Anti-prame / HLA-a2 antibodies and uses thereof
Patent Information
- Application Number
- PCT/US2025/035306
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-06-25
- Filing Date
- 2025-06-25
- Publication Date
- 2026-02-05
AI Technical Summary
Current cancer treatments lack effective methods to target and eliminate cancer cells expressing the PRAME antigen, which is overexpressed in various cancers.
Development of anti-PRAME/HLA-A2 antibodies and T-cell engaging bispecific antibodies that specifically bind to the PRAME/HLA-A2 complex, recruiting cytotoxic T cells to kill cancer cells expressing PRAME.
These antibodies elicit a cytotoxic T cell-mediated immune response, effectively targeting and killing cancer cells expressing PRAME, providing a therapeutic approach for treating cancers such as melanoma and non-small cell lung cancer.
Smart Images

Figure US2025035306_05022026_PF_FP_ABST
Abstract
Description
ANTI-PRAME / HLA-A2 ANTIBODY AND USES THEREOFRELATED APPLICATIONS
[0001] This application claims the benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application No. 63 / 663,990 filed on June 25, 2024; U.S. Provisional Application No. 63 / 664,008, filed on June 25, 2024; U.S. Provisional Application No. 63 / 664,113, filed on June 25, 2024; U.S. Provisional Application No. 63 / 664,139, filed June 25, 2024, and U.S. Provisional Application No. 63 / 664,145, filed June 25, 2024, the entire contents of each of which are hereby incorporated by reference in their entirety.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING
[0002] The content of the electronic sequence listing (Y013270000WO00-SEQ-EMB.xml; Size: 352,056 bytes; Date of Creation: June 24, 2025) is herein incorporated by reference in its entirety.BACKGROUND
[0003] PReferentially expressed Antigen in MElanoma (PRAME) is a cancer-associated antigen found to be overexpressed in a variety of cancers, including melanoma, acute myeloid leukemia, non- small cell lung cancer, and other hematological and solid cancers. PRAME is a cancer-testis antigen and under healthy conditions is only expressed in the testis or placenta.SUMMARY
[0004] The present disclosure, at least in part, relates to the development of antibodies that specifically recognize and bind PRAME peptides when they are complexed with HLA molecules (e.g., HLA-A2). For example, in one aspect, the disclosure features an isolated antibody (e.g., anti-PRAME / HLA-A2 antibody) that mimics a T cell receptor (TCR) that specifically binds a PRAME / HLA-A2 complex. In other aspects, the present disclosure provides T-cell engaging bispecific antibodies targeting PRAME / HLA-A2, which comprises a first antigen binding site that specifically binds a PRAME / HLA-A2 complex (e.g., any of the antigen binding site derived from any one of the anti-PRAME / HLA-A2 antibody described herein), and a second antigen binding site that specifically binds a T cell antigen (e.g., CD3) (referred to as anti-PRAME / HLA-A2xT cell bispecific antibody). In someembodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody recruits a T cell (e.g., cytotoxic T cell) to a cancer cell expressing PRAME. In some embodiments, an anti- PRAME / HLA-A2xT cell bispecific antibody elicits T cell mediated immune response (e.g., cytotoxic T cell mediated immune response) against a cancer cell expressing PRAME. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody induces T cell mediated killing (e.g., cytotoxic T cell mediated immune response) of a cancer cell expressing PRAME. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody is useful for treating cancer (e.g., cancer expressing PRAME). In other embodiments, the present disclosure also provides a chimeric T cell receptor (CAR) that comprises an antigen binding site of an anti-PRAME / HLA-A2. In some embodiments, a chimeric T cell expressing a CAR comprising an antigen binding site of an anti- PRAME / HLA-A2 can be used for treating cancer (e.g., cancer expressing PRAME).
[0005] In some embodiments, the present disclosure provides a means for specifically binding a peptide / HLA-A2 complex, wherein the peptide / HLA-A2 complex is a member of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X56X57X58X59HLIGX60 (SEQ ID NO: 18). In some embodiments, the present disclosure provides a means for specifically binding a PRAME / HLA-A2 complex, wherein the PRAME / HLA-A2 complex comprises a PRAME peptide comprising the amino acid sequence of SLLQHLIGL (SEQ ID NO: 19) bound by HLA-A2. In some embodiments, the means for specifically binding a peptide / HLA-A2 complex (e.g., peptide X56X57X58X59HLIGX60 (SEQ ID NO: 18) bound by HLA-A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof). In some embodiments, the means for specifically binding a PRAME / HLA-A2 complex (e.g., PRAME peptide SLLQHLIGL (SEQ ID NO: 19) bound by HLA-A2) is an anti- PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof).
[0006] In some embodiments, the present disclosure provides a means for specifically binding a peptide / HLA-A2 complex, wherein the peptide / HLA-A2 complex is a member of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X53X54X55X56X57LIGX58. In some embodiments, the present disclosure provides a means for specifically binding a PRAME / HLA-A2 complex, wherein the PRAME / HLA-A2 complex comprises a PRAME peptide comprising the amino acid sequence of SLLQHLIGL(SEQ ID NO: 19) bound by HLA-A2. In some embodiments, the means for specifically binding a peptide / HLA-A2 complex (e.g., peptide X53X54X55X56X57LIGX58 bound by HLA- A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof). In some embodiments, the means for specifically binding a PRAME / HLA-A2 complex (e.g., PRAME peptide SLLQHLIGL (SEQ ID NO: 19) bound by HLA-A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof).
[0007] In some embodiments, the present disclosure provides means for engaging a T cell to a cancer cell expressing PRAME. In some embodiments, the means for engaging a T cell to a cancer cell expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein. In some embodiments, the present disclosure provides means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME. In some embodiments, the means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein.
[0008] In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises HC CDR1, HC CDR2, and HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.
[0009] In some embodiments, the present disclosure provides means for engaging a T cell to a cancer cell expressing PRAME. In some embodiments, the means for engaging a T cell to a cancer cell expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibodydescribed herein. In some embodiments, the present disclosure provides means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME. In some embodiments, the means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein.
[0010] In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises HC CDR1, HC CDR2, and HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.
[0011] In some embodiments, the present disclosure provides means for engaging a T cell to a cancer cell expressing PRAME. In some embodiments, the means for engaging a T cell to a cancer cell expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein. In some embodiments, the present disclosure provides means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME. In some embodiments, the means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein.
[0012] In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, and HC CDR3 as providedfor any one of the antibodies elected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises HC CDR1, HC CDR2, and HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.
[0013] In some embodiments, the present disclosure provides means for engaging a T cell to a cancer cell expressing PRAME. In some embodiments, the means for engaging a T cell to a cancer cell expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein. In some embodiments, the present disclosure provides means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME. In some embodiments, the means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein.
[0014] In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvementcomprises HC CDR1, HC CDR2, and HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.
[0015] In some embodiments, the present disclosure provides means for engaging a T cell to a cancer cell expressing PRAME. In some embodiments, the means for engaging a T cell to a cancer cell expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein. In some embodiments, the present disclosure provides means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME. In some embodiments, the means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein.
[0016] In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises HC CDR1, HC CDR2, and HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.
[0017] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises a second antigen binding site that specifically binds to CD3, wherein the improvement comprises a first antigen binding site that specifically binds to a PRAME / HLA- A2 complex that comprises any one of the anti-PRAME / HLA-A2 binding sites derived from any of the anti-PRAME / HLA-A2 antibodies described herein (e.g., any one of the anti- PRAME / HLA-A2 binders described in Table 1).
[0018] In some aspects, the disclosure provides an antibody that specifically binds PRAME (PReferentially expressed Antigen in MElanoma) / HLA-A2 complex(PRAME / HLA-A2) comprising (a) a heavy chain complementarity determining region 1 (HC CDR1), a heavy chain complementarity determining region 2 (HC CDR2), and a heavy chain complementarity determining region 3 (HC CDR3) of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 27, and a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 28; (b) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 31, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 28; (c) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 38, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 32; (d) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 42, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 32; or (e) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 39, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 32; (f) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 87, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 88; (g) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 91, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 92; (h) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 95, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 96; (i) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 102, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 103; (j) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 105, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 106; (k) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 110, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 111; (1) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 115, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 116; (m) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 120, and a LC CDR1, LC CDR2,LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 121; (n) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 123, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 124; (o) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 126, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 127; (p) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 128, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 129; (q) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 134, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 135; (r) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 138, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 139; (s) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 140, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 141; (t) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 144, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 145; (u) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 149, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 150; (v) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 153, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 154; (w) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 155, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 156; (x) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 159, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 160; (y) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 161, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 162; (z) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 164, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 165; (aa) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 166, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 167; (bb) a HCCDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 170, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 171; (cc) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 172, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 173; (dd) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 174, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 175; (ee) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 179, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 180; or (ff) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 184, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 185.
[0019] In some embodiments, an antibody comprises (a) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 22, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 23, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 26; (b) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 22, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 30, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 26; (c) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 33, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 34, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (d) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 40, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (e) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 33, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (f) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 82, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 83, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 86; (g) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 89, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 83, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 77, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (h) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 89, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 93, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 94, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (i) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 97, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 98, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (j) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 89, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 83, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 101, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (k) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 80, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 98, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 104; (1) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 40, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 107, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 108, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ IDNO: 109, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (m) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 112, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 113, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114; (n) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 117, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 118, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 119, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114; (o) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 117, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 119, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 122, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114; (p) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 33, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 125, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 119, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114; (q) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 40, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 108, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 109, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (r) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 131, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 79, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 133, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (s) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 136, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 137, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 79, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (t) a HC CDR1 comprisingthe amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 132, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (u) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 142, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 143, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (v) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 146, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 147, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 148, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (w) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 151, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 78, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 152, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (x) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 132, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (y) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 157, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 158; (z) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 157, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (aa) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ IDNO: 163, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 132, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (bb) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 151, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 125, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (cc) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 168, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 169, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (dd) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 151, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (ee) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; (ff) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 176, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 177, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 178, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; or (gg) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 181, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 182, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 183, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90.
[0020] In some embodiments, an antibody comprises (a) a VH comprising the amino acid of SEQ ID NO: 27, and / or a VL comprising the amino acid sequence of SEQ ID NO: 28; (b)a VH comprising the amino acid of SEQ ID NO: 31, and / or a VL comprising the amino acid sequence of SEQ ID NO: 28; (c) a VH comprising the amino acid of SEQ ID NO: 38, and / or a VL comprising the amino acid sequence of SEQ ID NO: 32; (d) a VH comprising the amino acid of SEQ ID NO: 42, and / or a VL comprising the amino acid sequence of SEQ ID NO: 32; (e) a VH comprising the amino acid of SEQ ID NO: 39, and / or a VL comprising the amino acid sequence of SEQ ID NO: 32; (f) a VH comprising the amino acid sequence of SEQ ID NO: 87, and / or a VL comprising the amino acid sequence of SEQ ID NO: 88; (g) a VH comprising the amino acid sequence of SEQ ID NO: 91, and / or a VL comprising the amino acid sequence of SEQ ID NO: 92; (h) a VH comprising the amino acid sequence of SEQ ID NO: 95, and / or a VL comprising the amino acid sequence of SEQ ID NO: 96; (i) a VH comprising the amino acid sequence of SEQ ID NO: 102, and / or a VL comprising the amino acid sequence of SEQ ID NO: 103; (j) a VH comprising the amino acid sequence of SEQ ID NO: 105, and / or a VL comprising the amino acid sequence of SEQ ID NO: 106; (k) a VH comprising the amino acid sequence of SEQ ID NO: 110, and / or a VL comprising the amino acid sequence of SEQ ID NO: 111; (1) a VH comprising the amino acid sequence of SEQ ID NO: 115, and / or a VL comprising the amino acid sequence of SEQ ID NO: 116; (m) a VH comprising the amino acid sequence of SEQ ID NO: 120, and / or a VL comprising the amino acid sequence of SEQ ID NO: 121; (n) a VH comprising the amino acid sequence of SEQ ID NO: 123, and / or a VL comprising the amino acid sequence of SEQ ID NO: 124; (o) a VH comprising the amino acid sequence of SEQ ID NO: 126, and / or a VL comprising the amino acid sequence of SEQ ID NO: 127; (p) a VH comprising the amino acid sequence of SEQ ID NO: 128, and / or a VL comprising the amino acid sequence of SEQ ID NO: 129; (q) a VH comprising the amino acid sequence of SEQ ID NO: 134, and / or a VL comprising the amino acid sequence of SEQ ID NO: 135; (r) a VH comprising the amino acid sequence of SEQ ID NO: 138, and / or a VL comprising the amino acid sequence of SEQ ID NO: 139; (s) a VH comprising the amino acid sequence of SEQ ID NO: 140, and / or a VL comprising the amino acid sequence of SEQ ID NO: 141; (t) a VH comprising the amino acid sequence of SEQ ID NO: 144, and / or a VL comprising the amino acid sequence of SEQ ID NO: 145; (u) a VH comprising the amino acid sequence of SEQ ID NO: 149, and / or a VL comprising the amino acid sequence of SEQ ID NO: 150; (v) a VH comprising the amino acid sequence of SEQ ID NO: 153, and / or a VL comprising the amino acid sequence of SEQ ID NO: 154; (w) a VH comprising the amino acid sequence of SEQ ID NO: 155, and / or a VL comprising the amino acid sequence of SEQ ID NO: 156; (x) a VH comprising the amino acid sequence of SEQ ID NO: 159, and / or a VL comprising the amino acid sequence of SEQ ID NO: 160; (y)a VH comprising the amino acid sequence of SEQ ID NO: 161, and / or a VL comprising the amino acid sequence of SEQ ID NO: 162; (z) a VH comprising the amino acid sequence of SEQ ID NO: 164, and / or a VL comprising the amino acid sequence of SEQ ID NO: 165; (aa) a VH comprising the amino acid sequence of SEQ ID NO: 166, and / or a VL comprising the amino acid sequence of SEQ ID NO: 167; (bb) a VH comprising the amino acid sequence of SEQ ID NO: 170, and / or a VL comprising the amino acid sequence of SEQ ID NO: 171; (cc) a VH comprising the amino acid sequence of SEQ ID NO: 172, and / or a VL comprising the amino acid sequence of SEQ ID NO: 173; (dd) a VH comprising the amino acid sequence of SEQ ID NO: 174, and / or a VL comprising the amino acid sequence of SEQ ID NO: 175; (ee) a VH comprising the amino acid sequence of SEQ ID NO: 179, and / or a VL comprising the amino acid sequence of SEQ ID NO: 180; or (ff) a VH comprising the amino acid sequence of SEQ ID NO: 184, and / or a VL comprising the amino acid sequence of SEQ ID NO: 185.
[0021] In some embodiments, an antibody is a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, or a Fv. In some embodiments, an antibody comprises a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.
[0022] In some aspects, the disclosure provides an antibody that specifically binds members of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X56X57X58X59HLIGX60 (SEQ ID NO: 18), wherein X56 is S,G, A, T, Q, H, or Y when X57 is L, X58is L, X59 is Q, and X6o is L (SEQ ID NO: 288); X57 is M or L when X56is S, X58is L, X59 is Q, and X6o is L (SEQ ID NO: 289); X58is D, M, W, Y, L, N, Q, F, H, A, or T when X56is S, X57 is L, X59 is Q, and X6o is L (SEQ ID NO: 290); X59 is E, P, N, Q, S, G, K, T, or A when X56 is S, X57 is L, Xs8is L, and Xeo is L; or Xeo is Y, I, T, L, or A when X56 is S, X57 is L, Xs8is L, and X59 is Q (SEQ ID NO: 291).
[0023] In some embodiments, at least one member of the set of complexes comprises a PRAME peptide. In some embodiments, the PRAME peptide comprises the amino acid sequence consisting of SLLQHLIGL (SEQ ID NO: 19).
