesis of 7-((3S,4R)-1 -(tert-butoxycarbonyl)-3-fluoropiperidin-4-yl)-2-chloro-7H- pyrrolo[2,3-d]pyrimidine-6-carboxylic acid:

[0849] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-formyl-7H-pyrrolo[2,3-d]pyrimidin-7- yl)-3-fluoropiperidine-1-carboxylate (8000 mg, 20.9 mmol) in Tetra hydrofuran (THF) (80 mL), water (9 mL), and tert-Butanol (80 mL) at ambient temperature was added 2-methyl-2-butene (40 mL, 385.0 mmol), Sodium dihydrogen orthophosphate (7500 mg, 62.7 mmol) and Sodium chlorite (9400 mg, 104.5 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted water and extracted with Ethyl acetate (2 x 100 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 50 % Ethyl acetate in Petroleum ether to afford 7-((3S,4R)-1-(tert-butoxycarbonyl)- 3-fluoropiperidin-4-yl)-2-chloro-7H-pyrrolo[2,3-d]pyrimidine-6-carboxylic acid (6500 mg, 78 % yield). LC-MS (m / z) 399.11 , 401 .09 [M, M+2]+.

[0850] Step-6: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-(hydrazinecarbonyl)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate:

[0851] To a stirred solution of 7-((3S,4R)-1-(tert-butoxycarbonyl)-3-fluoropiperidin -4-yl)-2-chloro- 7H-pyrrolo[2,3-d]pyrimidine-6-carboxylic acid (6000 mg, 15.04 mmol) in Dimethylformamide (DMF) (60.0 mL) at 0 °C was added Diisopropylethylamine (DIPEA) (7.6 mL, 45.13 mmol), Hexafluorophosphate azabenzotriazole tetramethyl uranium (HATU) (8500 mg, 22.57 mmol), and Hydrazine hydrate (1000 mg, 30.09 mmol). The resulting reaction mixture was stirred at ambient temperature for 3 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate (2 x 80 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 80 % Ethyl acetate in Petroleum ether to afford tert-butyl (3S,4R)-4-(2-chloro-6-(hydrazinecarbonyl)-7H-pyrrolo[2,3-d]pyrimidin-7- yl)-3-fluoropiperidine-1 -carboxylate (1500 mg, 24 % yield). LC-MS (m / z)-. 413.19, 415.16 [M, M+2]+.

[0852] Step-7: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-(4-methyl-5-thioxo-4,5-dihydro-1 H- 1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate:

[0853] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-(hydrazinecarbonyl)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (1500 mg, 3.63 mmol) in Methanol (15 mL) at ambient temperature was added Isothiocyanatomethane (790 mg, 10.90 mmol). The resulting reaction mixture was stirred at ambient temperature for 16 hours. After completion, the reaction mixture was concentrated under reduced pressure to give the crude intermediate. It was dissolved in Ethanol (EtOH) (15 mL) and Triethylamine (1.5 mL, 10.9 mL) was added. The resulting reaction mixture was heated at 70 °C for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, volatiles were removed under reduced pressure to give the crude material. It was diluted with water and extracted with Ethyl acetate. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 20 % Ethyl acetate in Petroleum ether to afford tert-butyl (3S,4R)-4-(2-chloro-6- (4-methyl-5-thioxo-4,5-dihydro-1H-1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluoropiperidine-1 -carboxylate (1000 mg, 59 % yield). The material was used as it is.

[0854] Step-8: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate:

[0855] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-(4-methyl-5-thioxo-4,5-dihydro-1H- 1, 2, 4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (1000 mg, 2.13 mmol) in Dichloromethane (DCM) (5 mL) at 0 °C was added Acetic acid (2 mL) and Hydrogen peroxide (H2O2) (30 % aqueous solution, 1 mL). The resulting reaction mixture was stirred at same temperature for 2 hours. Progress of the reaction was monitored by TLC and LC- MS. After completion, the reaction mixture was diluted with water and extracted with Ethyl acetate (2 x 30 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 40 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-chloro-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluoropiperidine-1 -carboxylate (800 mg, 70 % yield). LC-MS (m / z)-. 436.12, 438.09 [M, M+2]+.

[0856] Step-9: Synthesis of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-(4-methyl-4H-1,2,4- triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidine:

[0857] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (800 mg, 1.83 mmol) in Dichloromethane (DCM) (4 mL) at 0 °C was added 4M HCI solution in 1 ,4-Dioxane (4 mL). The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, volatiles were removed under reduced pressure to give the crude material. It was basified with saturated aqueous Sodium bicarbonate solution and extracted with Dichloromethane. The organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give 2-chloro-7-((3S,4R)- 3-fluoropiperidin-4-yl)-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidine (600 mg, 88 % yield). It was used in the next step directly without further purification. LC-MS (m / z). 336.15, 338.13 [M, M+2]+.

[0858] Step-10: Synthesis of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-(4-methyl-4H- 1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidine:

[0859] To a solution of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-(4-methyl-4H-1,2,4-triazol-3-yl)- 7H-pyrrolo[2,3-d]pyrimidine (350 mg, 1.04 mmol) in 1 ,2-Dichloroethane (2 mL) and Methanol (0.5 mL) at 0 °C was added Triethylamine (0.73 mL, 5.27 mmol) and stirred for 10 minutes. Paraformaldehyde (313 mg, 10.42 mmol) was added. The reaction mixture was stirred at 0 °C for 1 hour. Sodium triacetoxyborohydride (196 mg, 3.12 mmol) was added in two portions with an interval of 2 hours. The resulting reaction mixture was stirred at ambient temperature for 12 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water and extracted with Dichloromethane (2 x 50 mL). The combined organic extracted was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 80 % Ethyl acetate in Petroleum ether to afford 2-chloro-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidine (250 mg, 76 % yield). LC-MS (m / z). 350.14, 352.16 [M, M+2]+.

[0860] Step-11 : Synthesis of N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3- fluoro-1 -methylpiperidin-4-yl)-6-(4-methyl-4H-1,2,4-triazol-3-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-amine (Example 68):

[0861] To a solution of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-(4-methyl-4H-1,2,4- triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidine (200 mg, 0.57 mmol) in Tetrahydrofuran (THF) (1.5 mL) at ambient temperature was added (3R,4R)-3-fluoro-1 -(methyl sulfonyl)piperidin-4-amine (0.13 mg, 0.68 mmol) and Sodium tert-butoxide (66 mg, 0.68 mmol). The mixture was purged with Argon gas for 3 minutes. BrettPhosPdG3 (52 mg, 0.057 mmol) was added, and the reaction mixture was heated at 90 °C for 1 hour under microwave irradiation. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with 10 % Methanol in Dichloromethane (10 ml) and filtered through Celite pad. The filtrate was concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC purification using the condition described below. Fractions collected were pooled, concentrated, and lyophilized to afford N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3- fluoro-1 -methylpiperidin-4-yl)-6-(4-methyl-4H-1 ,2,4-triazol-3-yl)-7H-pyrrolo [2,3- d]pyrimidin-2-amine (Example 68) (20 mg, 6.5 % yield) as an off-white solid.1H-NMR (400 MHz, DMSO-cfe): 6 8.67 (s, 2H), 7.23 (br s, 1 H), 6.88 (s, 1 H), 4.98-4.72 (m, 3H), 4.19 (br s, 1 H), 3.68- 3.52 (m, 5H), 3.45-3.43 (m, 1 H), 3.26-3.21 (m, 1 H), 3.16-3.03 (m, 2H), 2.95-2.91 (m, 4H), 2.19- 1.96 (m, 6H), 1.79-1.72 (m, 2H). LC-MS (m / z). 510.36 [M+H]+.

[0862] Prep-HPLC purification condition: Mobile phase A: 10 mM Ammonium Bicarbonate in water, Mobile phase B: Acetonitrile, Column: YMC C18 (30*150 mm) 10U, Mobile phase conditions (%

[0863] Of B)-0 / 40, 2 / 40, 10 / 45, 11 / 45, 11.1 / 100, 15 / 100, 15.1 / 40, 19 / 40, Solubility: ACN+THF+water, Flow- 15 mL / min.

[0864] Example 69: 7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N-((1 R,5S)-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine:

[0865] Step-1 : Synthesis of tert-butyl (1 R,5S)-3-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-yl)amino)-8-azabicyclo[3.2.1]octane-8-carboxylate: To a solution of lnt-34 (200 mg, 0.74 mmol) in Tetrahydrofuran (THF) (5 mL) at ambient temperature was added tert-butyl (1 R,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate (251 mg, 1.11 mmol), followed by Sodium tert-butoxide (106 mg, 1.11 mmol). The reaction mixture was purged with Argon gas for 5 minutes. BrettphosPdG3 (63 mg, 0.07 mmol) was added, and the reaction mixture was backfilled with Argon gas and stirred at 90 °C under microwave irradiation for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with Ethyl acetate and filtered through Celite pad. The filtrate was concentrated under reduced pressure to give the crude product. It was purified by silica gel column chromatography (100-200 mesh) and eluted with 10 % Methanol in Dichloromethane to afford tert-butyl (1R,5S)-3-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidin -2-yl)amino)-8-azabicyclo[3.2.1]octane-8-carboxylate as brown liquid (220 mg, 64.7 % yield). LC-MS (m / z). 459.50 [M+H]+.

[0866] Step-2: Synthesis of A / -((1R,5S)-8-azabicyclo[3.2.1]octan-3-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine:

[0867] To a solution of tert-butyl (1 R,5S)-3-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-yl)amino)-8-azabicyclo[3.2.1] octane-8-carboxylate (200 mg, 0.43 mmol) in 1 ,4-Dioxane (3 mL) at 0 °C was added 4.0 M HCI solution in 1 ,4-Dioxane (1 mL). The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, volatiles were completely removed under reduced pressure to get the crude material. It was basified with saturated aqueous Sodium bicarbonate solution and extracted with Dichloromethane. The organic extract was dried over anhydrous Sodium sulfate, filtered, and concentrated under reduced pressure to give N-((1 R,5S)- 8-azabicyclo[3.2.1]octan-3-yl)-7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-amine (180 mg) as an off-white solid. The material was used in the next step directly without further purification. LC-MS (m / z): 359.21 [M+H]+.