[0024] In some aspects, the disclosure provides an antibody that specifically binds members of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X53X54X55X56X57LIGXs8, wherein X53 is S, G, A, T, Y, Q,H, or F when X54 is L, X55 is L, X56 is Q, X57 is H, and Xs8is L; X54 is M or L when X53 is S, X55 is L, X56 is Q, X57 is H, and Xs8is L; X55 is Y, M, L, F, H, D, or W when X53 is S, X54 is L, X56 is Q, X57 is H, and Xs8is L; X56 is D, E, P, N, G, S, Q, T, K, or A when X53 is S, X54 isE, X55 is E, X57 is H, and X58is L; X57 is W, S, A, N, H, G, T, or S when X53 is S, X54 is E, X55 is L, X56 is Q, and X58 is L; or Xss is Y, T, L, or A when X53 is S, X54 is L, X55 is L, X56 is Q, and X57 is H. In some embodiments, at least one member of the set of complexes comprises a PRAME peptide. In some embodiments, the PRAME peptide comprises the amino acid sequence consisting of SLLQHLIGL (SEQ ID NO: 19).
[0025] In some embodiments, an antibody is obtained by a process comprising (1) exposing members of the set of complexes to a library of antibodies under conditions in which at least one antibody of the library that specifically binds to the members of the set of complexes is detected; (2) obtaining the sequence of a heavy chain variable domain of an antibody detected in step (1) that specifically binds the members of the set of complexes; and (3) producing an antibody having at least a heavy chain complementarity determining region 3 (HC CDR3) of the heavy chain variable domain of step (2), thereby obtaining the antibody that specifically binds to the members of the set of complexes. In some embodiments, an antibody is obtained by a process that further comprises (4) confirming that the antibody obtained by step (3) binds a PRAME peptide bound by HLA-A2.
[0026] In some embodiments, the disclosure provides a bispecific antibody comprising a first antigen binding site comprising an antibody provided herein, and a second antigen binding site. In some embodiments, the second antigen binding site specifically binds to a T cell antigen. In some embodiments, the T cell antigen is a CD3 complex. In some embodiments, the second antigen binding site specifically binds CD35 of a CD3 complex. In some embodiments, the second antigen binding site specifically binds CD3s of a CD3 complex. In some embodiments, the second antigen binding site specifically binds CD3y of a CD3 complex. In some embodiments, the second antigen binding site specifically binds a CD3s / 5 heterodimer of a CD3 complex. In some embodiments, the second antigen binding site specifically binds a CD3s / y heterodimer of a CD3 complex.
[0027] In some embodiments, the bispecific antibody comprises a first arm that is configured as a Fab, a Fab’, or a scFv and that comprises the first antigen binding site. In some embodiments, the bispecific antibody comprises a second arm that is configured as a Fab, a Fab’, or a scFv and that comprises the second antigen binding site. In some embodiments, the bispecific antibody comprises a first arm that is configured as a Fab and a second arm that is configured as a scFv. In some embodiments, the bispecific antibody comprises a first arm that is configured as a scFv and a second arm that is configured as a Fab. In some embodiments, the ratio between the first antigen binding site and the second antigen binding site is 1:1, 1:2, 1:3, 2:1 or 3:1.
[0028] In some embodiments, the disclosure provides a chimeric antigen receptor (CAR) comprising an antibody provided herein.
[0029] In some embodiments, the disclosure provides an isolated nucleic acid encoding the VH and / or VL of an antibody provided herein, a bispecific antibody, or a CAR provided herein. In some embodiments, the isolated nucleic acid comprises (a) the nucleic acid sequence of SEQ ID NO: 43, and / or the nucleic acid sequence of SEQ ID NO: 44; (b) the nucleic acid sequence of SEQ ID NO: 45, and / or the nucleic acid sequence of SEQ ID NO: 44; (c) the nucleic acid sequence of SEQ ID NO: 46, and / or the nucleic acid sequence of SEQ ID NO: 47; (d) the nucleic acid sequence of SEQ ID NO: 16, and / or the nucleic acid sequence of SEQ ID NO: 47; or (e) the nucleic acid sequence of SEQ ID NO: 48, and / or the nucleic acid sequence of SEQ ID NO: 47.
[0030] In some embodiments, the disclosure provides an isolated nucleic acid encoding the VH and / or VL of an antibody provided herein, a bispecific antibody provided herein, or a CAR provided herein. In some embodiments, the isolated nucleic acid comprises (a) the nucleic acid sequence of SEQ ID NO: 43, and / or the nucleic acid sequence of SEQ ID NO: 44; (b) the nucleic acid sequence of SEQ ID NO: 45, and / or the nucleic acid sequence of SEQ ID NO: 57; (c) the nucleic acid sequence of SEQ ID NO: 46, and / or the nucleic acid sequence of SEQ ID NO: 47; (d) the nucleic acid sequence of SEQ ID NO: 48, and / or the nucleic acid sequence of SEQ ID NO: 58; (e) the nucleic acid sequence of SEQ ID NO: 49, and / or the nucleic acid sequence of SEQ ID NO: 59; or (f) the nucleic acid sequence of SEQ ID NO: 60, and / or the nucleic acid sequence of SEQ ID NO: 16.
[0031] In some embodiments, the disclosure provides an expression vector comprising an isolated nucleic acid provided herein.
[0032] In some embodiments, the disclosure provides a host cell comprising an antibody, a bispecific antibody, a CAR, an isolated nucleic acid, or an expression vector provided herein.
[0033] In some embodiments, the disclosure provides an engineered cell expressing an antibody, a bispecific antibody, or a CAR provided herein. In some embodiments, the engineered cell is a T cell, a NK cell, or a NKT cell.
[0034] In some embodiments, the disclosure provides a composition comprising an antibody, a bispecific antibody, a CAR, an isolated nucleic acid, an expression vector, a host cell, or an engineered cell provided herein. In some embodiments, the composition further comprises a pharmaceutically acceptable carrier.
[0035] In some embodiments, the disclosure provides a method of treating cancer, the method comprising administering to a subject in need thereof an effective amount of anantibody, a bispecific antibody, a CAR, an isolated nucleic acid, an expression vector, a host cell, an engineered cell, or a composition provided herein.
[0036] The foregoing and other aspects, implementations, acts, functionalities, features, and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.BRIEF DESCRIPTION OF THE DRAWINGS
[0037] FIG. 1 is a high-level schematic of the lead antibody selection process.
[0038] FIGs. 2A-2B are schema of the phage -based poly specificity assay. Phages were loaded with PRAME peptides complexed with single-chain HLA-A2 molecules (FIG. 2A). 100 PRAME peptides were complexed with single-chain HLA-A2 molecules and loaded onto phages for high-throughput screens (FIG. 2B).
[0039] FIG. 3 shows binding strength of candidate antibodies against two PRAME peptides - VLD (full peptide sequence VLDGLDVLL (SEQ ID NO: 17)) and SLL (full peptide sequence SLLQHLIGL (SEQ ID NO: 19)) - as well as binding to off-target peptide / HLA-A2 complexes.
[0040] FIG. 4 are kinetics sensorgrams for each lead binder showing the relative response (RU) to a PRAME peptide.
[0041] FIG. 5 is a workflow schematic for epitope scanning of residues important for lead antibody recognition of a peptide, e.g., a PRAME peptide, complexed to a single-chain HLA- A2 molecule. Each residue of the peptide was individually and sequentially substituted for every possible amino acid. Each iteration was complexed with HLA-A2 and loaded onto a phage for monovalent presentation to lead antibodies, after which next-generation sequencing was performed to determine the residues of the peptides to which the lead antibodies bind. Sequences shown correspond (top-bottom) to SEQ ID NOs: 49-58.
[0042] FIG. 6 shows the binding strength of control beads (left) and of an example antibody lead (right) to each iteration of the SLL PRAME peptide. For the heatmap, each row represents an amino acid residue, and each column represents an amino acid position within the SLL peptide. Darker squares in the heat map represent strong binding to the peptide for a given residue substitution. Below the heatmap is an amino acid sequence logo plot. The relative size of the depiction of the residue corresponds to its frequency in the iterations of the peptides that are bound by the control beads of antibody candidates. Sequences shown correspond (top-bottom) to SEQ ID NOs: 59-68.
[0043] FIG. 7 is an amino acid sequence logo plot for an antibody described herein that binds the SLL PRAME peptide. Sequence shown corresponds to SEQ ID NO: 19.DETAILED DESCRIPTION
[0044] PReferentially expressed Antigen in MElanoma (PRAME) is one of the most highly expressed cancer-associated antigens. Under homeostatic conditions, PRAME is expressed intracellularly only in the testis or placenta and is thus categorized as a cancer-testis antigen. The normal function of PRAME is not fully understood, but it is thought to promote cancer cell proliferation, survival, and immune evasion. While PRAME is normally only expressed intracellularly, in cancer cells it is broken down into peptides and peptide fragments, which are then bound by HLA molecules for display on the cancer cell surface.
[0045] The present disclosure, at least in part, is based on the development of anti- PRAME / HLA-A2 antibodies and their variants thereof, which showed high binding affinity and specificity to PRAME / HLA-A2. PReferentially expressed Antigen in MElanoma (PRAME) is a protein found to be expressed by cells in a number of cancers, including melanoma, leukemia, breast cancer, lung cancer, and others. In healthy conditions, PRAME expression is limited to germline cells (e.g., sperm cells) and is not expressed in somatic cells. PRAME is an intracellular protein thought to function as a repressor of retinoic acid signaling, but in cancer cells it is processed by the proteosome such that PRAME peptides are presented on MHC or HLA molecules on the cancer cell surface, forming a PRAME / MHC complex (e.g., a PRAME / MHC-I complex) or a PRAME / HLA complex (e.g., a PRAME / HLA-A2 complex). Such complexes can be recognized by immune cells, including T effector cells. HLA molecules recognized by CD4+ T cells are encoded by the HLA-DP, HLA-DQ, and HLA-DR genes, while HLA molecules recognized by CD8+ T cells are encoded by the HLA- A, HLA-B, and HLA-C genes. Different alleles of genes encoding HLA molecules result in different HLA serotypes, such as HLA-A2 in the case of HLA-A. In some embodiments, an antibody provided herein specifically binds PRAME complexed with HLA- A2 (also referred to as HLA-A2, HLA-A02, HLA-A*02, or HLA-A*2). HLA-A2 can be further serotyped and separated by allele variation (e.g., HLA-A2:01, HLA-A2:01, HLA- A2:02, HLA-A2:03, HLA-A2:04, HLA-A2:05, HLA-A2:06, HLA-A2:07, HLA-A2:11, etc.). In some embodiments, an anti-PRAME / HLA-A2 antibody specifically binds PRAME complexed with HLA-A serotype HLA-A*02:01.
[0046] Also provided are the use of the anti-PRAME / HLA-A2 antibodies and their variants in research, diagnostic / detection, and therapeutic applications. In some embodiments, an anti-PRAME / HLA-A2 is a bispecific antibody and comprises a first binding site that specifically binds PRAME / HLA-A2 and a second binding site. In some embodiments, the second binding site specifically binds a T cell antigen. By having a binding site specific for PRAME / HLA-A2 and a binding site specific for a T cell antigen (e.g., CD3), the bispecific antibody can act as a scaffold, bringing a T cell to a PRAME / HLA-A2 expressing cell, e.g., a PRAME / HLA-A2 expressing cancer cell, to induce an immune response against the PRAME / HLA-A2 expressing cell. In some embodiments, an anti- PRAME / HLA-A2 antibody and / or an immune cell comprising a chimeric antigen receptor (CAR) comprising an anti-PRAME / HLA-A2 antibody is used to treat cancer in a subject. In some embodiments, the antibodies described herein show high binding affinity and specificity for PRAME / HLA-A2. The generation of the highly specific anti-PRAME / HLA- A2 antibodies provided by the present disclosure represents a significant advancement in the field.
[0047] The foregoing and other aspects, implementations, acts, functionalities, features, and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.I. Definitions
[0048] Administering: As used herein, the terms “administering” or “administration” means to provide an antibody or a composition thereof to a subject in a manner that is physiologically and / or pharmacologically useful (e.g., to treat a condition in the subject).
[0049] Affinity Matured Antibody: “Affinity Matured Antibody” is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an improvement in the affinity (i.e. KD, kd or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s). Exemplary affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen. A variety of procedures for producing affinity matured antibodies are known in the art, including the screening of a combinatory antibody library that has been prepared using bio-display. For example, Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and / or framework residues is described by Barbas et al., Proc. Nat. Acad. Sci. USA, 91: 3809-3813 (1994); Schier et al.,Gene, 169: 147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson et al., J. Immunol., 154(7): 3310-3319 (1995); and Hawkins et al, J. Mol. Biol., 226: 889-896 (1992). Selective mutation at selective mutagenesis positions and at contact or hypermutation positions with an activity-enhancing amino acid residue is described in U.S. Pat. No. 6,914,128 Bl.
[0050] Antibody: As used herein, the term “antibody” refers to a polypeptide that includes at least one immunoglobulin variable domain or at least one site, e.g., paratope, that specifically binds to an antigen. In some embodiments, an antibody comprises a paratope. In some embodiments, a paratope comprises one or more complementarity determining regions (CDRs). In some embodiments, an antibody is a full-length antibody. In some embodiments, an antibody is a chimeric antibody. In some embodiments, an antibody is a humanized antibody. However, in some embodiments, an antibody is a Fab fragment, a Fab’ fragment, a F(ab')2 fragment, a Fv fragment or a scFv fragment. In some embodiments, an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody. In some embodiments, an antibody is a diabody. In some embodiments, an antibody comprises a framework having a human germline sequence. In another embodiment, an antibody comprises a heavy chain constant domain selected from the group consisting of IgG, IgGl, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgAl, IgA2, IgD, IgM, and IgE constant domains. In some embodiments, an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and / or a light (L) chain variable region (abbreviated herein as VL). In some embodiments, an antibody comprises a constant domain, e.g., an Fc region. An immunoglobulin constant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known. With respect to the heavy chain, in some embodiments, the heavy chain of an antibody described herein can be an alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In some embodiments, the heavy chain of an antibody described herein can comprise a human alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In a particular embodiment, an antibody described herein comprises a human gamma 1 CHI, CH2, and / or CH3 domain. In some embodiments, the amino acid sequence of the VH domain comprises the amino acid sequence of a human gamma (y) heavy chain constant region, such as any known in the art. Non-limiting examples of human constant region sequences have been described in the art, e.g., see U.S. Pat. No. 5,693,780 and Kabat E A et al., (1991) supra. In some embodiments, the VH domain comprises an amino acid sequence that is at least 70%,75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the variable chain constant regions provided herein. In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecules are conjugated to an antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecules are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, or a phospholipid unit. In some embodiments, an antibody is a construct that comprises a polypeptide comprising one or more antigen binding fragments of the disclosure linked to a linker polypeptide or an immunoglobulin constant domain. Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Examples of linker polypeptides have been reported (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123). Still further, an antibody may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides. Examples of such immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol. 31:1047-1058). In some embodiments, an antibody can be a bispecific and / or a multispecific antibody.
[0051] Approximately: As used herein, the term “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0052] Bispecific Antibody: As used herein, the term “bispecific antibody” refers to apolypeptide or a complex (e.g., two covalently linked polypeptides) that includes two different antigen binding sites, e.g., paratopes, that have different antigen binding specificities. For example, in one embodiment, a bispecific antibody is a polypeptide that includes two different antigen binding sites in which each antigen binding site binds to a different epitope of the same antigen. In other embodiments, a bispecific antibody is a polypeptide that includes two different antigen binding sites in which each site binds to a different antigen. In some embodiments, a bispecific antibody comprises two different sets of immunoglobulin variable domains, each of which set binds to a different epitope or group of epitopes. In some embodiments, at least one antigen to which an antigen binding site of a bispecific antibody specifically binds is a complex (e.g., a peptide complexed with a single chain HLA-A2 molecule).
[0053] Typically, each of the two antigen binding sites is present within an “arm” of a bispecific antibody. In some embodiments, an arm of a bispecific antibody is configured as a monospecific antibody, e.g., a full-length IgG or a fragment thereof. In some embodiments, a bispecific antibody comprises two arms, one or each of which is configured as an Fv region that confers specificity to distinct antigen residues. In some embodiments, a bispecific antibody comprises two arms of the same configuration, e.g., a Fab, a Fab’, a scFv, or any other suitable format. In some embodiments, a bispecific antibody comprises two arms of two different configurations, e.g., a Fab on one arm and a scFv on the other arm. In some embodiments, a bispecific antibody does not comprise an Fc region. In some embodiments, the two arms of a bispecific antibody are linked directly. In some embodiments, the two arms of a bispecific antibody are linked by a linker. In some embodiments, a bispecific antibody comprises an Fc region, e.g., a dimeric Fc or a monomeric Fc. In some embodiments, a bispecific antibody comprises a monomeric Fc. In some embodiments, a bispecific antibody comprises one arm linked to one end (e.g., the N terminal) of a monomeric Fc and a second arm linked to the other end (e.g., the C terminal) of the monomeric Fc (see, e.g., Shan et al., “In vivo pharmacokinetic enhancement of monomeric Fc and monovalent bispecific designs through structural guidance”, Communications Biology, Vol. 4, Article No. 1048 (2021)). In some embodiments, a bispecific antibody comprises a dimeric Fc region. In some embodiments, a bispecific antibody comprises two arms that are oriented symmetrically around an Fc region (e.g., each Fc monomer of a dimeric Fc region is linked to one arm). In some embodiments, a bispecific antibody comprises two distinct heavy chains and two distinct light chains, with each heavy chain / light chain pair having different antigen binding specificity. In some embodiments, a bispecific antibody comprises two arms that are orientedasymmetrically around an Fc (e.g., the two arms of the bispecific antibody are linked to one of the monomers of a dimeric Fc region). In some embodiments, because bispecific antibodies are capable of binding two different targets, they can be used as scaffolds to recruit or redirect cells to antigenic targets, e.g., to recruit immune cells to cancer cells. In some embodiments, a bispecific antibody contains a first antigen binding site that specifically binds a peptide:MHC complex (e.g., PRAME / HLA-A2 complex) and a second antigen binding site. In some embodiments, a bispecific antibody comprises a second antigen binding site specifically binds to a T cell antigen. In some embodiments, the T cell antigen is a CD3 complex or a portion thereof, e.g., CD38, CD3e, CD3y, a CD3e / 8 heterodimer, or a CD3e / y heterodimer. In some embodiments, a bispecific antibody comprises a first antigen binding site structured as a T cell receptor-mimic (TCRm) antibody that specifically binds to a peptide:MHC complex (e.g., PRAME / HLA-A2 complex), and a second binding site that specifically binds to a T cell antigen (e.g., CD3).
[0054] CDR: As used herein, the term "CDR" refers to the complementarity determining region within antibody variable sequences. A typical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding. The VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the IMGT definition, the Chothia definition, the AbM definition, and / or the contact definition, all of which are well known in the art. See, e.g., Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; IMGT®, the international ImMunoGeneTics information system® http: / / www.imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); Lefranc, M.-P, Nucleic Acids Res., 29:207- 209 (2001); Lefranc, M.-P, Nucleic Acids Res., 31:307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [[Epub]], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); Chothia et al., (1989) Nature342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17: 132-143 (2004). See also hgmp.mrc.ac.uk and bioinf.org.uk / abs. As used herein, a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the IMGT definition.
[0055] In certain embodiments, there are three CDRs in each of the variable regions of a heavy chain and a light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions. The term "CDR set" as used herein refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Sub-portions of CDRs may be designated as LC CDR1, LC CDR2 and LC CDR3 or HC CDR1, HC CDR2 and HC CDR3 where the "LC" and the "HC" designate the light chain and the heavy chains regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133- 139 (1995)) and MacCallum (J Mol Biol 262(5) :732-45 (1996)). Still other CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use Kabat or Chothia defined CDRs.
[0056] In certain embodiments, the CDRs of an antibody may have different amino acid sequences when different definition systems are used (e.g., the IMGT definition, the Kabat definition, or the Chothia definition). A definition system annotates each amino acid in a given antibody sequence (e.g., VH or VL sequence) with a number, and numbers corresponding to the heavy chain and light chain CDRs are provided in Table 2. The CDRs listed in Table 1 are defined in accordance with the Kabat definition. One skilled in the art isable to derive the CDR sequences using the different numbering systems for the anti- PRAME / HLA-A2 antibodies provided in Table 1.Table 2. CDR Definitions1IMGT®, the international ImMunoGeneTics information system®, imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999)2Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-32423Chothia et al., J. Mol. Biol. 196:901-917 (1987)
[0057] CDR-grafted antibody: The term "CDR-grafted antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and / or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
[0058] Chemotherapeutic agent: As used herein, a "chemotherapeutic agent" refers to a chemical compound useful in the treatment of proliferative disorders, such as cancers (e.g., cancers expressing CD22). These agents can be, e.g., alkylating agents, such as thiotepa and cyclophosphamide (CYTOXAN®); alkylsulfonates such as busulfan, improsulfan and piposulfane; aziridines such as benzodopa, carbocuone, meturedopa and uredopa; ethylene imines and methylamelamines, including altretamine, triethylene methamine, triethylene phosphoramide, triethylene-thiophosphoramide and trimethylolomelamine; acetogenins (especially bulatacin and bulatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL); beta-lapacona; lapacol; Colchicines; betulinic acid; a camptothecin (which includes the synthetic analog topotecan (HYCAMTIN®), CPT-11 (irinotecan, CAMPTOSAR), acetylcamptothecin, scopolectin and 9-aminocamptothecin); Bryostatin; Callistatin; CC-1065 (including its synthetic analogs of adozelesin, carzelesin and bizelesin); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (which include the synthetic analogs, KW-2189 and CB1-TM1); eleutherobin; pancrati statin; a sarcodictiina, -pongistatin; nitrogen mustardssuch as chlorambucil, chlomaphazine, colofosfamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterin, prednimustine, trofosfamidea, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine and ranimnustine; antibiotics, such as enediin antibiotics (e.g., calicheamicin, especially gammall calicheamicin and omegall calicheamicin (see, for example, Agnew, Chem Inti. Ed. Engl., 33: 183-186 (1994)); dynemycin, including dynemycin A; a esperamycin; as well as neocarzinostatin chromophore and chromophores of related chromoprotein antibiotics), aclacinomisins, actinomycin, autramycin, azaserin, bleomycin, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorrubicin, 6-diazo-5-oxo- L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino- doxorubicin and deoxy doxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin , chelamicin, rodrububicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti -metabolites such as methotrexate and 5- fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogues such as fludarabine, 6-mercaptopurine, tiamiprin, thioguanine; analogues of pyrimidine such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocythabin, floxuridine; androgens such as calusterone, dromostanolone propionate, epithiostanol, mepitiostane, testolactone; antisuprenal drugs such as aminoglutethimide, mitotane, trilostane; folic acid enhancer such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabuchil; bisantrene; edatraxate; defofamin; demecolcine; diazicuone; elfomitin; eliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainin; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; fenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sizofirano; spirogermanium; tenuazonic acid; triazicuone; 2,2 2"- trichlorotriethylamine, trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine), urethane, vindesine (ELDISINE, FILDESIN), dacarbazine, manomustine, mitobronitol, mitolactol, pipobroman, gacitosin, arabinoside ("Ara-C"), thiotepa, taxoids, for example, paclitaxel (TAXOL, Bristol-Myers Squibb Oncology, Princeton, NJ), Cremophor- free ABRAXANE ™, nanoparticle formulation modified with paclitaxel albumin (American Pharmaceutical Partners, Schaumberg, Illinois), and docetaxel (TAXOTERE®; Rhone-Poulenc Rorer, Antony, France); chloranbuchil; gemcitabine (GEMZAR); 6-thioguanine; mercaptopurine; methotrexate; platinum analogues such as cisplatin and carboplatin; vinblastine (VELBAN®); platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine (ONCOVIN®); oxaliplatin; leucovovina; vinorrelbine (NAVELBINE®); novantrone; edatrexate; Daunomycin; aminopterin; ibandronate; Topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoids such as retinoic acid; capecitabine (XELODA®); pharmaceutically acceptable salts, acids or derivatives of any of the foregoing; as well as combinations of two or more of the foregoing such as CHOP, an abbreviation for a combination therapy of cyclophosphamide, doxorubicin, vincristine and prednisolone; CVP, an abbreviation for a combination therapy of cyclophosphamide, vincristine and prednisolone; and FOLFOX, an abbreviation for an oxaliplatin treatment regimen (ELOXATIN ™) combined with 5-FU and leucovorin.
[0059] Chimeric antibody: The term "chimeric antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.
[0060] Compete: The term “compete”, as used herein with regard to an antibody, means that a first antibody binds to an epitope of a protein (e.g., CD22) in a manner sufficiently similar to the binding of a second antibody, such that the result of binding of the first antibody with its epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody. The alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody, can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope. However, where each antibody detectably inhibits the binding of the other antibody with its epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to “Cross-compete” with each other for binding of their respective epitope(s). In some embodiments, antibodies that compete or cross-compete bind to the same or overlapping epitopes. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate that such competing and / or cross-competing antibodies are encompassed and can be useful for the methods and / or compositions provided herein.
[0061] Conjugated: As used herein, “conjugated” means two entities are associated,preferably with sufficient affinity that a therapeutic / diagnostic benefit of the association between the two entities is realized. The association between the two entities can be either direct or via a linker, such as a polymer linker. Conjugated can include covalent or noncovalent bonding as well as other forms of association, such as entrapment, e.g., of one entity on or within the other, or of either or both entities on or within a third entity, such as a micelle.
[0062] Complementary: As used herein, the term “complementary” refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides. In particular, complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. For example, if a base at one position of an oligonucleotide is capable of hydrogen bonding with a base at the corresponding position of a target nucleic acid (e.g., an mRNA), then the bases are considered to be complementary to each other at that position. Base pairings may include both canonical Watson-Crick base pairing and non- Watson-Crick base pairing (e.g., Wobble base pairing and Hoogsteen base pairing). For example, in some embodiments, for complementary base pairings, adenosine-type bases (A) are complementary to thymidine- type bases (T) or uracil-type bases (U), that cytosine-type bases (C) are complementary to guanosine-type bases (G), and that universal bases such as 3-nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T. Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A, C, U or T.
[0063] Conservative amino acid substitution: As used herein, a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Fourth Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2012, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
[0064] Cross-reactive: As used herein and in the context of a targeting agent (e.g., antibody), the term “cross-reactive,” refers to a property of the agent being capable ofspecifically binding to more than one antigen of a similar type or class (e.g., antigens of multiple homologs, paralogs, or orthologs) with similar affinity or avidity.
[0065] Cytotoxic agent: As used herein, the term "cytotoxic agent" refers to a substance that inhibits or prevents a cellular function and / or causes cell death or destruction. Such agents are well known in the art, and include, e.g., radioactive isotopes (e.g., At211, 1131, 1125, Y90, Rel86, Rel88, Sml53, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamycin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin, or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof, such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and / or variants thereof; and the various anti-tumor or anti-cancer agents described below.
[0066] Effective Amount: As used herein, “an effective amount” refers to the amount of each active agent (e.g., anti-PRAME / HLA-A2 antibody) required to confer a desired effect (e.g., a therapeutic effect on the subject), either alone or in combination with one or more other active agents. In some embodiments, the therapeutic effect is reduced PRAME / HLA- A2 level or activity and / or alleviated disease conditions (e.g., treatment of a PRAME- expressing cancer or reduction and / or PRAME-expressing tumor size).
[0067] Framework: As used herein, the term "framework" or "framework sequence" refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations. The six CDRs (LC CDR1, LC CDR2, and LC CDR3 of light chain and HC CDR1, HC CDR2, and HC CDR3 of heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred to by others, represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region. Human heavy chain and light chain acceptor sequences are known in the art. In one embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.
[0068] Human antibody: The term "human antibody", as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term "human antibody", as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
[0069] Humanized antibody: The term "humanized antibody" refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and / or VL sequence has been altered to be more "human-like", i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences. In one embodiment, humanized anti-PRAME / HLA-A2 antibodies and antigen binding portions are provided. Such antibodies may be generated by obtaining murine anti-PRAME / HLA-A2 monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT publication No. WO 2005 / 123126 A2.
[0070] Humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some embodiments, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non- human residues. Furthermore, the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences but are included to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Antibodies may have Fc regions modified as described in WO99 / 58572. Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.
[0071] In some embodiments, humanization is achieved by grafting the CDRs (e.g., as shown in Table 1) into the human variable domains (e.g., IGKV1-NL1*O1 and IGHVl-3*01 human variable domain). In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Table 1, and / or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Table 1.
[0072] Isolated antibody: An "isolated antibody", as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds PRAME / HLA-A2 is substantially free of antibodies that specifically bind antigens other than PRAME / HLA-A2). An isolated antibody that specifically binds PRAME / HLA-A2 may, however, have crossreactivity to other antigens. Moreover, an isolated antibody may be substantially free of other cellular material and / or chemicals.
[0073] Kabat numbering: The terms "Kabat numbering", "Kabat definitions” and "Kabat labeling" are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). For the heavy chain variable region, the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3. For the light chain variable region, the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
[0074] Multispecific Antibody: As used herein, the term “multispecific antibody” refers to a polypeptide or a complex (e.g., two or more covalently linked polypeptides) that includes at least two different immunoglobulin variable domains or at least two different sites, e.g., paratopes, that specifically bind to one or more antigens. For example, in one embodiment, amultispecific antibody is a polypeptide that includes at least two different sites in which each site binds to a different epitope of the same antigen. In other embodiments, a multispecific antibody is a polypeptide that includes at least two different sites in which each site binds to a different antigen. In some embodiments, an antigen to which a site of a multispecific antibody specifically binds is a complex (e.g., a peptide complexed with a single chain HLA- A2 molecule).
[0075] PRAME: PRAME, or PReferentially expressed Antigen in MElanoma, is a cancer- associated protein. Under normal conditions, PRAME is expressed intracellularly only in germline cells (e.g., sperm cells). It has been reported to function as a repressor of retinoic acid signaling. PRAME expression has been observed in a number of cancers, including but not limited to melanoma, leukemia, breast cancer, and lung cancer. In cancer cells, PRAME is processed by the proteosome such that fragments of the protein are presented on MHC-I molecules on the cancer cell surface, forming PRAME / HLA-A2 complexes in humans.
[0076] Recombinant antibody: The term "recombinant antibody", as used herein, is intended to include all antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), including, for example, antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29: 128- 145; Hoogenboom H., and Chames P. (2000) Immunology Today 21 :371-378), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21:364-370) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. In some embodiments, recombinant human antibodies are provided herein. In certain embodiments, such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. One embodiment of thedisclosure provides fully human antibodies capable of binding human PRAME / HLA-A2 which can be generated using techniques well known in the art, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO 2005 / 007699 A2.
[0077] Selective: As used herein, the term “selective” or “selectively” refers to the ability of a molecule to produce an effect (e.g., inhibit, antagonize, agonize, etc.) in relation to its target molecule compared to a reference molecule. For example, a molecule that selectively inhibits its target molecule means that this molecule is capable of inhibiting its target molecule to a degree that is distinguishable from a reference molecule in an inhibition assay or other inhibitory context. For example, with respect to an inhibitor, the term, “selectively inhibits”, refers to the ability of the inhibitor to inhibit its target molecule with a degree that is distinguishable from a reference molecule that is not substantially inhibited in an inhibition assay, e.g., to an extent that permit selective inhibition of the target molecule, as described herein. Once the reaction is terminated, the signal produced by inhibiting the target molecule can be measured. The half maximal inhibitor concentration for the target molecule and the reference molecule can be calculated. In some embodiments, a molecule described herein selectively binds to a target molecule. In some embodiments, a molecule described herein selectively binds PRAME / HLA-A2. In some embodiments, a molecule described herein directs a T cell to target a PRAME / HLA-A2 expressing cell. In some embodiments, a molecule described herein binds to PRAME / HLA-A2 to induce killing of PRAME / HLA-A2 expressing cells, e.g., PRAME / HLA-A2 expressing tumor cells.
[0078] Specifically binds: As used herein, the term “specifically binds” refers to the ability of a molecule to bind to a binding partner with a degree of affinity or avidity that enables the molecule to be used to distinguish the binding partner from an appropriate control in a binding assay or other binding context. With respect to an antibody, the term, “specifically binds”, refers to the ability of the antibody to bind to a specific antigen with a degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, as described herein. In some embodiments, an antibody specifically binds to a target if the antibody has a KD for binding the target of at least about 10'4M, 10'5M, 10'6M, 10'7M, 10'8M, 10'9M, 10’10M, 10'11M, 10'12M, 10’13M, or less. In some embodiments, an antibody specifically binds a PRAME peptide bound by HLA-A2.