[0868] Step-3: Synthesis of 7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N-((1 R,5S)-8-

[0869] (methylsulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine (Example 69): To a solution of N-((1 R,5S)-8-azabicyclo[3.2.1]octan-3-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine (180 mg, 0.5 mmol) in Dichloromethane (DCM) (5 mL) at 0 °C was added Triethylamine (2.1 mL, 1.5 mmol) and stirred for 5 minutes. Mesyl chloride (0.04 mL, 0.6 mmol) was added dropwise, and the reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the solvent was completely removed under reduced pressure to give the crude material. It was dissolved with Ethyl acetate (50 mL) and washed with water (2 x 50 mL), followed by Brine. The organic extract was dried over anhydrous Sodium sulfate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford 7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N- ((1 R,5S)-8-(methylsulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2- amine (Example 69) (32.4 mg, 15.9 % yield) as an off-white solid.1H NMR (400 MHz, DMSO): 5 8.51 (s, 1 H), 7.13-7.12 (dd, J = 3.6 Hz, 2.0 Hz, 1 H), 6.73 (d, J = 7.2 Hz, 1 H), 6.32 (d, J = 3.6 Hz, 1 H), 4.98-4.96 (m, 1 H), 4.65-4.53 (m, 1 H), 4.29-4.27 (m, 1 H), 4.17 (br s, 2H), 3.20-3.12 (m, 1 H), 2.98-2.94 (m, 4H), 2.46-2.39 (m, 1 H), 2.37-2.16 (m, 5H), 2.13-1.97 (m, 4H), 1.81-1.79 (m, 3H), 1.60-1.57 (m, 2H). LC-MS (m / z): 437.33 [M+H]+.

[0870] Prep-HPLC purification condition: purification using, Mobile phase A: 10 mM Ammonium bicarbonate (Aq), Mobile phase B: Acetonitrile Column: X-BRIDGE C18 (19*150 mm), Solubility: AC +Water+THF.

[0871] Example 70: N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine:

[0872] Paraformaldehyde. STAB BrettPhosPdG3. NaO'Bu

[0873] DCt, MeOH THF, 100 °C. 1 h RT. 12 h

[0874] Step-7

[0875] Step-6

[0876] Step-1 : Synthesis of tert-butyl (3R,4S)-4-((2-chloro-5-((trimethylsilyl)ethynyl) pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate:

[0877] To a stirred solution of lnt-35 (40000 mg, 87.58 mmol) in Tetrahydrofuran (THF) (400 mL) at ambient temperature was added Copper (I) iodide (1660 mg, 8.75 mmol), Triethylamine (37 mL, 262.70 mmol), TMS-acetylene (27000 mg, 175.8 mmol) and Pd(PPh3)4 (51000 mg, 4.46 mmol). The resulting reaction mixture was purged with Nitrogen gas for 10 minutes and then heated at 60 °C for 3 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad, and the celite pad was washed with Ethyl acetate (150 mL). The combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 30 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-((2-chloro-5-((trimethylsilyl)ethynyl)pyrimidin-4-yl)amino)-3- fluoropiperidine-1 -carboxylate (26000 mg, 70 % yield) as an off-white solid. LC-MS (m / z) 427.47, 429.49 [M, M+2]+.

[0878] Step-2: Synthesis of tert-butyl (3S,4R)-4-((2-chloro-5-(iodoethynyl)pyrimidin-4-yl) amino)- 3-fluoropiperidine-1 -carboxylate:

[0879] To a stirred solution tert-butyl (3S,4R)-4-((2-chloro-5-((trimethylsilyl) ethynyl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate (12000 mg, 28.10 mmol) in Dimethylformamide (DMF) (120 mL) at -10 °C was added N-lodosuccinimide (9400 mg, 42.16 mmol) and Silver nitrate (7160 mg, 42.16 mmol). The resulting reaction mixture was stirred at -10 °C for 30 minutes. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was poured in ice water, and the solid obtained was filtered and dried. The solid was dissolved in Ethyl acetate (200 mL), washed with water and Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 7 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4- ((2-chloro-5-(iodoethynyl)pyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (7000 mg, 52 % yield). LC-MS (m / z): 481.02, 483.04 [M, M+2]+.

[0880] Step-3: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-iodo-7H-pyrrolo[2,3-d] pyrimidin-7-yl)- 3-fluoropiperidine-1 -carboxylate:

[0881] To a stirred solution of tert-butyl (3S,4R)-4-((2-chloro-5-(iodoethynyl) pyrimidin-4-yl)amino)- 3-fluoropiperidine-1-carboxylate (7000 mg, 14.56 mmol) in Tetra hydrofuran (THF) (70 mL) at ambient temperature was added Tetrabutylammonium fluoride (1 M in THF) (36.40 mL, 36.40 mmol). The resulting reaction mixture was stirred at 70 °C for 3 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with aqueous saturated Ammonium chloride solution and extracted with Ethyl acetate. The organic extract was washed with water and Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 25 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-chloro-6-iodo-7H- pyrrolo[2,3-d] pyrimidin-7-yl)-3-fluoro piperidine-1 -carboxylate (5000 mg, 71 % yield). LC- MS (m / z) W\ A4, 483.1 [M, M+2]+.

[0882] Step-4: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-(prop-1-yn-1-yl)-7H-pyrrolo [2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (lnt-43):

[0883] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-iodo-7H-pyrrolo [2,3-d]pyrimidin-7-yl)- 3-fluoropiperidine-1 -carboxylate (5000 mg, 10.4 mmol) in Dimethylformamide (DMF) (50 mL) at ambient temperature was added Triethylamine (2.9 mL, 20.8 mmol), [1 ,1'- Bis(diphenylphosphino)ferrocene]dichloropalladium (II) complex with dichloromethane (255 mg, 0.3 mmol), Potassium fluoride (906 mg, 15.6 mmol), Cuprous iodide (198 mg, 1.0 mmol) and Trimethyl(prop-1-ynyl)silane (3.09 mL, 20.8 mmol) in sequence. The resulting reaction mixture was purged with Nitrogen gas for 10 minutes and then stirred at ambient temperature for 12 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through Celite pad, and the Celite pad was washed with Ethyl acetate. The combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 12 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4- (2-chloro-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1- carboxylate (lnt-43) (3000 mg, 73 % yield). LC-MS (m / z) 393.17, 395.18 [M, M+2]+.

[0884] Step-5: Synthesis of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H- pyrrolo[2,3-d]pyrimidine hydrochloride:

[0885] To a stirred solution of lnt-43 (3000 mg, 7.63 mmol) in Dichloromethane (DCM) (15 mL) at 0 °C was added 4M HCI solution in 1 ,4-Dioxane (15 mL). The resulting reaction mixture was stirred at ambient temperature for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give 2-chloro-7- ((3S,4R)-3-fluoropiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidine hydrochloride (2700 mg crude). It was used in the next step as it is. LC-MS m / z)’. 293.04, 295.05 [M, M+2]+.

[0886] Step-6: Synthesis of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-(prop-1-yn-1- yl)-7H-pyrrolo[2,3-d]pyrimidine: To a solution of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3- d]pyrimidine hydrochloride (2700 mg, 8.2 mmol) in 1 ,2-Dichloroethane (22 mL) and Methanol (8 mL) at 0 °C was added Triethylamine (3.4 mL, 24.6 mmol) and stirred for 10 minutes. Paraformaldehyde (2460 mg, 82.02 mmol) was added, and the reaction mixture was stirred at 0 °C for 1 hour. Sodium triacetoxyborohydride (5.21 g, 24.6 mmol) was added in two portions with an interval of 2 hours. The resulting reaction mixture was stirred at ambient temperature for 12 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water and extracted with Dichloromethane (DCM) (4 x 40 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give 2-chloro-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d] pyrimidine (2100 mg, 89 % yield in two steps). The material was used in the next step without further purification. LC-MS (m / z). 307.19, 309.20 [M, M+2]+.

[0887] Step-7: Synthesis of N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3- fluoro-1-methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d] pyrimidin-2-amine (Example 70):

[0888] To a solution of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H- pyrrolo[2,3-d] pyrimidine (500 mg, 1.6 mmol) in Tetrahydrofuran (THF) (5 mL) at ambient temperature was added (3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-amine (960 mg, 4.8 mmol) and Sodium tert-butoxide (NaO’Bu) (313 mg, 3.2 mmol). The resulting reaction mixture was purged with Argon gas for 5 minutes. BrettPhosPdG3 (148 mg, 0.16 mmol) was added, and the reaction mixture was heated at 100 °C for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature and filtered through a Celite pad. The filtrate was concentrated under reduced pressure to give the crude product. It was purified by flash-column chromatography and eluted with 2 % Methanol in Dichloromethane. Fractions collected were pooled and concentrated under reduced pressure to afford N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d] pyrimidin-2 -amine (420 mg, 55 % yield). 50 mg of the product obtained was further purified by prep-HPLC purification under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7- ((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-dJ pyrimidin-2 - amine (Example 70) (8 mg, 16 % yield) as an off-white solid.1H-NMR (400 MHz, DMSO-cfe): 6 8.50 (s, 1 H), 7.15 (br s, 1 H), 6.61 (s, 1 H), 4.78-4.54 (m, 3H), 4.15 (br s, 1 H), 3.69-3.53 (m, 2H), 3.43-3.38 (m, 1 H), 3.23-3.15 (m, 1 H), 3.17-3.07 (m, 2H), 3.01- 2.98 (m, 1 H), 2.94 (s, 3H), 2.31-2.18 (m, 4H), 2.12-2.07 (m, 5H), 1 .82-1 .80 (m, 1 H), 1 .68-1 .64 (m, 1 H). LC-MS (m / z) 467.30 [M+H]+. Prep-HPLC separation condition: Mobile phase A: 10 mM Ammonium bicarbonate in water, Mobile phase B: Acetonitrile, Column: XS CSH (19*150) 5 p, Mobile phase conditions (% Of B)- 0 / 43, 11 / 43, 11.01 / 100, 14 / 100, 14.01 / 43, 18 / 43, Solubility:- AC N-T HF- Water, Flow- 15 mL / min.

[0889] Example 71 (1S,3R,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol and Example 72 (1R,3S,4S)-3- fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexan-1 -ol:

[0890] Example 71 Example 72 Step-1 : Synthesis of ((1,4-dioxaspiro[4.5]dec-7-en-8-yl)oxy)trimethylsilane:

[0891] To a stirred solution of 1 ,4-dioxaspiro[4.5]decan-8-one (5000 mg, 32.01 mmol) in Dimethylformamide (DMF) (13 mL) at ambient temperature was added Triethylamine (11.1 mL, 80.02 mmol) and Trimethylsilyl chloride (7650 mg, 70.42 mmol) . The resulting reaction mixture was stirred at 80 °C for 22 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate (2 x 100 mL). The combined organic layer was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude ((1,4- dioxaspiro[4.5]dec-7-en-8-yl)oxy)trimethylsilane (5000 mg, crude). The material was used in the next step directly without further purification.

[0892] Step-2: Synthesis of 7-fluoro-1,4-dioxaspiro[4.5]decan-8-one (lnt-36):

[0893] To a stirred solution of ((1,4-dioxaspiro[4.5]dec-7-en-8-yl)oxy) trimethylsilane (5000 mg, 21.89 mmol) in Acetonitrile (50.0 mL) at 0 °C was added Selectfluor II (7000 mg, 21.89 mmol). The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate (2 x 80 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by silica gel flash column chromatography and eluted with 10% Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford 7-fluoro-1,4-dioxaspiro[4.5]decan-8-one (lnt-36) (2000 mg, 48 % overall yield in two steps). LC-MS (m / z) 175.24 [M+H]+.

[0894] Step-3: Synthesis of cis-racemic 7-fluoro-1,4-dioxaspiro[4.5]decan-8-ol:

[0895] To a stirred solution of 7-fluoro-1,4-dioxaspiro[4.5]decan-8-one (6000 mg, 34.4 mmol) in Tetra hydrofuran (THF) (60.0 mL) at -78 °C was added L-Selectride (2M in THF, 22.1 mL, 44.2 mmol). The resulting reaction mixture was stirred at same temperature for 3 hours. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate. The organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 10 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford cis-racemic 7-fluoro-1,4-dioxaspiro[4.5]decan- 8-ol (3500 mg, 58 % yield).1H-NMR (400 MHz, DMSO-cfe): 6 4.91-4.89 (m, 1 H), 4.65-4.40 (m, 1 H), 3.94-3.81 (m, 5H), 2.05-1.97 (m, 1 H), 1.84-1.82 (m, 1 H), 1.73-1.65 (m, 2H), 1.49-1.37 (m, 2H).

[0896] Step-4: Synthesis of cis-racemic 7 7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl 4- methylbenzenesulfonate:

[0897] To a stirred solution of cis-racemic 7-fluoro-1,4-dioxaspiro[4.5]decan-8-ol (3300 mg, 18.72 mmol) in Dichloromethane (DCM) (60 mL) at ambient temperature was added 4-4- (Dimethylamino)pyridine (DMAP) (4570 mg, 37.45 mmol) and p-Toluenesulfonyl chloride (5350 mg, 28.09 mmol) . The resulting reaction mixture was stirred at ambient temperature for 3 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water and extracted with Ethyl acetate (3 x 50 mL). The combined organic extract was washed with water and Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 10% Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford cis-racemic 7-fluoro-1,4- dioxaspiro[4.5]decan-8-yl 4-methylbenzenesulfonate (4700 mg, 76 % yield).1H-NMR (400 MHz, DMSO-cfe): 6 7.80 (d, J = 8.0 Hz, 2H), 7.47 (d, J = 8.0 Hz, 2H), 4.92-4.88 (m, 1 H), 4.72-4.58 (m, 1 H), 3.88-3.81 (m, 4H), 2.42 (s, 3H), 2.00-1 .95 (m, 1 H), 1.89-1.76 (m, 2H), 1.61-1.51 (m, 3H).

[0898] Step-5: Synthesis of trans-racemic 2-chloro-7-(7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)-7H- pyrrolo[2,3-d]pyrimidine:

[0899] To a stirred solution of cis-racemic 7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl 4- methylbenzenesulfonate (4700 mg, 14.22 mmol) in Dimethylformamide (DMF) (12 mL) at ambient temperature was added 2-chloro-7H-pyrrolo[2,3-d]pyrimidine (2170 mg, 14.22 mmol) and Caesium carbonate (6910 mg, 21.27 mmol) . The resulting reaction mixture was stirred at 100 °C for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water, and extracted with Ethyl acetate (3 x 50 mL). The combined organic extract was washed with water and Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography and eluted with 20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford trans-racemic 2-chloro-7-(7-fluoro-1,4- dioxaspiro[4.5]decan-8-yl)-7H-pyrrolo[2,3-d]pyrimidine (4000 mg, 90 % yield). LC-MS (m / z) 312.26, 314.23 [M, M+2]+.

[0900] Step-6: Synthesis of trans-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1 -one:

[0901] A mixture of trans-racemic 2-chloro-7-(7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)-7H- pyrrolo[2,3-d]pyrimidine (430 mg, 1.38 mmol) in Trifluoro acetic acid (TFA):water (3 mL:1.5 mL) was stirred at -10 °C for 30 minutes. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water, basified with saturated aqueous Sodium bi-carbonate solution (~pH 7) and extracted with Ethyl acetate (3 x 20 mL). The combined organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give trans-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1 -one (320 mg, Crude). The material was used in the next step directly without further purification. LC-MS (m / z)-. 268.45, 270.49 [M, M+2]+.

[0902] Step-7: Synthesis of trans-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1 -ol:

[0903] To a stirred solution of trans-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1-one (2000 mg, 11 .23 mmol) in Tetrahydrofuran (THF) (30 mL) at -78 °C was added L-Selectride (1 M in THF) (14.6 mL, 14.6 mmol). The resulting reaction mixture was stirred for 3 hours at same temperature. Progress of the reaction was monitored by TLC and LC- MS. After completion, the reaction mixture was quenched with water and extracted with Ethyl acetate. The organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by flash column chromatography (40 g, silica gel column) and eluted with 0 - 50 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford trans- racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluorocyclohexan-1-ol (175 mg, 19 % overall yield in two steps) as a pale yellow solid. The relative stereochemistry of the hydroxy group in the molecule is trans to the 3-Fluoro group. LC-MS (m / z): 270.26, 272.28 [M, M+2]+.

[0904] Step-8: Synthesis of trans-racemic (3-fluoro-4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1 -ol: To a stirred solution of trans-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1-ol (130 mg, 0.50 mmol), (3R,4R)-3-fluoro-1 -(methyl sulfonyl)piperidin-4- amine (125 mg, 0.65 mmol) and Sodium tert-butoxide (72 mg, 0.75 mmol) in Tetra hydrofuran (THF) (3 mL) at ambient temperature was added BrettphosPdG3 (45 mg, 0.05 mmol). The resulting reaction mixture was purged with Nitrogen gas for 5 minutes, and then stirred at 60 °C for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with 10 % Methanol in Dichloromethane, and passed through Celite pad. The filtrate was concentrated under reduced pressure to give the crude product. It was purified by prep. HPLC purification under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford trans-racemic (3-fluoro-4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (60 mg, 28 % yield) as a mixture of two stereo-isomers. LC-MS (m / z): 430.47 [M+H]+.

[0905] Prep-HPLC condition: Mobile phase A: 10 mM Ammonium bicarbonate (Aq), Mobile phase B: Acetonitrile, Column: X-SELECT PHENYL HEXYL [19-250] 5 Um, Flow: 14 ml / minutes, Method: (T / % of B):- 0 / 45, 2 / 55, 8 / 70, 12.5 / 70, 12.7 / 100, 16 / 100, 16.2 / 45, 20 / 45, Solubility: ACN+Water+THF, Temperature: Ambient.

[0906] Step-9: SFC separation of Example 71 and Example 72: trans-racemic (3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (300 mg) was subjected to SFC purification under the SFC condition described below. Fractions collected for each isomer were pooled, concentrated under reduced pressure, and lyophilized respectively to afford (1S,3R,4R)-3- fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexan-1-ol (Example 71 , peak-1 , SFC retention time: 3.81 min) (25 mg, 8.3 % yield) and (1R,3S,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (Example 72, peak-2, SFC retention time: 7.43 min) (20 mg, 6.7 % yield) as off-white solid. Absolute stereochemistry of the two isomers were assigned arbitrarily. Example 71 (peak-1):

[0907] 1H-NMR (400 MHz, DMSO-d6): 5 8.52 (s, 1 H), 7.26 (d, J = 3.6 Hz, 1 H), 6.99 (d, J = 8.0 Hz, 1 H), 6.36 (d, J = 3.6 Hz, 1 H), 5.49-5.20 (m, 1 H), 4.90-4.50 (m, 3H), 4.30-4.10 (m, 2H), 3.72-3.60 (m, 1 H), 3.50-3.40 (m, 1 H), 3.20-3.02 (m, 2H), 2.94 (s, 3H), 2.40-2.20 (m, 2H), 2.12-2.02 (m, 1 H), 1.80-1.52 (m, 5H). LC-MS (m / z): 430.26 [M+H]+. SFC retention time: 5.22 minutes.

[0908] Example 72 (peak-2):

[0909] 1H-NMR (400 MHz, DMSO-d6): 6 8.52 (s, 1 H), 7.26 (d, J = 3.6 Hz, 1 H), 6.99 (d, J = 8.0 Hz, 1 H), 6.36 (d, J = 3.6 Hz, 1 H), 5.45-5.18 (m, 1 H), 4.90-4.49 (m, 3H), 4.30-4.10 (m, 2H), 3.71-3.62 (m, 1 H), 3.50-3.40 (m, 1 H), 3.20-3.02 (m, 2H), 2.94 (s, 3H), 2.45-2.25 (m, 2H), 2.13-2.04 (m, 1 H), 1.80-1.51 (m, 5H). LC-MS (m / z): 430.26 [M+H]+. SFC retention time: 7.43 minutes.

[0910] Preparative SFC Conditions Column / Dimensions : Chiralpak AD-H (250X30X5p) % CO2 : 80% % Co solvent : 20% (100% Ethanol ) Total Flow : 100 g / min Back Pressure : 100.0 bar Temperature : 30.0° C Wavelength : 237 nm Stack time : 16.24 min Loadability : 9.75 mg / injection Solubility : 10mL of Ethanol No of Injection : 9

[0911] Instrument details: Make / Model: SFC-150-009

[0912] Example 73: (1 S,3S,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol and Example 74: (1 R,3R,4S)-3- fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexan-1 -ol:

[0913] Step-1 : Synthesis of trans-racemic 7-fluoro-1 ,4-dioxaspiro[4.5]decan-8-ol:

[0914] To a stirred solution of lnt-36 (17000 mg, 97.61 mmol) in Tetra hydrofuran (THF) (60 mL) and Methanol (12 mL) at 0 °C was added Sodium borohydride (NaBH4) (7380 mg, 195.20 mmol) portion-wise. The reaction mixture was allowed to slowly warm to ambient temperature and stirred for 1 hour. After completion, the reaction mixture was quenched with ice water (50 mL) and the extracted with Ethyl acetate (2 x 70 mL). The combined organic extract was washed with Brine (20 mL), dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by SepaBean flash column chromatography and eluted with 15 - 30 % Ethyl acetate in Hexanes. Fractions collected were pooled and concentrated under reduced pressure to afford trans-racemic 7-fluoro-1,4- dioxaspiro[4.5]decan-8-ol (14800 mg, 86 % yield) as liquid.