[0079] Subject: As used herein, the term “subject” refers to a mammal. In some embodiments, a subject is a human. In some embodiments, a subject is a patient, e.g., ahuman patient that has or is suspected of having a disease. In some embodiments, the subject is a human patient who has or is suspected of having a PRAME-expressing cancer or tumor and / or one or more conditions arising as a result of a PRAME-expressing cancer or tumor.
[0080] Treatment: As used herein, the term “treating” or “treatment” refers to the application or administration of a composition including one or more active agents (e.g., anti- PRAME / HLA-A2 antibodies) to a subject, who has a target disease or disorder (e.g., cancer expressing PRAME), a symptom of the disease / disorder, or a predisposition toward the disease / disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder. Alleviating a target disease / disorder includes delaying or preventing the development or progression of the disease or reducing disease severity.II. Antibodies and Related Compositions(a) Anti-PRAME / HLA-A2 Antibodies
[0081] In some embodiments, the anti-PRAME / HLA-A2 antibody is an antibody specific for PRAME / HLA-A2. Provided herein, in some aspects, are antibodies that bind to human PRAME / HLA-A2 with high specificity and affinity. In some embodiments, the anti- PRAME / HLA-A2 antibody described herein specifically binds to any extracellular epitope of a PRAME / HLA-A2 or an epitope that becomes exposed to an antibody.
[0082] PReferentially expressed Antigen in MElanoma (PRAME) is one of the most highly expressed cancer-associated antigens. Under homeostatic conditions, PRAME is expressed intracellularly only in the testis or placenta and is thus categorized as a cancer-testis antigen. The normal function of PRAME is not fully understood, but it is thought to promote cancer cell proliferation, survival, and immune evasion. While PRAME is normally only expressed intracellularly, in cancer cells it is broken down into peptides and peptide fragments, which are then bound by HLA molecules for display on the cancer cell surface.
[0083] The present disclosure, at least in part, is based on the development of anti- PRAME / HLA-A2 antibodies and their variants thereof, which showed high binding affinity and specificity to PRAME / HLA-A2. PReferentially expressed Antigen in MElanoma (PRAME) is a protein found to be expressed by cells in a number of cancers, including melanoma, leukemia, breast cancer, lung cancer, and others. In healthy conditions, PRAME expression is limited to germline cells (e.g., sperm cells) and is not expressed in somatic cells. PRAME is an intracellular protein thought to function as a repressor of retinoic acidsignaling, but in cancer cells it is processed by the proteosome such that PRAME peptides are presented on MHC or HLA molecules on the cancer cell surface, forming a PRAME / MHC complex (e.g., a PRAME / MHC-I complex) or a PRAME / HLA complex (e.g., a PRAME / HLA-A2 complex). Such complexes can be recognized by immune cells, including T effector cells.
[0084] In some embodiments, an anti-PRAME / HLA-A2 antibody described herein specifically binds to a human PRAME peptide bound by HLA-A2. Exemplary amino acids sequence of human PRAME is set forth in NCBI Accession Numbers CAG30435.1, AAH39731.1, AFX65484.1, AFX65485.1, AFX65486.1, AFX65487.1, KAI2596882.1, KAI2596883.1, KAI2596884.1, KAI2596885.1, or KAI2596886.1. An exemplary amino acid sequence of human PRAME is set forth in SEQ ID NO: 20. In some embodiments, an anti- PRAME / HLA-A2 antibody described herein specifically binds to a PRAME peptide comprising the amino acid sequence consists of SLLQHLIGL (SEQ ID NO: 19).
[0085] Human PRAME amino acid sequence (SEQ ID NO: 20):MERRRLRGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFD GRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDL RKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEG ACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPT LAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLR GRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQAL LERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLS NLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRTFY DPEP ILCPCFMPN
[0086] In some embodiments, the present disclosure provides antibodies that specifically binds members of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X56X57X58X59HLIGX60 (SEQ ID NO: 18). In some embodiments, when X57 is L, X58 is L, X59 is Q, and Xeo is L. In some embodiments, when X56 is S, X58 is L, X59 is Q, and Xeo is L, X57 is M or L. In some embodiments, when X56 is S, X57 is L, X59 is Q, and Xeo is L, X58 is D, M, W, Y, L, N, Q, F, H, A, or T. In some embodiments, when X56 is S, X57 is L, X58 is L, and Xeo is L, X59 is E, P, N, Q, S, G, K, T, or A. In some embodiments, when X56 is S, X57 is L, X58 is L, and X59 is Q, Xeo is Y, I, T, L, or A.
[0087] In some embodiments, the present disclosure provides antibodies that specifically binds members of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acidsequence defined by a formula set forth as X53X54X55X56X57LIGX58. In some embodiments, when X54 is L, X53 is S, X55 is L, X56 is Q, X57 is H, and X58 is L. In some embodiments, when X53 is S, X55 is L, X56 is Q, X57 is H, and X58 is L, X54 is M or L. In some embodiments, when X53 is S, X54 is L, X56 is Q, X57 is H, and X58 is L, X55 is Y, M, L, F, H, D, or W. In some embodiments, when X53 is S, X54 is L, X55 is L, X57 is H, and X58 is L, X56 is D, E, P, N, G, S, Q, T, K, or A. In some embodiments, when X53 is S, X54 is L, X55 is L, X56 is Q, and X58 is L, X57 is W, S, A, N, H, G, T, or S. In some embodiments, when X53 is S, X54 is L, X55 is L, X56 is Q, and X57 is H, X58 is Y, T, L, or A.
[0088] In some embodiments, at least one member of the set of complexes is a PRAME peptide bound by HLA-A2. In some embodiments, the PRAME peptide comprises the amino acid sequence consisting of SLLQHLIGL (SEQ ID NO: 19).
[0089] In some aspects, the present disclosure also provides an antibody obtained by a process comprising:(l) exposing members of a set of complexes, each complex comprises a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X56X57X58X59HLIGX60 (SEQ ID NO: 18), to a library of antibodies under conditions in which at least one antibody of the library that specifically binds to the members of the set of complexes is detected; (2) obtaining the sequence of a heavy chain variable domain of an antibody detected in step (1) that specifically binds the members of the set of complexes; and (3) producing an antibody having at least a heavy chain complementarity determining region 3 (HC CDR3) of the heavy chain variable domain of step (2), thereby obtaining the antibody that specifically binds to the members of the set of complexes. In some embodiments, the process further comprising (4) confirming that the antibody produced by step (3) binds PRAME / HLA-A2 complex (e.g., a complex comprising SLLQHLIGL (SEQ ID NO: 19 bound by HLA-A2).
[0090] In some embodiments, a need for means for binding a PRAME-HLA-A2 complex exists for treating cancers expressing a PRAME peptide bound by HLA-A2 on the cell surface. Accordingly, in some embodiments, the present disclosure provides a means for specifically binding a peptide / HLA-A2 complex, wherein the peptide / HLA-A2 complex is a member of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X56X57X58X59HLIGX60 (SEQ ID NO: 18). In some embodiments, the present disclosure provides a means for specifically binding a PRAME / HLA-A2 complex, wherein the PRAME / HLA-A2 complex comprises a PRAME peptide comprising the amino acid sequence of SLLQHLIGL (SEQ ID NO: 19) bound byHLA-A2. In some embodiments, the means for specifically binding a peptide / HLA-A2 complex (e.g., peptide X56X57X58X59HLIGX60 (SEQ ID NO: 18) bound by HLA-A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof). In some embodiments, the means for specifically binding a PRAME / HLA-A2 complex (e.g., PRAME peptide SLLQHLIGL (SEQ ID NO: 19) bound by HLA-A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof).
[0091] In some aspects, the present disclosure also provides an antibody obtained by a process comprising: (1) exposing members of a set of complexes, each complex comprises a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X53X54X55X56X57LIGX58, to a library of antibodies under conditions in which at least one antibody of the library that specifically binds to the members of the set of complexes is detected; (2) obtaining the sequence of a heavy chain variable domain of an antibody detected in step (1) that specifically binds the members of the set of complexes; and (3) producing an antibody having at least a heavy chain complementarity determining region 3 (HC CDR3) of the heavy chain variable domain of step (2), thereby obtaining an antibody that specifically binds to the members of the set of complexes. In some embodiments, the process further comprising (4) confirming that the antibody produced by step (3) binds PRAME / HLA-A2 complex (e.g., a complex comprising SLLQHLIGL (SEQ ID NO: 19 bound by HLA-A2).
[0092] In some embodiments, a need for means for binding a PRAME-HLA-A2 complex exists for treating cancers expressing a PRAME peptide bound by HLA-A2 on the cell surface. Accordingly, in some embodiments, the present disclosure provides a means for specifically binding a peptide / HLA-A2 complex, wherein the peptide / HLA-A2 complex is a member of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X53X54X55X56X57LIGX58. In some embodiments, the present disclosure provides a means for specifically binding a PRAME / HLA-A2 complex, wherein the PRAME / HLA-A2 complex comprises a PRAME peptide comprising the amino acid sequence of SLLQHLIGL (SEQ ID NO: 19) bound by HLA-A2. In some embodiments, the means for specifically binding a peptide / HLA-A2 complex (e.g., peptide X53X54X55X56X57LIGX58 bound by HLA-A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof). In some embodiments, the means for specifically binding a PRAME / HLA-A2 complex (e.g., PRAME peptideSLLQHLIGL (SEQ ID NO: 19) bound by HLA-A2) is an anti-PRAME / HLA-A2 antibody described herein (e.g., an antibody described in Table 1 or equivalents thereof).
[0093] In some embodiments, the anti-PRAME / HLA-A2 antibody described herein specifically binds to an epitope on human PRAME bound by HLA-A2. In some embodiments, the anti-PRAME / HLA-A2 antibody described herein may bind to a fragment of a human PRAME / HLA-A2. The fragment of PRAME / HLA-A2 may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, or between about 75 and about 150 amino acids in length. The fragment may comprise a contiguous number of amino acids from PRAME / HLA-A2. In some embodiments, the anti- PRAME / HLA-A2 antibody specifically binds an HLA-A2 (e.g., HLA-A*0201)-restricted fragment of PRAME comprising the amino acid sequence consisting of SLLQHLIGL (SEQ ID NO: 19).
[0094] In some embodiments, the anti-PRAME / HLA-A2 antibodies described herein are affinity matured clones. In some embodiments, an anti-PRAME / HLA-A2 antibody specifically binds a PRAME / HLA-A2 (e.g., a human PRAME / HLA-A2) with binding affinity (e.g., as indicated by KD) of at least about 10'4M, 10'5M, 10'6M, 10'7M, 10'8M, 10’9M, 10'10M, 10'11M, 10'12M, IO’13M, or less. For example, the anti-PRAME / HLA-A2 antibodies of the present disclosure can bind to a PRAME / HLA-A2 protein complex (e.g., human PRAME / HLA-A2) with an affinity between 5 pM and 500 nM, e.g., between 50 pM and 100 nM, e.g., between 500 pM and 50 nM. The disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a PRAME / HLA-A2 protein complex (e.g., human PRAME / HLA-A2) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of the anti- PRAME / HLA-A2 antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, the anti- PRAME / HLA-A2 antibodies described herein bind to PRAME / HLA-A2 with a KD of submicromolar range.
[0095] Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance (SPR), florescent activated cell sorting (FACS) or spectroscopy (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS-Pbuffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v / v) surfactant P20) and PBS buffer (lOmM PO4-3, 137mM NaCl, and 2.7mM KC1). These techniques can be used to measure the concentration of bound proteins as a function of target protein concentration. The concentration of bound protein ([[Bound]]) is generally related to the concentration of free target protein ([[Free]]) by the following equation:[[Bound]] = [[Free]] / (Kd+[[Free]])
[0096] It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as EEISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.
[0097] In some embodiments, an antibody is a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, or a Fv. In some embodiments, the antibody comprises a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.
[0098] In some embodiments, according to the Kabat definition system, an anti-PRAME- HEA-A2 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of X1X2X3X4X5X6X7, wherein Xi is M, S, or absent; X2 is D, G, N, S, or absent; X3 is G, S, N, or T; X4 is D, F, N, H, or Y; X5 is F, S, W, or Y; Xe is W or absent; and X7 is N or S.In some embodiments, according to the Kabat definition system, an anti-PRAME-HEA-A2 antibody of the present disclosure comprises a HC CDR2 having the amino acid sequence of X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16, wherein Xi is E, F, Y, or W; X2is I, M, or V; X3is F, Y, or N; X4is D, H, N, Y, or P; X5is S, T, or N; X6is G, E, or S; X7is N, S, T, or G; X8is T or Y; X9is N, S, Y, or T; X10 is Y or G; Xu is N or Y; X12 is P or A; X13 is S or Q; Xi4is E or K; X15 is K or F; and Xi6 is S, T, or Q.