[0915] Step-2: Synthesis of cis-racemic 2-chloro-7-(7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)-7H- pyrrolo[2,3-d]pyrimidine:

[0916] To a stirred solution of trans-racemic 7-fluoro-1,4-dioxaspiro[4.5]decan-8-ol (2960 mg, 19.30 mmol) in Toluene (20 mL) at 0 °C was added (cyanomethylene)tributylphosphorane (6980 mg, 28.95 mmol) drop-wise. The resulting reaction mixture was heated at 100 °C for 12 hours. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was allowed to cool to ambient temperature and concentrated under reduced pressure to give the crude material. Ice water (30 mL) was added, and the crude material was extracted with Ethyl acetate (2 x 50 mL). The combined organic extract was washed with saturated Brine (20 mL), dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by SepaBean flash column chromatography and eluted with 0 - 2 % Ethyl acetate in Dichloromethane. Fraction collected were pooled and concentrated under reduced pressure to afford cis-racemic 2-chloro-7-(7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)- 7H-pyrrolo[2,3-d]pyrimidine (2450 mg, 36 % yield) as solid. LC-MS (m / z) 312.35, 314.37 [M, M+2]+.

[0917] Step-3: Synthesis of cis-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1 -one:

[0918] A solution of cis-racemic 2-chloro-7-(7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)-7H-pyrrolo[2,3- d]pyrimidine (1000 mg, 3.18 mmol) in TFA (30 mL) and Water (3 mL) at -10 °C was stirred for 30 minutes. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was diluted with water (10 mL). Solid Sodium bicarbonate (2000 mg) was added to adjust the solution pH~7. The aqueous solution was extracted with Ethyl acetate (2 x 50 mL). The combined organic extract was washed with saturated Brine (20 mL), dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give cis-racemic 4-(2-chloro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluorocyclohexan-1-one (800 mg, 74 % yield). It was used in the next step without further purification. LC-MS (m / z)-. 268.36, 270.34 [M, M+2]+. Step-4: Synthesis of cis-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1 -ol:

[0919] To a stirred solution of cis-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1-one (800 mg, 2.98 mmol) in Tetrahydrofuran (THF) (10 mL) at -78 °C was added L-Selectride (1 M in THF) (738 mg, 3.88 mmol) drop wise. The resulting reaction mixture was stirred at -78 °C for 2 hours. Progress was monitored by TLC and LC-MS. After completion, the reaction mixture was quenched with saturated aqueous Ammonium chloride solution (10 mL) and extracted with Ethyl acetate (2 x 70 mL). The combined organic extract was washed with Brine (20 mL), dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by SepaBean flash column chromatography and eluted with 0 - 10 % Ethyl acetate in Dichloromethane. Fraction collected were pooled and concentrated under reduced pressure to afford cis-racemic 4-(2-chloro-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluorocyclohexan-1-ol (650 mg, 80 % yield). The relative stereochemistry of the hydroxy group is cis- to the 3-fluoro group. LC-MS (m / z)-. 269.97, 272.02 [M, M+2]+.

[0920] Step-5: Synthesis of cis-racemic 3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-

[0921] (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-l-ol:

[0922] A stirred solution of cis-racemic 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluorocyclohexan-1-ol (600 mg, 2.22 mmol) and lnt-4 (436 mg, 2.22 mmol) in Tetrahydrofuran (THF) (6 mL) at ambient temperature was purged with Nitrogen gas for 5 minutes. Sodium tert- butoxide (321 mg, 3.33 mmol) was added, and the reaction mixture was purged with Nitrogen gas for another 3 minutes. BrettphosPdG3 (201 mg, 0.22 mmol) was added. The resulting reaction mixture was stirred at 65 °C for 1.5 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered through celite pad, and the Celite pad was washed with 10 % Methanol in Dichloromethane. The combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC purification under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford cis-racemic 3-fluoro-4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (55 mg, 6.6 % yield) as an off-white solid.

[0923] Prep-HPLC condition: Mobile phase A:- 10 mM Ammonium bicarbonate (Aq), Mobile phase B:- Acetonitrile, Column:- YMC C18 (150*25) mm, 10u, Flow:- 19 ml / min, Method: - (T / % of B): 0 / 25, 2 / 25, 10 / 45, 23 / 45, 23.01 / 98, 25 / 98, 25.01 / 25, 28 / 25, Solubility:- ACN+WATER+THF, Temperature:- Ambient.

[0924] Step-6: Synthesis of (1S,3S,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl) piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (Example 73) and (1 R,3R,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl) piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (Example 74):

[0925] The cis-racemic 3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)- 7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (55 mg) obtained above was subjected to SFC separation under the condition described below. Fractions collected from each isomer were pooled, concentrated under reduced pressure, and lyophilized respectively to afford (1S,3S,4R)- 3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)cyclohexan-1-ol (Peak-1, SFC retention time: 2.47 min) (Example 73) (13 mg, 23%y ie Id) and (1 R,3R,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol (Peak-2, SFC retention time: 3.20 min) (Example 74) (22 mg, 39%yield) as white solid.

[0926] Example 73 (peak-1):1H-NMR (400 MHz, DMSO-cfe): 6 8.55 (s, 1 H), 7.17 (dd, J = 3.6 Hz, 2.0 Hz, 1 H), 7.00 (d, J = 4.0 Hz, 1 H), 6.34 (d, J = 4.0 Hz, 1 H), 4.96-4.84 (m, 1 H), 4.78-4.61 (m, 2H), 4.46 (s, 1 H), 4.24 (br s, 1 H), 3.94 (s, 1 H), 3.69-3.61 (m, 1 H), 3.45-3.42 (m, 1 H), 3.24-3.17 (m, 1 H), 3.12-3.06 (m, 1 H), 2.94 (s, 3H), 2.55-2.50 (m, 1 H), 2.19-2.16 (m, 1 H), 2.09-2.04 (m, 1 H), 1.94-1.56 (m, 5H). LC-MS (m / z)-. 430.22 [M+H]+. SFC retention time: 2.47 minutes.

[0927] Example 74 (peak-2):1H-NMR (400 MHz, DMSO-cfe): 6 8.55 (s, 1 H), 7.17 (d, J = 4.0 Hz, 2.0 Hz, 1 H), 7.00 (d, J = 8.0 Hz, 1 H), 6.34 (d, J = 3.6 Hz, 1 H), 4.96-4.84 (m, 1 H), 4.65-4.60 (m, 2H), 4.46 (d, J = 3.2 Hz, 1 H), 4.25 (br s, 1 H), 3.94-3.93 (m, 1 H), 3.71-3.60 (m, 1 H), 3.45-3.42 (m, 1 H), 3.22- 3.20 (m, 1 H), 3.12-3.10 (m, 1 H), 2.94 (s, 3H), 2.59-2.55 (m, 1 H), 2.19-2.15 (m, 1 H), 2.09-2.05 (m, 1 H), 1.94-1.55 (m, 5H). LC-MS (m / z) 430.31 [M+H]+. SFC retention time: 3.20 minutes.

[0928] Preparative SFC Condition: Column / Dimensions: chiralpak-AS-H (250*30*5 p), %Co solvent: 40% (30 mM Metanolic ammonia in Methanol), Total Flow: 90 g / min, Back pressure: 100.0 bar, Temp: 30 °C, Wave length: 235 nm, stack time: 9.57 mins, Load ability: 13.16 mg / injection, Solubility: 9 ml of MeOH. Example 75: 2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7-((3S,4R)-3- fluoro-1 -methylpiperidin-4-yl)-N,N-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide:

[0929] Example 75 Step-1 : Synthesis of tert-butyl (3S,4R)-4-((2-chloro-5-(3,3-diethoxyprop-1-yn-1- yl)pyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate:

[0930] To a stirred solution of in lnt-35 (2500 mg, 5.480 mmol) in Tetra hydrofuran (THF) (25 mL) at ambient temperature was added Copper (I) Iodide (104 mg, 0.548 mmol) and T riethylamine (2760 mg, 27.410 mmol). The reaction mixture was purged with Nitrogen for 5 minutes. Tetrakis(triphenylphosphine)palladium (0) (63 mg, 0.050 mmol) and 3,3-diethoxyprop-1-yne (700 mg, 5.482 mmol) were added. The reaction mixture was purged with Nitrogen for 3 minutes and then stirred at 70 °C for 7 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, filtered through Celite pad, and the Celite pad was washed with Ethyl acetate (20 mL). The combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (230-400 mesh) and eluted with 10 -20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-((2-chloro-5-(3,3-diethoxyprop-1-yn-1-yl)pyrimidin-4- yl)amino)-3-fluoropiperidine-1 -carboxylate (2500 mg, 99 % yield) as an off-white solid. LC-MS (m / z) 457.21 , 459.14 [M, M+2]+.

[0931] Step-2: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-(diethoxymethyl)-7H-pyrrolo [2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate:

[0932] To a stirred solution of tert-butyl (3S,4R)-4-((2-chloro-5-(3,3-diethoxyprop-1-yn-1- yl)pyrimidin-4-yl)amino)-3-fluoropiperidine-1 -carboxylate (2500 mg, 5.47 mmol) in Acetonitrile (25 mL) at ambient temperature was added Cesium carbonate (890 mg, 2.73 mmol). The resulting reaction mixture was heated at 60 °C for 6 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with Ethyl acetate (10 mL) and filtered through Celite pad. The Celite pad was washed with Ethyl acetate (15 mL) and the combined filtrate was concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (230-400 mesh) and eluted with 10 - 20 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-chloro-6-(diethoxymethyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3- fluoropiperidine-1 -carboxylate (1800 mg, 60 % yield) as a yellow gummy liquid. LC-MS (mlz) 457.31 , 459.29 [M, M+2]+. Step-3: Synthesis of tert-butyl (3S,4R)-4-(2-chloro-6-formyl-7H-pyrrolo[2,3-d] pyrimidin-7- yl)-3-fluoropiperidine-1 -carboxylate:

[0933] A solution of Tert-butyl (3S,4R)-4-(2-chloro-6-(diethoxymethyl)-7H-pyrrolo[2,3-d] pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (1800 mg, 3.94 mmol) in Acetone (18 mL) was stirred at ambient temperature for 10 minutes. Iodine (600 mg, 2.36 mmol) was added, and the reaction mixture was stirred at ambient temperature for 5 hours. Progress of the reaction was monitored by LC-MS and TLC. After completion, the reaction mixture was concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (230-400 mesh) and eluted with 20 - 30 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-chloro-6-formyl-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (750 mg, 50 % yield) as a pale-yellow solid. LC-MS (m / z) 383.21 , 385.23 [M, M+2]+.