[0099] In some embodiments, according to the Kabat definition system, an anti-PRAME- HEA-A2 antibody of the present disclosure comprises a HC CDR3 having the amino acid sequence 01X1X2X3X4X5X6X7X8X9X10X11X12, wherein Xi is E or absent; X2 is E, G, or absent; X3is D, Q, T, or W; X4is D, E, I, M, T, or Y;X5is I, L, M, or N;X6is I, L, R, or W, X7is G, N, or R;X8is A, G, F;X9is A, F, G, H, or V; X10 is F, I, or E; Xu is D or G; X12 is D, G, H, I, P, or Y.[000100] In some embodiments, according to the Kabat definition system, an anti-PRAME- HLA-A2 antibody of the present disclosure comprises a LC CDR1 having the amino acid sequence of RASX4X5ISX8WLA (SEQ ID NO: 186), wherein X4 is Q or P; X5 is G or D; and X8is N, R, or S.[000101] In some embodiments, according to the Kabat definition system, an anti-PRAME- HLA-A2 antibody of the present disclosure comprises a LC CDR2 having the amino acid sequence of X1X2SX4LX6X7, wherein Xi is A, T, or V; X2 is A or V; X4 is N or S; Xi> is H or Q; and H7 is G or S.[000102] In some embodiments, according to the Kabat definition system, an anti-PRAME- HLA-A2 antibody of the present disclosure comprises a LC CDR3 having the amino acid sequence of QQX3NX5FPX8T (SEQ ID NO: 187), wherein X3is A or T; X5is N, R, or S; X8is F, L, or W.[000103] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody comprises a HC CDR1 having the amino acid sequence of X1X2X3X4X5WX6, wherein Xi is S or N; X2 is Y, N, or G; X3 is F, N or S; X4 is H or absent; X5 is W, Y or absent; and Xi> is N or S. In some embodiments, when Xi of HC CDR1 is N, X2 is N and X5 is W. In some embodiments, when X4 of CDR1 is H, Xi is S and X5 is Y. In some embodiments, when Xi of HC CDR1 is S, X2 is Y or G, and X3 is F or S. In some embodiments, when X3 of HC CDR1 is F, Xi is S and X5 is absent.[000104] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody comprises a HC CDR2 having the amino acid sequence of X7IYX8X9GX10TNYNPSLKS (SEQ ID NO: 2), wherein X7is E, Y or F; X8is H, D, or Y; X9is S or T; and X10 is S, N or T. In some embodiments, when X7 of HC CDR2 is Y, X8is Y or D, and X10 is T or N. In some embodiments, when X8of HC CDR2 is Y, X7 is Y or F, and X9 is S or T.[000105] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody comprises a HC CDR3 having the amino acid sequence of X11X12X13X14IRGX15X16X17X18X19, wherein Xu is D or E; X12 is G, W, or absent; X13 is T,D, or E; X14 is M or L; X15 is V, A or H; Xi6 is G or absent; X17 is L or F; Xis is G or D; and X19 is Y, P, I, or D. In some embodiments, when Xu of HC CDR3 is E, X12 is G or W, X15 is A or H, and X19 is P, I, or D. In some embodiments, when X12 of HC CDR3 is W, X13 is D orE, X15 is A or H, and X19 is I or D. In some embodiments, when X14 of HC CDR3 is M, Xu is D or E, X12 is G or absent, X15 is V or A, and X19 is Y or P. In some embodiments, when X14 is L, X13 is D or E, X15 is A or H, X19 is I or D.[000106] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody comprises a LC CDR1 having the amino acid sequence of RASX20X21ISX22WLA (SEQ ID NO: 4), wherein X20 is Q or P, X21 is G or D, and X22 is S, R, or N.[000107] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody comprises a LC CDR2 having the amino acid sequence of X23ASSLQX24 (SEQ ID NO: 5), wherein X23 is A, T or V, and X24 is S or G. In some embodiments, when X23 of LC CDR2 is A, X24 is S or G.[000108] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody comprises a LC CDR3 having the amino acid sequence of QQX25NX26FPX27T (SEQ ID NO: 6), wherein X25is T or A; X26 is N or S; and X27 is W or L. In some embodiments, when X25 of LC CDR3 is A, X26 is S, and X27 is W or L.[000109] In some embodiments, when Xi of HC CDR1 of an anti-PRAME / HLA-A2 antibody is S, X2 is Y or G; X3 is F or S; X5 is T or absent; Xi> is S or N; X7 is E, Y or F; Xs isH, D, or Y; X9 is S or T; X10 is S, N, or T; Xu is D or E; X12 is W or absent; X13 is T, D, or E; X14 is M or L; X15 is V, A or H; Xi6 is absent; X17 is L or F; Xis is G or D; and X19 is Y, I, or D. In some embodiments, X23 is A or V; X24 is S or G; X25 is T or A; and X27 is L. In some embodiments, when Xi is N; X2 is N; X3 is N; X4 is absent or H; X5 is W, Y, or absent; Xi> is N or S; X7is E, Y, or F; X8is Y; X9is S or T; X10is S, N, or T; Xu is D or E; X12is G; X13is T, D, or E; X14 is M or L; X15 is V, A, or H; Xi6 is G; X17 is L or F; Xis is G or D; and X19 is P.[000110] In some embodiments, when X7 of HC CDR2 of an anti-PRAME / HLA-A2 antibody is F, Xi is S or N; X2 is G; X3 is S, F, or N; X4 is H or absent; X5 is Y; Xe is S or N; X8is Y; X9 is T or S; X10 is T, N, or S; Xu is E or D; X12 is W; X13 is E, D, or T; X14 is L or M; X15 is H, A, or V; Xi6 is absent or G; X17 is F; Xis is D or G; and X19 is D.[000111] In some embodiments, when Xu of HC CDR3 of an anti-PRAME / HLA-A2 antibody is E, Xi is N or S; X2 is N, Y, or G; X3 is Y, F, or S; X4 is H or absent; X5 is W, Y, or absent; Xi> is S; X7 is Y or F; X8is Y or D; X9 is S or T; X10 is T or N; X12 is G or W; X13 is T, D, or E; X14 is M or L; X15 is A or H; Xi6 is G or absent; X17 is F; Xis is D; and X19 is P,I, or D. In some embodiments, X23 is T, A, or V; X24 is S or G; X25 is A; X26 is S; and X27 is L or W. In some embodiments, when X19 is I, Xi is S or N; X2 is Y; X3 is F, N, or S; X4 is absent; X5 is W, Y, or absent; Xi> is S; X7 is E, Y, or F; X8is H, Y, or D; X9 is S; X10 is S, T, or N; Xu is E; X12 is G, W, or absent; X13 is T, D, or E; X14 is L, X15 is V, A, or H; Xi6 is absent, X17 is L or F; and Xis is D.[000112] In some embodiments, an antibody comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 according to paragraphs
[0101] -
[0114] . [000113] In some embodiments, the antibody of paragraph
[0115] further comprises a framework region 1 (FR1) comprising the amino acid sequence QVQLX40X41SGX42X43X44X45KPX46X47X48X49X50X51X52CX53X54SGX55X56X57X58 (SEQ ID NO: 188), wherein X40 is Q or V; X41 is E or Q; X42 is A or P; X43 is E or G; X44 is L or V;X45 is K or V; X46 is G or S; X47 is A, E or G; X48 is S or T; X49 is L or V; X50 is K or S; X51 is L or V; X52 is S or T; X53 is A, K, S, or T; X54 is A or V; X55 is D, G, V, or Y; X56is I or S; X57 is F, I, or V; X58is I, N, S, or T.[000114] In some embodiments, the antibody of paragraph
[0115] further comprises a framework region 2 (FR2) comprising the amino acid sequence WX59RX60X61PGX62GLX63WIG (SEQ ID NO: 189), wherein X59 is I or V; X60is Q or R; X6iis P or T; X62 is K or R; X63 is E or G.[000115] In some embodiments, the antibody of paragraph
[0115] further comprises a framework region 3 (FR3) comprising the amino acid sequence RVTX64X65X66X67X68X69X70X71X72X73X74X75X76X77X78SX79X80X81X82DTAX83YYCAR (SEQ ID NO: 190), wherein X64 is I, L, or M; Xes is S or T; Xee is I, L, R, or V; X67 is D or N; Xes is T, K, or P; X69 is P or S; X70 is I or K; X71 isN or S; X72 is H, Q, or T; X73 is A or F; X74 is S or Y; X75 is L or M; X76 is E, K, M, N, or R; X77 is L or M; X78 is N, S, T, or R; X79 is L or V; Xso is R or T; Xsi is A or S; Xs2 is A or E; and Xs3 is V or M.[000116] In some embodiments, the antibody of paragraph
[0115] further comprises a framework region 3 (FR3) comprising the amino acid sequence WGX84GTX85VTVSS (SEQ ID NO: 191), wherein Xs4 is R or Q and Xss is L or M.[000117] In some embodiments, according to the Kabat definition system, an anti- PRAME / HLA-A2 antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of X1X2X3X4X5WX6, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of X11X12X13X14IRGX15X16X17X18X19, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000118] In some embodiments, an anti-PRAME / HLA-A2 antibody comprises a variable heavy domain (VH) with a framework region 1 (FR1) having the amino acid sequence of SEQ ID NO: 7, a framework region 2 (FR2) having the amino acid sequence of SEQ ID NO:8, a framework region 3 (FR3) having the amino acid sequence of SEQ ID NO: 9, and a framework region 4 (FR4) having the amino acid sequence of SEQ ID NO: 10.[000119] In some embodiments, an anti-PRAME / HLA-A2 antibody comprises a VH domain with a FR1 having the amino acid sequence of QVQLQESGPGLVKPSX28TLSLTCX29VSGX30SX31X32 (SEQ ID NO: 7), wherein X28is G or E; X29 is T or A; X30 is G or D; X31 is I or V; and X32 is N or S.[000120] In some embodiments, an anti-PRAME / HLA-A2 antibody comprises a VH domain with a FR2 having the amino acid sequence of WX33RQPPGKGLEWIG (SEQ ID NO: 8), wherein X33 is I or V.[000121] In some embodiments, an anti-PRAME / HLA-A2 antibody comprises a VH domain with a FR3 having the amino acid sequence of RVTISX34DX35SKNX36FSLX37LX38SVTAADTAVYYCAR (SEQ ID NO: 9), wherein X34 is V or L, X35 is T, K, or P, X36 is Q or H, X37 is K or N, and X38 is S or R.[000122] In some embodiments, an anti-PRAME / HLA-A2 antibody comprises a VH domain with a FR4 having the amino acid sequence of WGQGTX39VTVSS (SEQ ID NO: 10), wherein X39 is L or M.[000123] In some embodiments, the disclosure provides an antibody comprising a heavy chain complementarity determining region 1 (HC CDR1) comprising the amino acid sequence X40X41X42WX43, wherein X40 is S or T, X41 is Y or F, X42 is F or Y, and X43 is N or S; a heavy chain complementarity determining region 2 (HC CDR2) comprising the amino acid sequence YIYYSGX44TX45YNPSLKS (SEQ ID NO: 12), wherein X44 is S or T, and X45 is N or Y; and a heavy chain complementarity determining region 3 (HC CDR3) comprising the amino acid sequence X46X47X48LIRGX49X50X51Y (SEQ ID NO: 13), wherein X46 is D or E, X47 is T or W, X48 is M or E, X49 is V or H, X50 is I or F, and X51 is G or D. In some embodiments, an antibody further comprises a light chain complementarity determining region 1 (LC CDR1) comprising the amino acid sequence RASQGISSWLA (SEQ ID NO: 24); a light chain complementarity determining region 2 (LC CDR2) comprising the amino acid sequence X52ASSLQS (SEQ ID NO: 14), wherein X52 is A or V; and a light chain complementarity determining region 3 (LC CDR3) comprising the amino acid sequence QQX53NX54FPLT (SEQ ID NO: 15), wherein X53 is T or A, and X54 is N or S.[000124] In some embodiments, when X44 is S, X40 is S, X41 is Y, X42 is F or Y, X43 is S, X45 is N or Y, X46 is D or E, X47 is W, X48 M or E, X49 is L, X50 is H, X51 is L, I, or F, X52 G or D, X53 is V, X54 is T or A, and X55 is N or S. In some embodiments, when X51 is F, X40 is S, X41 is Y, X42 is F or Y, X43 is S, X44 is T or S, X45 is Y or N, X46 is E, X47 is W, X48 is E, X50is H, X52 is D, X53 is V, X54 is A, and X55 is S. In some embodiments, when X40 is T, X41 is F, X42 is F, X43 is N, X44 is T, X45 is N, X46 is D, X47 is T, X48 is M, X49 is absent, X50 is V, X51 is I, X52 is G, X53 is A, X54 is T, and X55 is N. In some embodiments, when X40 is S, X41 is Y, X42 is F, X43 is N, X44 is T, X45 is N, X46 is D, X47 is T, X48 is M, X49 is absent, X50 is V, X51 is L, X52 is G, X53 is A, X54 is T, and X55 is N.[000125] In some embodiments, the disclosure provides an antibody comprising a heavy chain complementarity determining region 1 (HC CDR1) comprising the amino acid sequence X40X41X42WWS, wherein X40 is S or N, X41 is S, G or N, and X42 is N or D; a heavy chain complementarity determining region 2 (HC CDR2) comprising the amino acid sequence EX43YX44SGSTX45YNPSLKX46 (SEQ ID NO: 200), wherein X43 is I or V; X44 is H or N; X45is N or S; and X46 is S or T; and a heavy chain complementarity determining region 3 (HC CDR3) comprising the amino acid sequence EGTMIRGAGFDP (SEQ ID NO: 201). In some embodiments, an antibody further comprises a light chain complementarity determining region 1 (LC CDR1) comprising the amino acid sequence RASX47X48ISX49WLA (SEQ ID NO: 202), wherein X47 is Q orP, X48 is G or D, and X49 is R, N or S; a light chain complementarity determining region 2 (LC CDR2) comprising the amino acid sequence X50ASSLX51S (SEQ ID NO: 203), wherein X50 is A or T, and X51 is H or Q; and a light chain complementarity determining region 3 (LC CDR3) comprising the amino acid sequence QQANX52FPT (SEQ ID NO: 204), wherein X52 is S or R.[000126] In some embodiments, when X41 is S, X40 is S, X42 is N, X43 is I or V, X44 is H or N, X45 is N or S, X46 is S or T, X47 is Q or P, X48 is G or D, X49 is R or N, X50 is A, X51 is H or Q, and X52 is S. In some embodiments, when X45 is S, X40 is S, X41 is G or N, X42 is D or N, X43 is I, X44 is H, X46 is S, X47 is Q, X48 is G, X49 is S, X50 is A, X51 is W, and X52 is S or R. In some embodiments, when X40 is S, X41 is N, X42 is N, X43 is I, X44 is H, X45 is S, X46 is S, X47 is Q, X48 is G, X49 is S, X50 is A, X51 isQ, and X52 is R. In some embodiments, when X40 is N, X41 is N, X42 is N, X43 is I, X44 is H, X45 is N, X46 is S, X47 is Q, X48 is G, X49 is S, X50 is T, X51 is Q, and X52 is S.In some embodiments, an antibody is a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, or a Fv. In some embodiments, an antibody comprises a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.[000127] The heavy chain variable domain (VH) and light chain variable domain (VL), CDR sequences, and heavy chain and light chain constant region sequences of non-limiting examples of anti-PRAME / HLA-A2 antibodies are provided in Table 1.Table 1. Examples of anti-PRAME / HLA-A2 binders (CDRs according to the Kabat definition)Table 7 -Consensus Sequences for Antibodies #1 - #33Table 8. anti-PRAME / HLA-A2 consensus sequences (CDRs according to Kabat definition)[000128] In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvementcomprises HC CDR1, HC CDR2, and HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.[000129] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Table 1. In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprise the LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the present disclosure provides an antibody that specifically binds PRAME / HLA-A2 complex, wherein the improvement comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.[000130] In some embodiments, the anti-PRAME / HLA-A2 antibodies of the present disclosure comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for an antigen. Accordingly, the anti-PRAME / HLA-A2 antibodies of the disclosure may include at least the heavy and / or light chain CDR3 as of any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.[000131] In some embodiments, the isolated anti-PRAME / HLA-A2 antibody comprises a heavy chain variable region that comprises a heavy chain CDR1 (HC CDR1), a heavy chain CDR2 (HC CDR2), and a heavy chain CDR3 (HC CDR3).[000132] Also within the scope of the present disclosure are functional variants of any of the exemplary anti-PRAME / HLA-A2 antibodies as disclosed herein. A functional variant may contain one or more amino acid residue variations in the VH and / or VL, or in one or more of the HC CDRs and / or one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities e.g., substantially similar binding affinity, binding specificity, inhibitory activity, anti-inflammatory activity, or acombination thereof) as the reference antibody.[000133] In some embodiments, any of the anti-PRAME / HLA-A2 antibodies of the disclosure have one or more CDRs (e.g., HC CDR or LC CDR) sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 sequences from one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the position of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). Lor example, in some embodiments, the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and / or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as immuno specific binding to PRAME / HLA- A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). In another embodiment, the length of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).[000134] Accordingly, in some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRS from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more aminoacids longer than one or more of the CDRs described herein (e.g., CDRS from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRs from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). Any method can be used to ascertain whetherimmuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained, for example, using binding assays and conditions described in the art.[000135] In some examples, any of the anti-PRAME / HLA-A2 antibodies of the disclosure have one or more CDR (e.g., HC CDR or LC CDR) sequences substantially similar to any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. For example, the antibodies may include one or more CDR sequence(s) from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1 containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-PRAME / HLA-A2 antibodies selected from Table 1) so long as immuno specific binding to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, any of the amino acid variations in any of the CDRs provided herein may be conservative variations. Conservative variations can be introduced into the CDRs at positions where the residues are not likely to be involved in interacting with a PRAME / HLA-A2 protein complex (e.g., a human PRAME / HLA-A2 protein complex), for example, as determined based on a crystal structure. Some aspects of the disclosure provide anti-PRAME / HLA-A2 antibodies that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the HC CDR sequences (e.g., HC CDR1, HC CDR2, and HC CDR3) provided herein, for example, any of the CDR-H sequences provided in any one of the anti-PRAME / HLA-A2 selected from Table 1. In some embodiments, any of the VL domains provided herein include one or more of the CDR-L sequences (e.g., LC CDR1, LC CDR2, and LC CDR3) provided herein, for example, any of the LC CDR sequences provided in any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1.