[0934] Step-4: Synthesis tert-butyl (3S,4R)-4-(2-chloro-6-(dimethylcarbamoyl)-7H-pyrrolo [2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate:

[0935] To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-formyl-7H-pyrrolo[2,3-d]pyrimidin-7- yl)-3-fluoropiperidine-1 -carboxylate (750 mg, 1.959 mmol) in Carbontetrachloride (CCI4) (13 mL) at ambient temperature was added 1 ,3-diiodo-5,5-dimethylimidazolidine-2, 4-dione (742 mg, 10 mmol) and Potassium carbonate (270 mg, 1.959 mmol). The resulting reaction mixture was stirred at ambient temperature for 10 minutes. Dimethyl amine (264 mg, 5.877 mmol) was added, and the reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was diluted with water and extracted with Dichloromethane. The organic extract was washed with Brine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified by Sepa-Bean flash column chromatography using silica gel (230-400 mesh) and eluted with 30 - 40 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford tert-butyl (3S,4R)-4-(2-chloro-6- (dimethylcarbamoyl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (800 mg, 95 % yield) as a pale-yellow solid. LC-MS (m / z)-. 426.37, 428.36 [M, M+2]+.

[0936] Step-5: Synthesis of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-N,N-dimethyl-7H- pyrrolo[2,3-d]pyrimidine-6-carboxamide hydrochloride: To a stirred solution of tert-butyl (3S,4R)-4-(2-chloro-6-(dimethyl carbamoyl)-7H-pyrrolo[2,3- d]pyrimidin-7-yl)-3-fluoropiperidine-1 -carboxylate (800 mg, 1.88 mmol) in Dichloromethane (DCM) (10 mL) at 0 °C was added 4M HCI solution in 1 ,4-dioxane (4 mL). The resulting reaction mixture was allowed to slowly warm to ambient temperature and stirred for 3 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, volatiles were removed under reduced pressure to give the crude material. It was triturated with Diethyl ether, decanted, and dried under vacuum to give 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-N,N-dimethyl-7H- pyrrolo[2,3-d]pyrimidine-6-carboxamide hydrochloride (600 mg, 98 % yield) as a pale-yellow solid. The material was used in the next directly without further purification. LC-MS (m / z). 326.27, 328.29 [M, M+2]+.

[0937] Step-6: Synthesis of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N,N-dimethyl-7H- pyrrolo[2,3-d]pyrimidine-6-carboxamide:

[0938] To a stirred solution of 2-chloro-7-((3S,4R)-3-fluoropiperidin-4-yl)-N,N-dimethyl-7H- pyrrolo[2,3-d]pyrimidine-6-carboxamide hydrochloride (500 mg, 1.53 mmol) in Methanol and 1 ,2-dichloroethane (DCE) (1 :2, v / v) (10 mL) at ambient temperature was added Triethylamine (775 mg, 7.67 mmol) and Paraformaldehyde (460 mg, 15.35 mmol). The resulting reaction mixture was stirred for 10 minutes. Sodium triacetoxyborohydride (1300 mg, 6.14 mmol) was added. The resulting reaction mixture was stirred at ambient temperature for 16 hours. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was diluted with Dichloromethane (20 mL) and washed with water (2 x 10 mL). The organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give 2-chloro- 7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-N,N-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6- carboxamide (380 mg, 73 % yield) as a brown solid. It was used in the next step directly without further purification. LC-MS (m / z)-. 340.25, 342.20 [M, M+2]+.

[0939] Step-7: Synthesis of 2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl) amino)-7- ((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-N,N-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6- carboxamide (Example 75):

[0940] To a solution of 2-chloro-7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-N,N-dimethyl-7H- pyrrolo[2,3-d]pyrimidine-6-carboxamide (100 mg, 0.29 mmol) and (3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-amine (60 mg, 0.35 mmol) in dry Tetrahydrofuran (THF) (5 mL) at ambient temperature was added Sodium fert-butoxide (40 mg, 0.43 mmol) and BrettPhosPdG3 (26 mg, 0.02 mmol). The resulting reaction mixture was purged with Nitrogen for 5 minutes and then stirred at 80 °C under microwave irradiation for 1 hour. Progress of the reaction was monitored by TLC and LC-MS. After completion, the reaction mixture was filtered, and the filtrate was concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC purification under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford 2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7-((3S,4R)-3-fluoro-1 -methylpiperidin-4-yl)-N,N- dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide (Example 75) (40 mg, 27 % yield) as an off-white solid.1H-NMR (400 MHz, DMSO-cfe): 68.60 (s, 1 H), 7.17 (s, 1 H), 6.57 (s, 1 H), 4.89-4.71 (m, 2H), 4.63-4.51 (m, 1 H), 4.17 (br s, 1 H), 3.68-3.61 (m, 1 H), 3.47-3.40 (m, 2H), 3.32-3.20 (m,

[0941] 2H), 3.10-3.02 (m, 8H), 2.95-2.93 (m, 4H), 2.20 (s, 3H), 2.13-2.02 (m, 2H), 1.78-1.65 (m, 2H). LC- MS (m / z): 500.30 [M+H]+.

[0942] Prep-HPLC condition: Method: Buffer: A:- 10 mM ABC, Buffer: B:- ACN, Flow:- 19 ml / min, Column:- UNISIL C18 (150*25 mm) 10 urn. Gradient:- 0 / 10, 2 / 10, 10 / 50, 12.5 / 50, 12.6 / 98, 17 / 98, 17.01 / 10, 20 / 10.

[0943] Example 76 and Example 77: tran-racemic tran-racemic

[0944] Example 76 Example 77 Step-1 : Synthesis of trans-racemic tert-butyl 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)- 3-methylpiperidine-1 -carboxylate:

[0945] To a stirred solution of 2-chloro-7H-pyrrolo[2,3-d]pyrimidine (400 mg, 2.605 mmol) in Toluene (4 mL) at ambient temperature under Nitrogen atmosphere was added cis-racemic tert-butyl 4- hydroxy-3-methylpiperidine-1-carboxylate (673 mg, 3.126 mmol) and (cyanomethylene)tributyl phosphorane (1.38 mL, 5.209 mmol). The resulting reaction mixture was stirred at 100 °C for 6 hours. Progress of the reaction was monitored by LC-MS. After completion, the reaction mixture was allowed to cool to ambient temperature, diluted with water (20 mL) and extracted with Ethyl acetate (2 x 20 mL). The combined organic extract was washed with Bine, dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified using SepaBean T instrument (Silica gel: 100-200 mesh size, snap size-100 g) and eluted with 0 - 50 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford trans-racemic tert-butyl 4-(2-chloro-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-3-methylpiperidine-1 -carboxylate (350 mg, 35 % yield) as a pale-yellow liquid. LC-MS (m / z). 351.25, 353.22 [M, M+2]+.

[0946] Step-2: Synthesis of trans-racemic tert-butyl 4-(2-(((3R,4R)-3-fluoro-1-

[0947] (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-methylpiperidine- 1 -carboxylate:

[0948] To a stirred solution of trans-racemic tert-butyl 4-(2-chloro-7H-pyrrolo[2,3-d]pyrimidin-7-yl)- 3-methylpiperidine-1-carboxylate (350 mg, 0.998 mmol) in Tetrahydrofuran (THF) (3.5 mL) at ambient temperature was added Sodium tert-butoxide (96 mg, 0.998 mmol) and lnt-4 (235 mg, 1.197 mmol). The resulting reaction mixture was purged with Nitrogen for 5 minutes. BrettPhosPdG3 (90 mg, 0.099 mmol) was added. The resulting reaction mixture was stirred at 90 °C under microwave irradiation for 1 hour. Progress of the reaction was monitored by LC- MS. After completion, the reaction mixture was diluted with water (20 mL) and filtered through Celite pad. The combined filtrate was extracted with Ethyl acetate (2 x 20 mL). The combined organic extract was dried over anhydrous Sodium sulphate, filtered, and concentrated under reduced pressure to give the crude product. It was purified using SepaBean T instrument (Silica gel: 100-200 mesh size, snap size-100 g) and eluted with 0 - 100 % Ethyl acetate in Petroleum ether. Fractions collected were pooled and concentrated under reduced pressure to afford trans- racemic tert-butyl 4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-3-methylpiperidine-1 -carboxylate (450 mg, 85 % yield) as a pale yellow liquid. LC-MS (m / z). 511 .71 [M+H]+.

[0949] Step-3: Synthesis of N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine (Example 76) and N-((3R,4R)-3- fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-amine (Example 77)

[0950] To a stirred solution of trans-racemic tert-butyl 4-(2-(((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-3-methylpiperidine- 1 -carboxylate (450 mg, 0.881 mmol) in Dichloromethane (DCM) (4.5 mL) at 0 °C was added 4M HCI solution in 1 ,4-dioxane (2.2 mL, 8.813 mmol) dropwise. The resulting reaction mixture was stirred at ambient temperature for 2 hours. Progress of the reaction was monitored by LC- MS. After completion, the reaction mixture was concentrated under reduced pressure to give the crude material. It was diluted with water and the pH was adjusted to 7-8 by adding saturated aqueous Sodium bicarbonate solution. The mixture was concentrated under reduced pressure to dryness. Dichloromethane was added to the mixture and stirred for 10 minutes. The mixture was filtered, and the filtrate was concentrated under reduced pressure to give the crude product. It was purified by prep-HPLC purification under the condition described below. Fractions collected were pooled, concentrated under reduced pressure, and lyophilized to afford trans-racemic N- ((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-(3-methylpiperidin-4-yl)-7H- pyrrolo[2,3-d]pyrimidin-2-amine (170 mg, 47 % yield).

[0951] The isomers were separated by SFC purification under the condition described below. Fractions collected from each isomer were pooled, concentrated, and lyophilized respectively to afford N- ((3R,4R)-3-fluoro-1 -(methyl sulfonyl)piperidin-4-yl)-7-((3S,4S)-3-methylpiperidin-4-yl)-7H- pyrrolo[2,3-d] pyrimidin-2-amine (Example 76, Peak-2, SFC retention time: 6.70 min) (23 mg, 6 % yield) and N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d] pyrimidin-2 -amine (Example 77, Peak-1, SFC retention time: 5.92 min) (54 mg, 15 % yield) as off-white solid. Absolute stereochemistry of the two isomers of the two methyl-piperidine enantiomers were assigned arbitrarily.