[000136] In some embodiments, the anti-PRAME / HLA-A2 antibodies of the disclosure include any antibody that includes a heavy chain variable domain and / or a light chain variable domain of any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1, and variants thereof. In some embodiments, anti-PRAME / HLA-A2 antibodies of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of any anti-PRAME / HLA-A2 antibodies selected from Table 1.[000137] Aspects of the disclosure provide anti-PRAME / HLA-A2 antibodies having a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequencehomologous to any of those described herein. In some embodiments, the anti-PRAME / HLA- A2 antibody comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the heavy chain variable sequence and / or any light chain variable sequence of any one of the anti-PRAME / HLA-A2 antibodies selected from Table 1. In some embodiments, the homologous heavy chain variable and / or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a heavy chain variable and / or a light chain variable sequence excluding any of the CDR sequences provided herein. In some embodiments, any of the anti-PRAME / HLA-A2 antibodies provided herein comprise a heavy chain variable sequence and a light chain variable sequence that comprises a framework sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of any anti-PRAME / HLA-A2 antibodies selected from Table 1.[000138] In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Table 1). In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 that are the same as the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 shown in Table 1, and comprises a humanized heavy chain variable region and / or a humanized light chain variable region.[000139] In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure is a humanized antibody comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-PRAME / HLA-A2 antibodies listed in Table 1. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure is a humanized antibody comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti- PRAME / HLA-A2 antibodies listed in Table 1.Table 9 - Antibody #1 - #33 CDR SequencesTable 10 - Antibody #1 - #33 VH and VL Sequences[000140] In some embodiments, a VH region of the present disclosure comprises HC CDR1 (or a variant thereof in which 1, 2, or 3 amino acids in HC CDR1 are substituted with another amino acid), HC CDR2 (or a variant thereof in which 1, 2, or 3 amino acids in HC CDR2 are substituted with another amino acid) and HC CDR3 (or a variant thereof in which 1, 2, or 3 amino acids in HC CDR3 are substituted with another amino acid) as indicated in: (1) row 1, (2) row 2, (3) row 3, (4) row 4, (5) row 5, (6) row 6, (7) row 7, (8) row 8, (9) row 9, (10) row10, (11) row 11, (12) row 12, (13) row 13, (14) row 14, (15) row 15, (16) row 16, (17) row17, (18) row 18, (19) row 19, (20) row 20, (21) row 21, (22) row 22, (23) row 23, (24) row24, (25) row 25, (26) row 26, (27) row 27, (28) row 28, (29) row 29, (30) row 30, (31) row31, (32) row 32, and (33) row 33 of Column A of Table 9.[000141] In some embodiments, a VH region of the present disclosure comprises at least 80%, preferably one of ^80%, ^85%, ^90%, ^91%, ^92%, ^93%, ^94%, ^95%, 2? 96%, ^97%, %98%, %99%, or 100% amino acid sequence identity to the amino acid sequence of a VH region sequence as indicated in row 34, row 35, row 36, row 37, row 38, row 39, row 40, row 41, row 42, row 43, row 44, row 45, row 46, row 47, row 48, row 49, row 50, row 51, row 52, row 53, row 54, row 55, row 56, row 57, row 58, row 59, row 60, row 61, row 62, row 63, row 64, row 65, or row 66 of Column A of Table 10.[000142] In some embodiments, a VL region of the present disclosure comprises LC CDR1 (or a variant thereof in which 1, 2, or 3 amino acids in LC CDR1 are substituted with another amino acid), LC CDR2 (or a variant thereof in which 1, 2, or 3 amino acids in LC CDR2 are substituted with another amino acid) and LC CDR3 (or a variant thereof in which 1, 2, or 3 amino acids in LC CDR3 are substituted with another amino acid) as indicated in: row 1, row 2, row 3, row 4, row 5, row 6, row 7, row 8, row 9, row 10, row 11, row 12, row 13, row 14, row 15, row 16, row 17, row 18, row 19, row 20, row 21, row 22, row 23, row 24, row 25, row 26, row 27, row 28, row 29, row 30, row 31, row 32, and row 33 of Column B of Table 9.[000143] In some embodiments, a VH region of the present disclosure comprises at least 80%, preferably one of ^80%, ^85%, ^90%, ^91%, ^92%, ^93%, ^94%, ^95%, 2? 96%, ^97%, %98%, %99%, or 100% amino acid sequence identity to the amino acid sequence of a VH region sequence as indicated in row 34, row 35, row 36, row 37, row 38, row 39, row 40, row 41, row 42, row 43, row 44, row 45, row 46, row 47, row 48, row 49, row 50, row 51, row 52, row 53, row 54, row 55, row 56, row 57, row 58, row 59, row 60, row 61, row 62, row 63, row 64, row 65, or row 66 of Column B of Table 10.[000144] In some embodiments, an antigen-binding molecule according to the present disclosure comprises a VH region according to any one of (1), (2), (3), (4), (5), (6), (7), (8), (9), (10), (11), (12), (13), (14), (15), (16), (17), (18), (19), (20), (21), (22), (23), (24), (25), (26), (27), (28), (29), (30), (31), (32), or (33) as described hereinabove; and a VL region according to any one of (34), (35), (36), (37), (38), (39), (40), (41), (42), (43), (44), (45), (46),(47), (48), (49), (50), (51), (52), (53), (54), (55), (56), (57), (58), (59), (60), (61), (62), (63), (64), (65), or (66) as described hereinabove. In the following paragraph, it will be appreciated that, for example, reference to “(1) and (34)” is shorthand for “a VH region according to (1), and a VL region according (34)”.[000145] In some embodiments, an antigen-binding molecule according to the present disclosure comprises: (1) and (34), (1) and (35), (1) and (36), (1) and (37), (1) and (38), (1) and (39), (1) and (40), (1) and (41), (1) and (42), (1) and (43), (1) and (44), and (1) and (45), (1) and (46), (1) and (47), (1) and (48), (1) and (49), (1) and (50), (1) and (51), (1) and (52), (1) and (53), (1) and (54), (1) and (55), (1) and (56), (1) and (57), (1) and (58), (1) and (59), (1) and (60), (1) and (61), (1) and (62), (1) and (63), (1) and (64), (1) and (65), and (1) and (66), (2) and (34), (2) and (35), (2) and (36), (2) and (37), (2) and (38), (2) and (39), (2) and (40), (2) and (41), (2) and (42), (2) and (43), (2) and (44), and (2) and (45), (2) and (46), (2) and (47), (2) and (48), (2) and (49), (2) and (50), (2) and (51), (2) and (52), (2) and (53), (2) and (54), (2) and (55), (2) and (56), (2) and (57), (2) and (58), (2) and (59), (2) and (60), (2) and (61), (2) and (62), (2) and (63), (2) and (64), (2) and (65), and (2) and (66), (3) and (34), (3) and (35), (3) and (36), (3) and (37), (3) and (38), (3) and (39), (3) and (40), (3) and (41),(3) and (42), (3) and (43), (3) and (44), and (3) and (45), (3) and (46), (3) and (47), (3) and(48), (3) and (49), (3) and (50), (3) and (51), (3) and (52), (3) and (53), (3) and (54), (3) and (55), (3) and (56), (3) and (57), (3) and (58), (3) and (59), (3) and (60), (3) and (61), (3) and (62), (3) and (63), (3) and (64), (3) and (65), and (3) and (66), (4) and (34), (4) and (35), (4) and (36), (4) and (37), (4) and (38), (4) and (39), (4) and (40), (4) and (41), (4) and (42), (4) and (43), (4) and (44), and (4) and (45), (4) and (46), (4) and (47), (4) and (48), (4) and (49),(4) and (50), (4) and (51), (4) and (52), (4) and (53), (4) and (54), (4) and (55), (4) and (56),(4) and (57), (4) and (58), (4) and (59), (4) and (60), (4) and (61), (4) and (62), (4) and (63), (4) and (64), (4) and (65), and (4) and (66), (5) and (34), (5) and (35), (5) and (36), (5) and (37), (5) and (38), (5) and (39), (5) and (40), (5) and (41), (5) and (42), (5) and (43), (5) and(44), and (5) and (45), (5) and (46), (5) and (47), (5) and (48), (5) and (49), (5) and (50), (5) and (51), (5) and (52), (5) and (53), (5) and (54), (5) and (55), (5) and (56), (5) and (57), (5) and (58), (5) and (59), (5) and (60), (5) and (61), (5) and (62), (5) and (63), (5) and (64), (5)and (65), and (5) and (66), (6) and (34), (6) and (35), (6) and (36), (6) and (37), (6) and (38),(6) and (39), (6) and (40), (6) and (41), (6) and (42), (6) and (43), (6) and (44), and (6) and (45), (6) and (46), (6) and (47), (6) and (48), (6) and (49), (6) and (50), (6) and (51), (6) and(52), (6) and (53), (6) and (54), (6) and (55), (6) and (56), (6) and (57), (6) and (58), (6) and (59), (6) and (60), (6) and (61), (6) and (62), (6) and (63), (6) and (64), (6) and (65), and (6) and (66), (7) and (34), (7) and (35), (7) and (36), (7) and (37), (7) and (38), (7) and (39), (7) and (40), (7) and (41), (7) and (42), (7) and (43), (7) and (44), and (7) and (45), (7) and (46),(7) and (47), (7) and (48), (7) and (49), (7) and (50), (7) and (51), (7) and (52), (7) and (53), (7) and (54), (7) and (55), (7) and (56), (7) and (57), (7) and (58), (7) and (59), (7) and (60), (7) and (61), (7) and (62), (7) and (63), (7) and (64), (7) and (65), and (7) and (66), (8) and (34), (8) and (35), (8) and (36), (8) and (37), (8) and (38), (8) and (39), (8) and (40), (8) and (41), (8) and (42), (8) and (43), (8) and (44), and (8) and (45), (8) and (46), (8) and (47), (8) and (48), (8) and (49), (8) and (50), (8) and (51), (8) and (52), (8) and (53), (8) and (54), (8) and (55), (8) and (56), (8) and (57), (8) and (58), (8) and (59), (8) and (60), (8) and (61), (8) and (62), (8) and (63), (8) and (64), (8) and (65), and (8) and (66), (9) and (34), (9) and (35),(9) and (36), (9) and (37), (9) and (38), (9) and (39), (9) and (40), (9) and (41), (9) and (42),(9) and (43), (9) and (44), and (9) and (45), (9) and (46), (9) and (47), (9) and (48), (9) and (49), (9) and (50), (9) and (51), (9) and (52), (9) and (53), (9) and (54), (9) and (55), (9) and (56), (9) and (57), (9) and (58), (9) and (59), (9) and (60), (9) and (61), (9) and (62), (9) and (63), (9) and (64), (9) and (65), and (9) and (66), (10) and (34), (10) and (35), (10) and (36),(10) and (37), (10) and (38), (10) and (39), (10) and (40), (10) and (41), (10) and (42), (10) and (43), (10) and (44), and (10) and (45), (10) and (46), (10) and (47), (10) and (48), (10) and (49), (10) and (50), (10) and (51), (10) and (52), (10) and (53), (10) and (54), (10) and (55), (10) and (56), (10) and (57), (10) and (58), (10) and (59), (10) and (60), (10) and (61),(10) and (62), (10) and (63), (10) and (64), (10) and (65), and (10) and (66), (11) and (34),(11) and (35), (11) and (36), (11) and (37), (11) and (38), (11) and (39), (11) and (40), (11) and (41), (11) and (42), (11) and (43), (11) and (44), and (11) and (45), (11) and (46), (11) and (47), (11) and (48), (11) and (49), (11) and (50), (11) and (51), (11) and (52), (11) and(53), (11) and (54), (11) and (55), (11) and (56), (11) and (57), (11) and (58), (11) and (59),(11) and (60), (11) and (61), (11) and (62), (11) and (63), (11) and (64), (11) and (65), and (11) and (66), (12) and (34), (12) and (35), (12) and (36), (12) and (37), (12) and (38), (12) and (39), (12) and (40), (12) and (41), (12) and (42), (12) and (43), (12) and (44), and (12) and (45), (12) and (46), (12) and (47), (12) and (48), (12) and (49), (12) and (50), (12) and (51), (12) and (52), (12) and (53), (12) and (54), (12) and (55), (12) and (56), (12) and (57),(12) and (58), (12) and (59), (12) and (60), (12) and (61), (12) and (62), (12) and (63), (12) and (64), (12) and (65), and (12) and (66), (13) and (34), (13) and (35), (13) and (36), (13) and (37), (13) and (38), (13) and (39), (13) and (40), (13) and (41), (13) and (42), (13) and (43), (13) and (44), and (13) and (45), (13) and (46), (13) and (47), (13) and (48), (13) and (49), (13) and (50), (13) and (51), (13) and (52), (13) and (53), (13) and (54), (13) and (55),(13) and (56), (13) and (57), (13) and (58), (13) and (59), (13) and (60), (13) and (61), (13) and (62), (13) and (63), (13) and (64), (13) and (65), and (13) and (66), (14) and (34), (14) and (35), (14) and (36), (14) and (37), (14) and (38), (14) and (39), (14) and (40), (14) and (41), (14) and (42), (14) and (43), (14) and (44), and (14) and (45), (14) and (46), (14) and (47), (14) and (48), (14) and (49), (14) and (50), (14) and (51), (14) and (52), (14) and (53),(14) and (54), (14) and (55), (14) and (56), (14) and (57), (14) and (58), (14) and (59), (14) and (60), (14) and (61), (14) and (62), (14) and (63), (14) and (64), (14) and (65), and (14) and (66), (15) and (34), (15) and (35), (15) and (36), (15) and (37), (15) and (38), (15) and (39), (15) and (40), (15) and (41), (15) and (42), (15) and (43), (15) and (44), and (15) and (45), (15) and (46), (15) and (47), (15) and (48), (15) and (49), (15) and (50), (15) and (51),(15) and (52), (15) and (53), (15) and (54), (15) and (55), (15) and (56), (15) and (57), (15) and (58), (15) and (59), (15) and (60), (15) and (61), (15) and (62), (15) and (63), (15) and (64), (15) and (65), and (15) and (66), (16) and (34), (16) and (35), (16) and (36), (16) and (37), (16) and (38), (16) and (39), (16) and (40), (16) and (41), (16) and (42), (16) and (43),(16) and (44), and (16) and (45), (16) and (46), (16) and (47), (16) and (48), (16) and (49),(16) and (50), (16) and (51), (16) and (52), (16) and (53), (16) and (54), (16) and (55), (16) and (56), (16) and (57), (16) and (58), (16) and (59), (16) and (60), (16) and (61), (16) and (62), (16) and (63), (16) and (64), (16) and (65), and (16) and (66), (17) and (34), (17) and (35), (17) and (36), (17) and (37), (17) and (38), (17) and (39), (17) and (40), (17) and (41),(17) and (42), (17) and (43), (17) and (44), and (17) and (45), (17) and (46), (17) and (47),(17) and (48), (17) and (49), (17) and (50), (17) and (51), (17) and (52), (17) and (53), (17) and (54), (17) and (55), (17) and (56), (17) and (57), (17) and (58), (17) and (59), (17) and (60), (17) and (61), (17) and (62), (17) and (63), (17) and (64), (17) and (65), and (17) and (66), (18) and (34), (18) and (35), (18) and (36), (18) and (37), (18) and (38), (18) and (39),(18) and (40), (18) and (41), (18) and (42), (18) and (43), (18) and (44), and (18) and (45),(18) and (46), (18) and (47), (18) and (48), (18) and (49), (18) and (50), (18) and (51), (18) and (52), (18) and (53), (18) and (54), (18) and (55), (18) and (56), (18) and (57), (18) and (58), (18) and (59), (18) and (60), (18) and (61), (18) and (62), (18) and (63), (18) and (64), (18) and (65), and (18) and (66), (19) and (34), (19) and (35), (19) and (36), (19) and (37),(19) and (38), (19) and (39), (19) and (40), (19) and (41), (19) and (42), (19) and (43), (19) and (44), and (19) and (45), (19) and (46), (19) and (47), (19) and (48), (19) and (49), (19) and (50), (19) and (51), (19) and (52), (19) and (53), (19) and (54), (19) and (55), (19) and (56), (19) and (57), (19) and (58), (19) and (59), (19) and (60), (19) and (61), (19) and (62),(19) and (63), (19) and (64), (19) and (65), and (19) and (66), (20) and (34), (20) and (35),(20) and (36), (20) and (37), (20) and (38), (20) and (39), (20) and (40), (20) and (41), (20) and (42), (20) and (43), (20) and (44), and (20) and (45), (20) and (46), (20) and (47), (20) and (48), (20) and (49), (20) and (50), (20) and (51), (20) and (52), (20) and (53), (20) and (54), (20) and (55), (20) and (56), (20) and (57), (20) and (58), (20) and (59), (20) and (60),(20) and (61), (20) and (62), (20) and (63), (20) and (64), (20) and (65), and (20) and (66),(21) and (34), (21) and (35), (21) and (36), (21) and (37), (21) and (38), (21) and (39), (21) and (40), (21) and (41), (21) and (42), (21) and (43), (21) and (44), and (21) and (45), (21) and (46), (21) and (47), (21) and (48), (21) and (49), (21) and (50), (21) and (51), (21) and (52), (21) and (53), (21) and (54), (21) and (55), (21) and (56), (21) and (57), (21) and (58),(21) and (59), (21) and (60), (21) and (61), (21) and (62), (21) and (63), (21) and (64), (21) and (65), and (21) and (66), (22) and (34), (22) and (35), (22) and (36), (22) and (37), (22) and (38), (22) and (39), (22) and (40), (22) and (41), (22) and (42), (22) and (43), (22) and(44), and (22) and (45), (22) and (46), (22) and (47), (22) and (48), (22) and (49), (22) and(50), (22) and (51), (22) and (52), (22) and (53), (22) and (54), (22) and (55), (22) and (56),(22) and (57), (22) and (58), (22) and (59), (22) and (60), (22) and (61), (22) and (62), (22) and (63), (22) and (64), (22) and (65), and (22) and (66), (23) and (34), (23) and (35), (23) and (36), (23) and (37), (23) and (38), (23) and (39), (23) and (40), (23) and (41), (23) and (42), (23) and (43), (23) and (44), and (23) and (45), (23) and (46), (23) and (47), (23) and (48), (23) and (49), (23) and (50), (23) and (51), (23) and (52), (23) and (53), (23) and (54),(23) and (55), (23) and (56), (23) and (57), (23) and (58), (23) and (59), (23) and (60), (23) and (61), (23) and (62), (23) and (63), (23) and (64), (23) and (65), and (23) and (66), (24) and (34), (24) and (35), (24) and (36), (24) and (37), (24) and (38), (24) and (39), (24) and (40), (24) and (41), (24) and (42), (24) and (43), (24) and (44), and (24) and (45), (24) and (46), (24) and (47), (24) and (48), (24) and (49), (24) and (50), (24) and (51), (24) and (52),(24) and (53), (24) and (54), (24) and (55), (24) and (56), (24) and (57), (24) and (58), (24) and (59), (24) and (60), (24) and (61), (24) and (62), (24) and (63), (24) and (64), (24) and (65), and (24) and (66), (25) and (34), (25) and (35), (25) and (36), (25) and (37), (25) and (38), (25) and (39), (25) and (40), (25) and (41), (25) and (42), (25) and (43), (25) and (44),(25) and (45), (25) and (46), (25) and (47), (25) and (48), (25) and (49), (25) and (50), (25)and (51), (25) and (52), (25) and (53), (25) and (54), (25) and (55), (25) and (56), (25) and (57), (25) and (58), (25) and (59), (25) and (60), (25) and (61), (25) and (62), (25) and (63),(25) and (64), (25) and (65), and (25) and (66), (26) and (34), (26) and (35), (26) and (36),(26) and (37), (26) and (38), (26) and (39), (26) and (40), (26) and (41), (26) and (42), (26) and (43), (26) and (44), (26) and (45), (26) and (46), (26) and (47), (26) and (48), (26) and (49), (26) and (50), (26) and (51), (26) and (52), (26) and (53), (26) and (54), (26) and (55),(26) and (56), (26) and (57), (26) and (58), (26) and (59), (26) and (60), (26) and (61), (26) and (62), (26) and (63), (26) and (64), (26) and (65), and (26) and (66), (27) and (34), (27) and (35), (27) and (36), (27) and (37), (27) and (38), (27) and (39), (27) and (40), (27) and (41), (27) and (42), (27) and (43), (27) and (44), (27) and (45), (27) and (27), (27) and (47),(27) and (48), (27) and (49), (27) and (50), (27) and (51), (27) and (52), (27) and (53), (27) and (54), (27) and (55), (27) and (56), (27) and (57), (27) and (58), (27) and (59), (27) and (60), (27) and (61), (27) and (62), (27) and (63), (27) and (64), (27) and (65), and (27) and (66), (28) and (34), (28) and (35), (28) and (36), (28) and (37), (28) and (38), (28) and (39),(28) and (40), (28) and (41), (28) and (42), (28) and (43), (28) and (44), (28) and (45), (28) and (46), (28) and (47), (28) and (48), (28) and (49), (28) and (50), (28) and (51), (28) and (52), (28) and (53), (28) and (54), (28) and (55), (28) and (56), (28) and (57), (28) and (58),(28) and (59), (28) and (60), (28) and (61), (28) and (62), (28) and (63), (28) and (64), (28) and (65), and (28) and (66), (29) and (34), (29) and (35), (29) and (36), (29) and (37), (29) and (38), (29) and (39), (29) and (40), (29) and (41), (29) and (42), (29) and (43), (29) and (44), (29) and (45), (29) and (46), (29) and (47), (29) and (48), (29) and (49), (29) and (50),(29) and (51), (29) and (52), (29) and (53), (29) and (54), (29) and (55), (29) and (56), (29) and (57), (29) and (58), (29) and (59), (29) and (60), (29) and (61), (29) and (62), (29) and (63), (29) and (64), (29) and (65), and (29) and (66), (30) and (34), (30) and (35), (30) and (36), (30) and (37), (30) and (38), (30) and (39), (30) and (40), (30) and (41), (30) and (42),(30) and (43), (30) and (44), (30) and (45), (30) and (46), (30) and (47), (30) and (48), (30) and (49), (30) and (50), (30) and (51), (30) and (52), (30) and (53), (30) and (54), (30) and (55), (30) and (56), (30) and (57), (30) and (58), (30) and (59), (30) and (60), (30) and (61),(30) and (62), (30) and (63), (30) and (64), (30) and (65), and (30) and (66), (31) and (34),(31) and (35), (31) and (36), (31) and (37), (31) and (38), (31) and (39), (31) and (40), (31) and (41), (31) and (42), (31) and (43), (31) and (44), (31) and (45), (31) and (46), (31) and (47), (31) and (48), (31) and (49), (31) and (50), (31) and (51), (31) and (52), (31) and (53), (31) and (54), (31) and (55), (31) and (56), (31) and (57), (31) and (58), (31) and (59), (31) and (60), (31) and (61), (31) and (62), (31) and (63), (31) and (64), (31) and (65), and (31)and (66), (32) and (34), (32) and (35), (32) and (36), (32) and (37), (32) and (38), (32) and (39), (32) and (40), (32) and (41), (32) and (42), (32) and (43), (32) and (44), (32) and (45), (32) and (46), (32) and (47), (32) and (48), (32) and (49), (32) and (50), (32) and (51), (32) and (52), (32) and (53), (32) and (54), (32) and (55), (32) and (56), (32) and (57), (32) and (58), (32) and (59), (32) and (60), (32) and (61), (32) and (62), (32) and (63), (32) and (64),(32) and (65), and (32) and (66), (33) and (34), (33) and (35), (33) and (36), (33) and (37),(33) and (38), (33) and (39), (33) and (40), (33) and (41), (33) and (42), (33) and (43), (33) and (44), (33) and (45), (33) and (46), (33) and (47), (33) and (48), (33) and (49), (33) and (50), (33) and (51), (33) and (52), (33) and (53), (33) and (54), (33) and (55), (33) and (56), (33) and (57), (33) and (58), (33) and (59), (33) and (60), (33) and (61), (33) and (62), (33) and (63), (33) and (64), (33) and (65), and (33) and (66).[000146] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000147] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 having the amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, columns A and B of Table 9.[000148] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9, column B of Table 9.[000149] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody#29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9, column A of Table 9.[000150] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation), a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation), and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation), and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000151] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises: a HC CDR1 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, atleast 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 a HC CDR2 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR2 and / or a HC CDR3 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR3 amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises: a LC CDR1 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR1; a LC CDR2 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR2; and / or a LC CDR3 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR3 amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody#30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000152] In some embodiments, an anti-PRAME / HLA-A2 antibody of the present disclosure comprises a VH comprising the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, the anti- PRAME / HLA-A2 antibody of the present disclosure comprises a VL comprising the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000153] In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10 and / or a VL amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62,antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10 excluding any of the CDR sequences therein. In some embodiments, an anti-PRAME / HLA-A2 antibodies provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000154] In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 inrow 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10 excluding any of the CDR sequences therein. In some embodiments, an anti-PRAME / HLA-A2 antibody provided herein comprise a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10.[000155] In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure is a chimeric antibody, which can include a heavy constant region and a lightconstant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.[000156] In some embodiments, the anti-PRAME / HLA-A2 antibody described herein is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals e.g., a non- human mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.[000157] In some embodiments, the anti-PRAME / HLA-A2 antibody of the present disclosure comprises a VL domain and / or VH domain of any one of the anti-PRAME / HLA- A2 antibodies selected from Table 1, and comprises a constant region comprising the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule. Non-limiting examples of human constant regions are described in the art, e.g., see Kabat E A et al., (1991) supra.[000158] In some embodiments, the light chain of any of the anti-PRAME / HLA-A2 antibodies described herein may further comprise a light chain constant region (CL), which can be any CL known in the art. In some examples, the CL is a kappa light chain. In other examples, the CL is a lambda light chain.[000159] Other antibody heavy and light chain constant regions may be used in some embodiments, e.g., those provided in the IMGT database (www.imgt.org) or at www.vbase2.org / vbstat.php., both of which are incorporated by reference herein.[000160] The anti-PRAME / HLA-A2 antibodies described herein can be in any antibody form, including, but not limited to, intact (i.e., full-length) antibodies, antigen-bindingfragments thereof (such as Fab, F(ab'), F(ab')2, Fv), single chain antibodies, bi-specific antibodies, or nanobodies. In some embodiments, the anti-PRAME / HLA-A2 antibody described herein is a scFv. In some embodiments, the anti-PRAME / HLA-A2 antibody described herein is a scFv-Fab (e.g., scFv fused to a portion of a constant region). Provided herein, in some embodiments, is a bispecific antibody. In some embodiments, the first antigen binding site of the bispecific antibody specifically binds PRAME / HLA-A2. In some embodiments, the second antigen binding site specifically binds a T cell antigen. In some antibodies, the T cell antigen is a CD3 complex or a portion thereof.[000161] In some embodiments, conservative mutations can be introduced into antibody sequences (e.g., CDRs or framework sequences) at positions where the residues are not likely to be involved in interacting with a target antigen (e.g., PRAME / HLA-A2), for example, as determined based on a crystal structure. In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the Fc region of an anti-PRAME / HLA-A2 antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgGl) and / or CH3 domain (residues 341-447 of human IgGl) and / or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat) to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding and / or antigen-dependent cellular cytotoxicity.[000162] In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the hinge region of the Fc region (CHI domain) such that the number of cysteine residues in the hinge region are altered (e.g., increased or decreased) as described in, e.g., U.S. Pat. No. 5,677,425. The number of cysteine residues in the hinge region of the CHI domain can be altered to, e.g., facilitate assembly of the light and heavy chains, or to alter (e.g., increase or decrease) the stability of an antibody or to facilitate linker conjugation.[000163] In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the Fc region of an antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgGl) and / or CH3 domain (residues 341-447 of human IgGl) and / or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat) to increase or decrease the affinity of an antibody for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell. Mutations in the Fc region of an antibody that decrease or increase the affinity of an antibody for an Fc receptor and techniques for introducing such mutations into the Fc receptor or fragment thereof are known to one of skill in the art. Examples of mutations in the Fc receptor of an antibody that can be made to alter the affinity of the antibody for an Fc receptor are described in, e.g., Smith P etal., (2012) PNAS 109: 6181-6186, U.S. Pat. No. 6,737,056, and International Publication Nos. WO 02 / 060919; WO 98 / 23289; and WO 97 / 34631, which are incorporated herein by reference.[000164] In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to alter (e.g., decrease or increase) half-life of an antibody in vivo. See, e.g., International Publication Nos. WO 02 / 060919; WO 98 / 23289; and WO 97 / 34631; and U.S. Pat. Nos. 5,869,046, 6,121,022, 6,277,375 and 6,165,745 for examples of mutations that will alter (e.g., decrease or increase) the half-life of an antibody in vivo.[000165] In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to decrease the half-life of the anti-PRAME / HLA-A2 antibody in vivo. In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions, or deletions) are introduced into an IgG constant domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to increase the half-life of an antibody in vivo. In some embodiments, the antibodies can have one or more amino acid mutations (e.g., substitutions) in the second constant (CH2) domain (residues 231-340 of human IgGl) and / or the third constant (CH3) domain (residues 341-447 of human IgGl), with numbering according to the EU index in Kabat (Kabat E A et al., (1991) supra). In some embodiments, the constant region of the IgGl of an antibody described herein comprises a methionine (M) to tyrosine (Y) substitution in position 252, a serine (S) to threonine (T) substitution in position 254, and a threonine (T) to glutamic acid (E) substitution in position 256, numbered according to the EU index as in Kabat. See U.S. Pat. No. 7,658,921, which is incorporated herein by reference. This type of mutant IgG, referred to as "YTE mutant" has been shown to display fourfold increased half-life as compared to wild-type versions of the same antibody (see Dall'Acqua W F et al., (2006) J Biol Chem 281: 23514-24). In some embodiments, an antibody comprises an IgG constant domain comprising one, two, three or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, numbered according to the EU index as in Kabat.[000166] In some embodiments, one, two or more amino acid substitutions are introduced into an IgG constant domain Fc region to alter the effector function(s) of the anti- PRAME / HLA-A2 antibody. The effector ligand to which affinity is altered can be, forexample, an Fc receptor or the Cl component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260 (e.g., L234A and L235A mutations). In some embodiments, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating antibody thereby increasing tumor localization. See, e.g., U.S. Pat. Nos. 5,585,097 and 8,591,886 for a description of mutations that delete or inactivate the constant domain and thereby increase tumor localization. In some embodiments, one or more amino acid substitutions may be introduced into the Fc region of an antibody described herein to remove potential glycosylation sites on Fc region, which may reduce Fc receptor binding (see, e.g., Shields R L et al., (2001) J Biol Chem 276: 6591-604).[000167] In some embodiments, one or more amino in the constant region of an anti- PRAME / HLA-A2 antibody described herein can be replaced with a different amino acid residue such that the antibody has altered Clq binding and / or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551 (Idusogie et al). In some embodiments, one or more amino acid residues in the N-terminal region of the CH2 domain of an antibody described herein are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in International Publication No. WO 94 / 29351. In some embodiments, the Fc region of an antibody described herein is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and / or to increase the affinity of the antibody for an Fey receptor. This approach is described further in International Publication No. WO 00 / 42072.[000168] In some embodiments, the heavy and / or light chain variable domain(s) sequence(s) of the antibodies provided herein can be used to generate, for example, CDR-grafted, chimeric, humanized, or composite human antibodies or antigen-binding fragments, as described elsewhere herein. As understood by one of ordinary skill in the art, any variant, CDR-grafted, chimeric, humanized, or composite antibodies derived from any of the antibodies provided herein may be useful in the compositions and methods described herein and will maintain the ability to specifically bind PRAME / HLA-A2, such that the variant, CDR-grafted, chimeric, humanized, or composite antibody has at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more binding to PRAME / HLA-A2 relative to the original antibody from which it is derived.[000169] In some embodiments, the antibodies provided herein comprise mutations that confer desirable properties to the antibodies. For example, to avoid potential complicationsdue to Fab-arm exchange, which is known to occur with native IgG4 mAbs, the antibodies provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse / human (IgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgGl-like hinge sequence. Accordingly, any of the antibodies may include a stabilizing ‘Adair’ mutation.[000170] In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecules are conjugated to an antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecules are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, an N-acetylgalactosamine unit, a galactose unit, a fucose unit, or a phospholipid unit. In some embodiments, there are about 1-10, about 1-5, about 5-10, about 1-4, about 1-3, or about 2 sugar molecules. In some embodiments, a glycosylated antibody is fully or partially glycosylated. In some embodiments, an antibody is glycosylated by chemical reactions or by enzymatic means. In some embodiments, an antibody is glycosylated in vitro or inside a cell, which may optionally be deficient in an enzyme in the N- or O- glycosylation pathway, e.g., a glycosyltransferase. In some embodiments, an antibody is functionalized with sugar or carbohydrate molecules as described in International Patent Application Publication WO2014065661, published on May 1, 2014, entitled, “Modified antibody, antibodyconjugate and process for the preparation thereof ’ .