[0952] Example 76 (Peak-2):1H NMR (400 MHz, DMSO-cfe): 6 8.52 (s, 1 H), 7.19 (d, J = 3.6 Hz, 1 H), 6.97 (d, J = 8.0 Hz, 1 H), 6.37 (d, J = 3.6 Hz, 1 H), 4.81-4.65 (m, 1 H), 4.23-4.12 (m, 2H), 3.70-3.62 (m, 1 H), 3.45-3.42 (m, 1 H), 3.25-3.19 (m, 1 H), 3.14-3.01 (m, 3H), 2.94 (s, 3H), 2.61-2.55 (m, 1 H), 2.26 (t, J = 11 .6 Hz, 1 H), 2.09-1 .87 (m, 3H), 1 .72-1 .60 (m, 2H), 0.50 (d, J = 6.4 Hz, 3H). LC-MS (m / z) 411 .27 [M+H]+. SFC retention time: 6.70 minutes.

[0953] Example 77 (Peak-1):1H NMR (400 MHz, DMSO-cfe): 6 8.52 (s, 1 H), 7.20 (d, J = 3.6 Hz, 1 H), 6.97 (d, J = 8.0 Hz, 1 H), 6.37 (d, J = 3.6 Hz, 1 H), 4.77-4.64 (m, 1 H), 4.25-4.14 (m, 2H), 3.65-3.63 (m, 1 H), 3.60-3.42 (m, 1 H), 3.26-3.21 (m, 1 H), 3.15-3.01 (m, 3H), 2.94 (s, 3H), 2.61-2.58 (m, 1 H),

[0954] 2.33-2.22 (m, 1 H), 2.09-1 .71 (m, 3H), 1 .70-1 .65 (m, 2H), 0.50 (d, J = 6.4 Hz, 3H). LC-MS (m / z): 411.27 [M+H]+. SFC retention time: 5.92 minutes.

[0955] Prep-HPLC condition: Mobile phase A: 10 mM Ammonium bicarbonate (Aq), Mobile phase B: Acetonitrile, Column: X-BRIDGE C18 [19-250] 5 pm, Flow: 20 ml / min, Method: (T / % of B):- 0 / 20, 2 / 25, 10 / 30, Solubility: ACN+Water+THF, Temperature: Ambient.

[0956] SFC separation condition: column / dimensions: Chiralpak IG (250x30x5p), Mobile Phase: (0.5% Methanolic ammonia in Methanol), Flow: 20.0 mL / min, Temperature: Ambient, Wave Length: 238 nm, Stacking: 6.0 min, Run time: 15 min, Loadability: 8 mg / inj, Solubility: 10 ml of MeOH, No of Injections: 25. The following compounds were synthesized by following the similar procedure as described in Example 76 and Example 77:

[0957] NMR and MS Data Summary

[0958] SFC analytical Conditions : Column :CHIRALPAK AD-H (4.6*250mm)5pm Co-solvent :0.5% DEA IN METHANOL Total flow :3mL / min % of CO2 :70 % of Co-Solvent :30 ABPR : 1500 psi Temperature : 30°C

[0959] The stereochemistry of the following pairs of enantiomers was assigned arbitrarily:

[0960] Examples 1 and 2

[0961] Examples 3 and 4 Examples 18 and 19 Examples 23 and 24

[0962] Examples 30 and 31

[0963] Examples 44 and 45

[0964] Examples 48 and 49

[0965] Examples 50 and 51

[0966] Examples 55 and 56

[0967] Examples 65 and 66

[0968] Examples 71 and 72

[0969] Examples 73 and 74

[0970] Examples 76 and 77

[0971] Examples 78 and 79

[0972] Examples 81 and 82

[0973] The stereochemistry of i) Examples 9 and 10, ii) Examples 11 and 12 and iii) Examples 32 and 33 was confirmed by single crystal X-ray diffraction.

[0974] CDKi Biochemical assays

[0975] Biochemical assays measured the inhibitory effects of compounds in this disclosure on the enzymatic activity of CDK enzyme in complex with Cyclin protein partner by phosphorylation of Ser-780 (S780) on retinoblastoma protein peptide (RB1) in the presence of 1 mM adenosime-5 — triphosphate (ATP) and varying concentration of test compound in 20 mM 2-[4-(2- hydroxyethyl)paperazin-1-yl] ethanesulfonic acid (HEPES), pH 7.5, 10 mM MgCI2, 1 mM dithiothreitol (DTT), 0.01 % bovine serum albumin (BSA), 0.005% Tween 20. Total Reaction volume of 10 pL proceeded for 60 minutes at room temperature (25°C) and were quenched with 5 pL of 200 mM 2',2",2"'-(Ethane-1 ,2-diyldinitrilo)tetraacetic acid (EDTA) pH 8.0 before addition of 5 pL detection solution containing 100 nM fluorophore conjugate streptavidin allophycocyanin (SA-APC), 2 nM Europium labelled Anti-p-RB(S780)-K (Perkin Elmer, 64CUSKAY), 50 mM HEPES, pH 7.5, 400 mM potassium fluoride (KF), 0.1 % BSA, and 0.01 % Tween-20. Phosphorylation of S780 on RB1 peptide (His-MBP-RB1 [773-924] - SEQ ID NO. 9) was detected by TR-FRET after 3-hour incubation with detection solution. Percent phosphorylation activity was plotted against log concentration of compound to generate an apparent IC5o. The following CDK enzyme in complex with different cyclin proteins and protein peptide substrate were used in these assays:

[0976] CDK1 / CyclinB1 , Avi-tag, 10 pM used in the assay

[0977] CDK2 / CyclinE1 , Avi-tag, 100 pM used in the assay

[0978] CDK4 / cyclinD1 , Avi-tag, 20 pM used in the assay

[0979] CDK6 / cyclinD3, Avi-tag, 10 pM used in the assay

[0980] His-MBP-RB1 [773-924], Avi-tag, 200 nM used in the assay

[0981] The avi-tag is a C-terminal fusion on the CDK1 / 2 / 4 / 6 sequence in each of these two-protein complexes. The known avi-tag sequence, GLNDIFEAQKIEWHE (SEQ ID NO. 10), is a substrate for E. coli biotin ligase BirA, which covalently attaches a biotin molecule to the e-amino group of the lysine in that sequence. The avi-tag is attached with an 8 amino-acid linker sequence GGSGGGGS (SEQ ID NO. 11), resulting in the full C-terminal fusion GGSGGGGSGLNDIFEAQKIEWHE (SEQ ID NO. 12).

[0982] The sequences of the recombinant proteins used here are provided below.

[0983] Recombinant proteins were generated as N-terminal fusions of 9x His tag - E. coli Maltose Binding Protein (MBP), with or without a C-terminal Avi-tag. (Li, Y. & Sousa, R. Expression and purification of E. coli BirA biotin ligase for in vitro biotinylation. Protein Expr. Purif. 82, 162-7 (2012)). CDK2 and His-MBP-RB1 [773-924]-c-avi were expressed in E. coli while the remainder were expressed in Sf21 insect cells. Genes were synthesized commercially (GeneArt and Twist Bioscience) using codon frequencies appropriate to the respective organisms and proprietary codon optimization strategies and inserted into pET 24 (E coli) or pDEST8 (insect) vectors already containing the 9x His-MBP tag using standard methods of PCR and Gibson Assembly. (Gibson, D. G. et al. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat. Methods 6, 343-345 (2009)).

[0984] E. coli expression was performed by auto-induction overnight at 18 or 21 C. For insect cell expression, bacmids and viruses were created, (Invitrogen. Bac-to-Bac® Baculovirus Expression System. An Efficient Site-Specific Transposition System to Generate Baculovirus for High-Level Expression of Recombinant Proteins. (2010)) then used to synchronously infect Sf21 insect cells with harvest at 40-48 hrs., per standard protocols. (Invitrogen life technologies. Guide to Baculovirus Expression Vector Systems (BEVS) and Insect Cell Culture Techniques. (2002)). For CDK2 / Cyclin E and CDK1 / Cyclin B, the CDK and Cyclin proteins were expressed separately, lysed by sonication and clarified by centrifugation. The fusion proteins were each separately purified by immobilized metal ion affinity chromatography (IMAC) (5 mL HisTrap, Cytiva) and Superdex 200 26 / 60 (Cytiva) size-exclusion and complexed in vitro (1-3 hrs incubation at room temperature) prior to tag cleavage by recombinant his-tagged Tobacco Etch Virus protease or his-tagged Human rhinovirus 3C protease, as appropriate. The cleaved complex is further purified by Superdex 75 26 / 60 (Cytiva) size-exclusion followed by reverse-IMAC, in which the complex is in the column flow-through and residual His-MBP and his-tagged proteases are retained. The final complex is concentrated as desired by centrifugal concentration (Amicon Ultra 10,000 Da MWCO 15 mL concentrators, Millipore).

[0985] For E. coli expressed CDK2 and His-MBP-RB1 [773-924]-c-avi, the proteins were biotinylated in vitro after the first IMAC step. (Li, Y. & Sousa, R. Expression and purification of E. coli BirA biotin ligase for in vitro biotinylation. Protein Expr. Purif. 82, 162-7 (2012))

[0986] For CDK4 / Cyclin D1 and CDK6 / Cyclin D3, the complexes were expressed by simultaneous coinfection of insect cells by three separate viruses including one expressing untagged E. coli BirA. The expression media is supplemented with 50 uM d-biotin. The resulting protein complexes purified similarly. After lysis and clarification, the complex is purified by IMAC, Superdex 20026 / 60 size exclusion, tag cleavage by human rhinovirus 3C protease, Superdex 75 26 / 60 size exclusion and reverse IMAC. BirA is typically not retained on the first IMAC, and excess CDK or Cyclin monomer is separated on the Superdex 200 size exclusion. Cleaved His-MBP and remaining monomer are removed by the Superdex 75 size exclusion and the reverse IMAC step. Final concentration by centrifugal concentrators as described above.

[0987] For the is-MBP-RB1 [773-924]-c-avi, the protein was lysed by sonication and clarified by centrifugation. After IMAC capture and in vitro biotinylation, the fusion protein is purified by Q HP HiTrap (Cytiva) with a gradient elution after binding in low salt, followed by SP HP HiTrap (Cytiva) with a gradient elution. The material is finally purified on a Superdex 75 26 / 60 as a polishing step. Although there is a TEV protease cleavage site in this construct, it is not removed for this purpose. Final concentration by centrifugal concentrators as described above.

[0988] 9x His-MBP-3C-CDK2-c-avi (SEQ ID NO. 1)

[0989] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSG LEVLFQGPMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKE LNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVL HRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEWTLWYRAPEILLGCKYYSTAVDIWSL GCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEWWPGVTSMPDYKPSFPKWARQDFSKVV PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRLGGSGGGGSGLNDIFEAQ KIEWHE*

[0990] 9x His-MBP-TEV-Cyclin E1 (SEQ ID NO. 2)

[0991] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSE NLYFQGGSGMPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRT ARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREE VWKI M LN KE KT YL R DQ H F L EQ H P LLQ P KM R Al L L DWL M E VC E VY KL H R ET FY LAQ D F F D RY M A TQENWKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLT IVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSE LMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKA RAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA*

[0992] 9x His-MBP-TEV-CDK1 -c-avi (SEQ ID NO. 3)

[0993] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSE NLYFQGGMEDYTKIEKIGEGTYGWYKGRHKTTGQWAMKKIRLESEEEGVPSTAIREISLLKEL RHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRR VLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEWTLWYRSPEVLLGSARYSTPVDIW SIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHV KNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKMGGSGGGGSGLNDIFEAQKIE WHE*

[0994] 9x His-MBP-Cyclin B1 (SEQ ID NO. 4)

[0995] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSE NLYFQGGMALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQL QAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEE

[0996] QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLV GVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKI GEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESL

[0997] LPVMQHLAKNWMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV*

[0998] 9x His-MBP-CDK4-c-avi (SEQ ID NO. 5)

[0999] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA

[1000] TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE

[1001] EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSE NLYFQGGSGMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPIST VREVALLRRLEAFEHPNWRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETI KDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPWVTLWYR

[1002] APEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSL PRGAFPPRGPRPVQSWPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPEGGS GGGGSGLNDIFEAQKIEWHE*

[1003] 9x His-MBP-Cyclin D1 (SEQ ID NO. 6)

[1004] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA

[1005] TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE

[1006] EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSE NLYFQGGSGMEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLP SMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETI PLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQ

[1007] TFVALCATDVKFISNPPSMVAAGSWAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRAC QEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI*

[1008] 9x His-MBP-CDK6-c-avi (SEQ ID NO. 7)

[1009] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA

[1010] TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE

[1011] EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSM MGSSSSGLEVLFQGPMEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRV QTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDK

[1012] VPEPGVPTETIKDMMFQLLRGLDFLHSHRWHRDLKPQNILVTSSGQIKLADFGLARIYSFQMAL TSWVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLER CKENLDSHLPPSQNTSELNTAGGSGGGGSGLNDIFEAQKIEWHE* 9x His-MBP-Cyclin D3 (SEQ ID NO. 8)

[1013] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE

[1014] EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSLE VLQGPGSMELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPH M R KM LAY WM L E VC E EQ RC E E E VF P LAM N YL D RY LSCVPT R KAQ LQ L LG AVC M L LAS KLR ETT PLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHA QTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQ

[1015] IEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL*

[1016] 9x His-MBP- RB1 [773-924]-c-avi (SEQ ID NO. 9)

[1017] MHHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAA TGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIY NKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV GVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGV TVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSE NLYFQGGSTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRIL VSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGES KFQQKLAEMTSTRTRMQKQKMNDSMDTSNGGSGGGGSGLNDIFEAQKIEWHE*

[1018] (Gibson, D. G. et al. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat. Methods 6, 343-345 (2009)).

[1019] (Invitrogen. Bac-to-Bac® Baculovirus Expression System. An Efficient Site-Specific Transposition System to Generate Baculovirus for High-Level Expression of Recombinant Proteins. (2010)).

[1020] (Invitrogen life technologies. Guide to Baculovirus Expression Vector Systems (BEVS) and Insect Cell Culture Techniques. (2002)).

[1021] IC5o values determined in the biochemical assays are listed in the following table:

[1022] Ratio of CDK1 to CDK4

[1023] Importance of Stereochemistry CD34+ In-vitro hematotoxicity surrogate Assay to measure compounds sensitivity in human bone marrow CD34+ hematopoietic stem precursor cells.

[1024] CD34+ hematopoietic stem precursor cells are an important cell population that is responsible for the constant replenishment of many differentiated blood cell types. It is the proliferative arrest and subsequent decrease in the number of this key stem cell population that has been mechanistically attributed to the hematopoietic toxicity observed in certain CDK4 / 6i treatments (Friberg et al, Invest New Drugs. 2003 May;21 (2):183-94, Sun et al, J Clin Pharmacol. 2017 Sep;57(9):1159-1173, Le Marouille et al, Pharmaceutics. 2021 Oct 16; 13(10): 1708, Palmer et al, 2025, Cancer Cell 43, 464-481), most notably neutropenia. CD34+ cells are used to test the relative potency of different inhibitors to block their proliferation, which has been established as a predictive surrogate for haematological toxicity in patients (Aprikyan et al, Blood (2001) 97 (1): 147-153), (lower pM values are indicative of increased hematological toxicity). Herein we have utilized this assay to demonstrate that the compounds of the invention have significantly reduced activity compared to compounds of the prior art, suggesting an improved therapeutic index in patients.

[1025] CD34+ (CyQuant) protocol

[1026] Cell lines:

[1027] Human Bone Marrow CD34+ cells (StemCell Technologies #700002.5) Media:

[1028] StemSpan SFEM II (StemCell Technologies #09605)

[1029] 10X StemSpan CD34 expansion supplements: (StemCell Technologies #02691)

[1030] Materials:

[1031] 1. Black 384-well plates (Greiner, cat. No. 781091)

[1032] 2. CyQuant Direct Cell Proliferation Assay kit (Invitrogen C35012)

[1033] Assay Protocol:

[1034] Day1 :

[1035] 1. Prepare growth medium of StemSpan SFEM II + StemSpan CD34 expansion supplements.

[1036] 2. Thaw CD34+ cells into 2mL warm StemSpan SFEM II + 1X StemSpan CD34 expansion supplements

[1037] 3. Count cells using ThermoFisher Vi-CELL BLU Cell Viability Analyzer - aliquot 200uL for analysis.

[1038] 4. Prepare cells with growth media with supplement to 6.25E3 cells / mL.

[1039] 5. Seed cells in black 384-well assay plates using ThermoFisher Multidrop combi dispenser. a. Add 80ul / well, cells density should be at 500cells / well. b. Prepare 2 assay plates per 1 compound plate and 1 plate of 12 wells to be used for TO timepoint.

[1040] 6. Incubate cells in assay plates overnight.

[1041] Day2:

[1042] A. Process TO plates (12 wells to be used as TO time point).

[1043] 1 . Process TO plates for CyQuant assay. TO never receives any compound treatment. TO reading is Day 1 reading to compare to D9 reading for cell growth activity.

[1044] 2. Add 8uL of detection mix using ThermoFisher Multidrop co...

Claims

CLAIMS1 . A compound according to formula (I):wherein:A1is selected from bond, -CR4aR4b- and -CH2-CR4aR4b-*, wherein * denotes the point of connection to A2;A2is NR5or CH(OH);R1is selected from H, Ci-C4alkyl, Ci-C4haloalkyl, C3-C4cycloalkyl, C3- C4cyclohaloalkyl, C=C-R1a, C(=O)N(R1a)2, and 5-6 membered heteroaryl comprising 1 to 4 heteroatoms independently selected from the group consisting of N, 0 and S, said 5-6 membered heteroaryl being substituted with 0-4 R1bgroups; each R1ais independently selected from H and Ci-C4alkyl; each R1bis independently selected from halo, Ci-C4alkyl, and Ci-C4haloalkyl;R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci-C4haloalkyl, O-Ci-C4alkyl, and O-Ci-C4haloalkyl;R2ais H or halo; orR2and R2ajoin together with the carbon atom to which they are attached to form C3-C4cycloalkyl or C3-C4cyclohaloalkyl;R3is selected from H, halo, Ci-C4alkyl, and Ci-C4haloalkyl;R4ais H or Ci-C4alkyl;R4bis H or Ci-C4alkyl; orR3and R4ajoin together to form a -CH2CH2- bridge and R4bis H or Ci-C4alkyl;R5is H or Ci-C4alkyl;R6is H or fluoro;R7and R8are both H; orR7and R8join together to form a -CH2CH2- bridge;R9is selected from Ci-C4alkyl, C3-C4cycloalkyl, and NH-Ci-C4alkyl;X is CH or N; andY is C, Z is N and W is CH; orY is N, Z is C and W is N, or a pharmaceutically acceptable salt thereof.

2. The compound or pharmaceutically acceptable salt thereof according to claim 1 , having a formula (la):wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9, W, X, Y and Z are as defined in claim 1 .

3. The compound or pharmaceutically acceptable salt thereof according to claim 1 , having a formula (lb):wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8, R9and X are as defined in claim 1.

4. The compound or pharmaceutically acceptable salt thereof according to claim 1 , having a formula (Ic):wherein A1, A2, R1, R2, R2a, R3, R6, R7, R8and R9are as defined in claim 1.

5. The compound or pharmaceutically acceptable salt thereof according to claim 1 , having a formula (Id):wherein A1, R1, R2, R2a, R3, R5, R6, R7, R8and R9are as defined in claim 1.

6. The compound or pharmaceutically acceptable salt thereof according to claim 1 , having a formula (le):wherein A2, R1, R2, R2a, R3, R4a, R4b, R6, R7, R8and R9are as defined in claim 1.

7. The compound or pharmaceutically acceptable salt thereof according to claim 1 , having a formula (If):wherein R1, R2, R2a, R3, R4a, R4b, R5, R6, R7, R8and R9are as defined in claim 1.

8. The compound or pharmaceutically acceptable salt thereof according to claim 6 or claim 7, wherein R3is selected from H, halo, Ci-C4alkyl and Ci-C4haloalkyl, R4ais H or Ci-C4alkyl and R4bis H or Ci-C4alkyl.

9. The compound or pharmaceutically acceptable salt thereof according to claim 8, wherein R3is H or Ci-C4haloalkyl.

10. The compound or pharmaceutically acceptable salt thereof according to claim 9, wherein R3is H or CFs.11 . The compound or pharmaceutically acceptable salt thereof according to claim 10, wherein R3is H.

12. The compound or pharmaceutically acceptable salt thereof according to any one of claims 8 to 11 , wherein R4ais H or CHs.

13. The compound or pharmaceutically acceptable salt thereof according to claim 12, wherein R4ais H.

14. The compound or pharmaceutically acceptable salt thereof according to any one of claims 8 to 13, wherein R4bis H or CHs.

15. The compound or pharmaceutically acceptable salt thereof according to claim 14, wherein R4bis H.

16. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, having a formula (II):wherein R1, R2, R2a, R5, R6, R7, R8and R9are as defined in claim 1.

17. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl, Ci- C4haloalkyl, O-Ci-C4alkyl and O-Ci-C4haloalkyl and R2ais H or halo.

18. The compound or pharmaceutically acceptable salt thereof according to claim 17, wherein R2ais H or fluoro.

19. The compound or pharmaceutically acceptable salt thereof according to claim 18, wherein R2ais H.

20. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, having a formula (III):wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl,Ci-C4haloalkyl, O-Ci-C4alkyl and O-Ci-C4haloalkyl and R1, R5, R6, R7, R8and R9are as defined in claim 1.21 . The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, wherein R7and R8are both H.

22. The compound or pharmaceutically acceptable salt thereof according to any one of claims 18 to 21 , having a formula (IV):wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl,Ci-C4haloalkyl, O-Ci-C4alkyl and O-Ci-C4haloalkyl and R1, R5, R6, and R9are as defined in claim 1.

23. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, wherein R6is fluoro.

24. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, having a formula (V):wherein R2is selected from H, halo, hydroxyl, Ci-C4alkyl,Ci-C4haloalkyl, O-Ci-C4alkyl and O-Ci-C4haloalkyl and R1, R5and R9are as defined in claim 1.

25. The compound or pharmaceutically acceptable salt thereof according to any one of claims 17 to 24, wherein R2is selected from H, fluoro, hydroxyl, OCH2CH3, OCHF2, OCH2F, OCH3 and CH3.

26. The compound or pharmaceutically acceptable salt thereof according to claim 25, wherein R2is fluoro.

27. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, having a formula (VI):wherein R1, R5, and R9are as defined in claim 1.

28. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, wherein R1is selected from H, Ci-C4alkyl, cyclopropyl, C C=C-29. The compound or pharmaceutically acceptable salt thereof according to claim 28, wherein R1is H or Ci-C4alkyl.

30. The compound or pharmaceutically acceptable salt thereof according to claim 29, wherein R1is H.31 . The compound or pharmaceutically acceptable salt thereof according to claim 29, wherein R1is Ci-C4alkyl.

32. The compound or pharmaceutically acceptable salt thereof according to claim 31 , wherein R1is CHs.

33. The compound or pharmaceutically acceptable salt thereof according to any one of claims 5 and 7 to 32, wherein R5is selected from H, CHs and CH2CH3.

34. The compound or pharmaceutically acceptable salt thereof according to claim 33, wherein R5is H or CHs.

35. The compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims, wherein R9is CHs, cyclopropyl or NHCHs.

36. The compound or pharmaceutically acceptable salt thereof according to claim 35, wherein R9is CHs or cyclopropyl.

37. The compound or pharmaceutically acceptable salt thereof according to claim 1 , selected from:1 ) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;2) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;3) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;4) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;5) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;6) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin- 4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;7) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;8) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;9) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3- fluoroazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;10) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoroazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;11 ) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoroazepan- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;12) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoroazepan- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;13) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3- fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;14) 6-ethyl-N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;15) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4S)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;16) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;17) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;18) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoroazepan- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;19) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoroazepan- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;20) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;21 ) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;22) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;23) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;24) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;25) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-6-ethyl-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;26) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;27) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin- 4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;28) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;29) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;30) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- fluoroazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;31 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3- fluoroazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;32) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;33) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1 - methylazepan-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;34) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;35) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-aminef;36) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4R)-3- fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;37) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoropiperidin- 4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;38) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3-fluoropiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;39) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3-fluoro-1 - methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;40) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3R,4R)-3- fluoropiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;41 ) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin- 4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;42) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;43) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-3-fluoro-1 - methylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;44) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4R,5S)-5-fluoro-2,2- dimethylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;45) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((4S,5R)-5-fluoro-2,2- dimethylpiperidin-4-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;46) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3-fluoropiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;47) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;48) (3R,4S)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;49) (3S,4R)-4-(2-(((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;50) (3R,4S)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-6-methyl- 7H-pyrrolo[2,3-d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;51 ) (3S,4R)-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)amino)-6-methyl- 7H-pyrrolo[2,3-d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;52) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- ethoxypiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;53) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- (difluoromethoxy)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;54) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((1 S,2S,3R,5R)-2- fluoro-8-azabicyclo[3.2.1]octan-3-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2-amine;55) (3S,4R)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;56) (3R,4S)-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7H- pyrrolo[2,3-d]pyrimidin-7-yl)-1 -methylpiperidin-3-ol;57) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- (fluoromethoxy)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;58) 7-((3S,4S)-3-(difluoromethoxy)piperidin-4-yl)-N-((3R,4R)-3-fluoro-1- (methylsulfonyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;59) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3- methoxypiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;60) N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((3S,4S)-3-methoxy- 1 -methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2 -amine;61 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-(piperazin-1 - yl)pyrrolo[2, 1 -f][ 1 ,2,4]triazin-2-amine;62) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((1 S,2S,3R,5R)-2- fluoro-8-methyl-8-azabicyclo[3.2.1]octan-3-yl)-6-methyl-7H-pyrrolo[2,3-d]pyrimidin-2- amine;63) 6-cyclopropyl-N-((3R,4R)-1-(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7- ((3S,4R)-3-fluoropiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;64) (3R,4R)-3-fluoro-4-((7-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-7H-pyrrolo[2,3- d]pyrimidin-2-yl)amino)-N-methylpiperidine-1 -sulfonamide;65) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((R)-5-azaspiro[2.5]octan- 8-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;66) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((S)-5-azaspiro[2.5]octan- 8-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;67) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-1 -((3S,4R)-3- fluoropiperidin-4-yl)-1 H-pyrrolo[3,2-c]pyridin-6-amine;68) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-6-(4-methyl-4H-1 ,2,4-triazol-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2- amine;69) 7-((3S,4R)-3-fluoro-1 -methyl pi peridi n-4-yl)-N-(( 1 R,5S)-8-(methylsulfonyl)-8- azabicyclo[3.2.1]octan-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;70) N-((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoro-1 - methylpiperidin-4-yl)-6-(prop-1-yn-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;71) (1 S,3R,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;72) (1 R,3S,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;73) (1 S,3S,4R)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;74) (1 R,3R,4S)-3-fluoro-4-(2-(((3R,4R)-3-fluoro-1 -(methylsulfonyl)piperidin-4- yl)amino)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)cyclohexan-1-ol;75) 2-(((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)amino)-7-((3S,4R)-3-fluoro- 1-methylpiperidin-4-yl)-N,N-dimethyl-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide;76) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4S)-3- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;77) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4R)-3- methylpiperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;78) 7-((R)-3,3-difluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;79) 7-((S)-3,3-difluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin- 4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;80) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3R,4S)-4- fluoropyrrolidin-3-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;81 ) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((2S,4S)-2- (trifluoromethyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; 82) N-((3R,4R)-1 -(cyclopropylsulfonyl)-3-fluoropiperidin-4-yl)-7-((2R,4R)-2-(trifluoromethyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;83) 7-((3S,4R)-1 -ethyl-3-fluoropiperidin-4-yl)-N-((3R,4R)-3-fluoro-1 - (methylsulfonyl)piperidin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine;84) N-((3R,4R)-3-fluoro-1-(methylsulfonyl)piperidin-4-yl)-7-((3S,4R)-3-fluoropiperidin- 4-yl)-6-(prop-1 -yn-1 -yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine; or a pharmaceutically acceptable salt thereof.

38. The compound according to claim 1 , having the structure:

40. The compound according to claim 1 , having the structure:.

42. The compound according to claim 1 , having the structure:pharmaceutically acceptable salt thereof.

43. The compound according to claim 1 , having the structure:

45. The compound according to claim 1 , having the structure:pharmaceutically acceptable salt thereof.

46. A pharmaceutical composition comprising the compound or pharmaceutically acceptable salt thereof according to any one of the preceding claims and one or more pharmaceutically acceptable carriers.

47. A combination comprising the compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45, and one or more therapeutically active agents.

48. A method of modulating CDK2 and / or CDK4 activity in a subject comprising administering to the subject a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45.

49. A method of treating cancer comprising administering to a subject in need thereof a therapeutically effective amount of the compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45.

50. The compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45 for use as a medicament.51 . The compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45 for use in the treatment of cancer.

52. Use of the compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45 in the treatment of cancer.

53. Use of the compound or pharmaceutically acceptable salt thereof according to any one of claims 1 to 45 in the manufacture of a medicament for the treatment of cancer.

54. The method according to claim 49, the compound or pharmaceutically acceptable salt thereof for use according to claim 51 , or the use according to claim 52 or claim 53, wherein the cancer is selected from breast cancer, prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer and colorectal cancer.

55. The method according to claim 49 or claim 54, the compound or pharmaceutically acceptable salt thereof for use according to claim 51 or claim 54, or the use according to any one of claims 52 to 54, wherein the cancer is breast cancer.

56. The method according to claim 55, the compound or pharmaceutically acceptable salt thereof for use according to claim 55, or the use according to claim 55, wherein the breast cancer is ER+ breast Cancer.

57. The method according to claim 55 or claim 56, the compound or pharmaceutically acceptable salt thereof for use according to claim 55 or claim 56, or the use according to claim 55 or claim 56, wherein the breast cancer is a) HER2- breast cancer, or b) HER2+ breast cancer.

58. The method according to claim 57, the compound or pharmaceutically acceptable salt thereof for use according to claim 57, or the use according to claim 57, wherein the breast cancer is HER2- breast cancer.

59. The method according to any one of claims 49 and 52 to 58, the compound or pharmaceutically acceptable salt thereof for use according to any one of claims 51 and 54 to 58, or the use according to any one of claims 52 to 58, wherein the cancer has one or more of the following features: a) CCNE1 amplification, b) CCNE2 amplification, c) CCND1 amplification, d) CDK4 amplification and e) p53 mutation.

60. A method for treating a CDK2 and / or CDK4 dependent disease or disorder or a disease or disorder that is mediated, at least in part, by CDK2 and / or CDK4, or a disease characterized by amplification or overexpression of cyclin El (CCNE1), cyclin E2 (CCNE2), CCND1 , or CDK4, or p53 mutation, in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a compound, or pharmaceutically acceptable salt thereof, according to any one of claims 1 to 45. 61 . The method according to claim 60, wherein the CDK2 and / or CDK4 dependent disease or disorder or the disease or disorder that is mediated, at least in part, by CDK2 and / or CDK4, is selected from breast cancer, prostate cancer, liposarcoma, mantle cell lymphoma, lung cancer and colorectal cancer.

Citation Information

Patent Citations

  • Cyclin-dependent kinase inhibitor and preparation method thereof

    CN114790206A

  • Cyclin-dependent kinase inhibitors

    WO2020140052A1

  • Inhibitors of CDK4 / 6 kinase

    WO2023147372A1