[000171] In some embodiments, any one of the anti-PRAME / HLA-A2 antibodies described herein may comprise a signal peptide in the heavy and / or light chain sequence (e.g., a N- terminal signal peptide). In some embodiments, the anti-PRAME / HLA-A2 antibody described herein comprises any one of the VH and VL sequences, any one of the IgG heavy chain and light chain sequences, or any one of the F(ab') heavy chain and light chain sequences described herein, and further comprises a signal peptide (e.g., a N-terminal signal peptide).[000172] In some embodiments, any one of the antibodies described herein is a multispecific antibody that specifically binds PRAME / HLA-A2 and one or more additional target antigens. In some embodiments, an antibody is a bispecific antibody that specifically binds to PRAME / HLA-A2 and one additional target antigen. In some embodiments, the multispecific antibody or bispecific antibody can be obtained by known technology in the art. In some embodiments, the one or more additional targets include but are not limited to CD3, CD4, CD8, CD20, CD19, CD21, CD23, CD46, CD80, HLA-DR, CD74, CD22, CD14, CD15, CD16, CD123, TCR gamma / delta, NKp46, or KIR.[000173] In some embodiments, the antibodies described herein are conjugated directly or indirectly to one or more molecular pay loads or labels. For example, in some embodiments, antibodies described herein are conjugated to molecular payload, e.g., a molecular payload providing a therapeutic benefit for a subject, e.g., an antibody-drug conjugate (ADC). In some embodiments, a molecular payload may be a small molecule, protein, nucleic acid, oligonucleotide, or any molecular entity capable of modulating the activity or function of a gene, protein, and / or nucleic acid, e.g., in a cell. In some embodiments, the molecular pay load is a cytotoxic agent or a chemotherapeutic agent. In some embodiments, antibodies described herein are conjugated directly or indirectly to a detectable label, e.g., for diagnostic purposes.[000174] In some embodiments, the present disclosure also provides fusion proteins comprising an anti-PRAME / HLA-A2 antibody described herein fused directly or indirectly (e.g., via a linker) to one or more polypeptide or protein.(b) Chimeric Antigen Receptors[000175] In some aspects, the present disclosure also contemplates engineering any of the anti-PRAME / HLA-A2 antibodies or antigen binding fragment thereof disclosed herein into the format of an extracellular ligand-binding domain of a CAR expressed by genetically modified immune cells (e.g., T cells, NK cells, or NKT cells) described herein. Aspects of the present disclosure also provide chimeric antigen receptors (CARs) comprising an extracellular ligand-binding domain. In some embodiments, the ligand-binding domain binds to a cell surface marker on a target cell (e.g., a tumor cell or cancer cell). In some embodiments, the ligand-binding domain binds to a cell surface marker on a target cell in a particular disease state (e.g., PRAME / HLA-A2 on a PRAME-expressing tumor cell or cancer cell). Generally, a CAR e.g., anti-PRAME / HLA-A2 CAR) of the present disclosure comprises at least an extracellular domain and an intracellular domain. In some embodiments,the extracellular domain of an anti-PRAME / HLA-A2 CAR comprises a target- specific binding element (e.g., an antibody that specifically binds to PRAME / HLA-A2 (e.g., human PRAME / HLA-A2)) otherwise referred to herein as a ligand-binding domain (also referred to herein as an antigen-binding domain). In some embodiments, the extracellular ligand-binding domain of an anti-PRAME / HLA-A2 CAR is an antigen-binding domain or a portion thereof. In some embodiments, the extracellular ligand-binding domain of an anti-PRAME / HLA-A2 CAR is a Fab. In some embodiments, the extracellular ligand-binding domain of an anti- PRAME / HLA-A2 CAR is a scFv. In some embodiments, an extracellular ligand-binding domain of a CAR described herein comprises an anti-PRAME / HLA-A2 antibody as described in Table 1.[000176] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000177] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, a LC CDR3 having the amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, columns A and B of Table 9.[000178] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000179] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000180] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000181] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises: a HC CDR1 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1; a HC CDR2 that is at least 80%(e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR2; and / or a HC CDR3 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR3 amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises: a LC CDR1 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR1; a LC CDR2 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR2; and / or a LC CDR3 that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR3 amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000182] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a VH comprising the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti- PRAME / HLA-A2 CAR of the present disclosure comprises a VL comprising the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000183] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 inrow 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10 and / or a VL of amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10, excluding any of the CDR sequences therein. In some embodiments,an anti-PRAME / HLA-A2 CAR provided herein comprise a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000184] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2 CAR of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody#21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10 excluding any of the CDR sequences therein. In some embodiments, an anti-PRAME / HLA-A2 CAR provided herein comprise a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000185] In some embodiments, a chimeric antigen receptor (CAR) of the present disclosure comprises a HC CDR1 having the amino acid sequence of X1X2X3X4X5WX6, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acidsequence of X11X12X13X14IRGX15X16X17X18X19, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000186] In some embodiments, a CAR comprises a HC CDR1 having the amino acid sequence of X1X2X3X4X5WX6, wherein Xi is S or N; X2 is Y, N, or G; X3 is F, N or S; X4 is H or absent; X5 is W, Y or absent; and Xf> is N or S. In some embodiments, when Xi of HC CDR1 is N, X2 is N and X5 is W. In some embodiments, when X4 of CDR1 is H, Xi is S and X5 is Y. In some embodiments, when Xi of HC CDR1 is S, X2 is Y or G, and X3 is F or S. In some embodiments, when X3 of HC CDR1 is F, Xi is S and X5 is absent.[000187] In some embodiments, a CAR comprises a HC CDR2 having the amino acid sequence of X7IYX8X9GX10TNYNPSLKS (SEQ ID NO: 2), wherein X7is E, Y or F; X8is H, D, or Y; X9 is S or T; and X10 is S, N or T. In some embodiments, when X7 of HC CDR2 is Y, Xs is Y or D, and X10 is T or N. In some embodiments, when Xs of HC CDR2 is Y, X7 is Y or F, and X9 is S or T.[000188] In some embodiments, a CAR comprises a HC CDR3 having the amino acid sequence of X11X12X13X14IRGX15X16X17X18X19, wherein Xu is D or E; X12 is G, W, or absent; X13 is T, D, or E; X14 is M or L; X15 is V, A or H; Xi6 is G or absent; X17 is L or F; Xis is G or D; and X19 is Y, P, I, or D. In some embodiments, when Xu of HC CDR3 is E, X12 is G or W, X15 is A or H, and X19 is P, I, or D. In some embodiments, when X12 of HC CDR3 is W, X13 is D or E, X15 is A or H, and X19 is I or D. In some embodiments, when X14 of HC CDR3 is M, Xu is D or E, X12 is G or absent, X15 is V or A, and X19 is Y or P. In some embodiments, when X14 is L, X13 is D or E, X15 is A or H, X19 is I or D.[000189] In some embodiments, a CAR comprises a LC CDR1 having the amino acid sequence of RASX20X21ISX22WLA (SEQ ID NO: 4), wherein X20 is Q or P, X21 is G or D, and X22 is S, R, or N.[000190] In some embodiments, a CAR comprises a LC CDR2 having the amino acid sequence of X23ASSLQX24 (SEQ ID NO: 5), wherein X23 is A, T or V, and X24 is S or G. In some embodiments, when X23 of LC CDR2 is A, X24 is S or G.[000191] In some embodiments, a CAR comprises a LC CDR3 having the amino acid sequence of QQX25NX26FPX27T (SEQ ID NO: 6), wherein X25 is T or A; X26 is N or S; and X27 is W or L. In some embodiments, when X25 of LC CDR3 is A, X26 is S, and X27 is W or L.[000192] In some embodiments, when Xi of HC CDR1 is S, X2 is Y or G; X3 is F or S; X5 is T or absent; Xf> is S or N; X? is E, Y or F; Xs is H, D, or Y; X9 is S or T; X10 is S, N, or T; Xuis D or E; X12 is W or absent; X13 is T, D, or E; X14 is M or L; X15 is V, A or H; Xi6 is absent; X17 is L or F; Xis is G or D; and X19 is Y, I, or D. In some embodiments, X23 is A or V; X24 is S or G; X25 is T or A; and X27 is L.[000193] In some embodiments, when Xu of HC CDR3 is E, Xi is N or S; X2 is N, Y, or G; X3 is Y, F, or S; X4 is H or absent; X5 is W, Y, or absent; Xi> is S; X7 is Y or F; Xs is Y or D; X9 is S or T; X10 is T or N; X12 is G or W; X13 is T, D, or E; X14 is M or L; X15 is A or H; Xi6 is G or absent; X17 is F; Xis is D; and X19 is P, I, or D. In some embodiments, X23 is T, A, or V; X24 is S or G; X25 is A; X26 is S; and X27 is L or W.[000194] In some embodiments, a CAR comprises a variable heavy domain (VH) with a framework region 1 (FR1) having the amino acid sequence of SEQ ID NO: 7, a framework region 2 (FR2) having the amino acid sequence of SEQ ID NO: 8, a framework region 3 (FR3) having the amino acid sequence of SEQ ID NO: 9, and a framework region 4 (FR4) having the amino acid sequence of SEQ ID NO: 10.[000195] In some embodiments, a CAR comprises a VH domain with a FR1 having the amino acid sequence of QVQLQESGPGLVKPSX28TLSLTCX29VSGX30SX31X32 (SEQ ID NO: 7), wherein X28 is G or E; X29 is T or A; X30 is G or D; X31 is I or V; and X32 is N or S. [000196] In some embodiments, a CAR comprises a VH domain with a FR2 having the amino acid sequence of WX33RQPPGKGLEWIG (SEQ ID NO: 8), wherein X33 is I or V. [000197] In some embodiments, a CAR comprises a VH domain with a FR3 having the amino acid sequence of RVTISX37DX35SKNX36FSLX37LX38SVTAADTAVYYCAR (SEQ ID NO: 9), wherein X37 is V or L, X35 is T, K, or P, X36 is Q or H, X37 is K or N, and X38 is S or R.[000198] In some embodiments, a CAR comprises a VH domain with a FR4 having the amino acid sequence of WGQGTX39VTVSS (SEQ ID NO: 10), wherein X39 is L or M. [000199] In some embodiments, the disclosure provides a chimeric antigen receptor (CAR) comprising a heavy chain complementarity determining region 1 (HC CDR1) comprising the amino acid sequence X40X41X40WX43, wherein X40 is S or T, X41 is Y or F, X40 is F or Y, and X43 is N or S; a heavy chain complementarity determining region 2 (HC CDR2) comprising the amino acid sequence YIYYSGX44TX45YNPSLKS (SEQ ID NO: 12), wherein X44 is S or T, and X45 is N or Y; and a heavy chain complementarity determining region 3 (HC CDR3) comprising the amino acid sequence X46X47X48LIRGX49X50X51Y (SEQ ID NO: 13), wherein X46 is D or E, X47 is T or W, X48 is M or E, X49 is V or H, X50 is I or F, and X51 is G or D. In some embodiments, the CAR further comprises a light chain complementarity determining region 1 (LC CDR1) comprising the amino acid sequence RASQGISSWLA (SEQ ID NO:24); a light chain complementarity determining region 2 (LC CDR2) comprising the amino acid sequence X52ASSLQS (SEQ ID NO: 14), wherein X52 is A or V; and a light chain complementarity determining region 3 (LC CDR3) comprising the amino acid sequence QQX53NX54FPLT (SEQ ID NO: 15), wherein X53 is T or A, and X54 is N or S.[000200] In some embodiments, when X44 is S, X40 is S, X41 is Y, X40 is F or Y, X43 is S, X45 is N or Y, X46 is D or E, X47 is W, X48 M or E, X49 is L, X50 is H, X51 is L, I, or F, X52 G or D, X53 is V, X54 is T or A, and X55 is N or S. In some embodiments, when X51 is F, X40 is S, X41 is Y, X40 is F or Y, X43 is S, X44 is T or S, X45 is Y or N, X46 is E, X47 is W, X48 is E, X50 is H, X52 is D, X53 is V, X54 is A, and X55 is S. In some embodiments, when X40 is T, X41 is F, X40 is F, X43 is N, X44 is T, X45 is N, X46 is D, X47 is T, X48 is M, X49 is absent, X50 is V, X51 is I, X52 is G, X53 is A, X54 is T, and X55 is N. In some embodiments, when X40 is S, X41 is Y, X40 is F, X43 is N, X44 is T, X45 is N, X46 is D, X47 is T, X48 is M, X49 is absent, X50 is V, X51 is L, X52 is G, X53 is A, X54 is T, and X55 is N.[000201] In some embodiments, an anti-PRAME / HLA-A2 CAR comprises an extracellular ligand-binding domain that comprises a single-chain variable fragment (scFv). In some embodiments, the VH and the VL of an anti-PRAME / HLA-A2 CAR (e.g., an anti- PRAME / HLA-A2 scFv) are joined together by a linker. In some embodiments, a linker may have a length of about 2 to 10 amino acids, 5 to 20 amino acids, 10 to 30 amino acids, 20-50 amino acids, 40 to 60 amino acids, 60 to 80 amino acids, or more than 80 amino acids. In some embodiments, a linker may include, without limitation, any of those encompassed by U.S. Patent Nos. 8,445,251 and 9,434,931.[000202] In some embodiments, an anti-PRAME / HLA-A2 CAR comprises an extracellular ligand-binding domain that comprises a scFv comprising a VH and a VL, and the C-terminus of the VH is joined with the N terminus of the VL via a linker. In some embodiments, an anti-PRAME / HLA-A2 CAR comprises an extracellular ligand-binding domain that comprises scFv comprising a VH and a VL, and the C-terminus of the VL is joined with the N terminus of the VH via a linker. In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure further comprises a hinge region. Any suitable known hinge region can be used in the anti-PRAME / HLA-A2 CAR described herein, e.g., hinge regions derived from CD4, CD8, CD28, CD3, IgGl, IgG4, IgD, IgA, or IgM, a hybrid or variant therefore (see, e.g., Jayaraman et al., CAR-T design: Elements and their synergistic function, eBioMedicine, VOLUME 58, 102931, AUGUST 2020); Guedan et al., Engineering and Design of Chimeric Antigen Receptors, Mol Ther Methods Clin Dev. 2019 Mar 15; 12: 145-156).[000203] In some embodiments, an anti-PRAME / HLA-A2 CAR of the present disclosure further comprises a transmembrane domain, which links the extracellular ligand-binding domain with the intracellular signaling and co-stimulatory domains. With respect to the transmembrane domain, the CAR can be designed to comprise a transmembrane domain that is fused to the extracellular domain (e.g., the antigen binding domain) of the CAR directly or via the hinge region. Any transmembrane domain is contemplated for use herein as long as the domain is capable of anchoring a CAR comprising the domain to a cell membrane. In some embodiments, the transmembrane domain that naturally is associated with one of the domains in the CAR is used. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex. One skilled in the art would appreciate that the full transmembrane domain, or portion thereof, is implemented with the cytoplasmic domain, or a portion thereof. The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. In some embodiments, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker. In some embodiments, the transmembrane domain can be any suitable transmembrane domain known in the art, e.g., transmembrane domain derived from TCRa, TCRp, TCR(^, CD3(^, CD3s, CD3y, CD35, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD32, CD33, CD34, CD37, CD45, CD64, CD80, CD86, CD134, CD137, CD154, or inducible T cell costimulator (ICOS). However, any transmembrane domain is contemplated for use herein as long as the domain is capable of anchoring a CAR comprising the extracellular domain to a cell membrane. Transmembrane domains can be identified using any method known in the art or described herein, e.g., by using the UniProt Database.[000204] In some embodiments, an anti-PRAME / HLA-A2 CAR further comprises an intracellular (or cytoplasmic) domain. In some embodiments, the intracellular domain of the CAR is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed in. The term “effector function” refers to aspecialized function of a cell (e.g., a T cell, a NK cell, or a NKT cell). Effector function of a cell (e.g., a T cell, a NK cell, or a NKT cell), for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus, the term “intracellular signaling domain” refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact domain as long as it transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal. In certain embodiments, the intracellular (or cytoplasmic) domain of a chimeric antigen receptor as disclosed herein may include, but is not limited to, a 4- IBB intracellular domain, a 0X40 intracellular domain, a CD30 intracellular domain, a CD40 intracellular domain, an ICOS intracellular domain, a LFA-1 intracellular domain, a CD2 intracellular domain, a CD3 C, intracellular domain, a CD3 y intracellular domain, a CD3 5 intracellular domain, a CD3 a intracellular domain, and a CD7 intracellular domain, and a CD22 intracellular domain. [000205] In some embodiments, the intracellular domain further comprises one or more intracellular co-stimulatory domains, such as those described herein, which transmit a costimulatory signal which promotes cell proliferation, cell survival, and / or cytokine secretion after binding of the extracellular domain. In some embodiments, such intracellular co- stimulatory domains include, without limitation, any co-stimulatory domain disclosed herein or those domains known in the art, including but not limited to CD28, ICOS, 4- IBB, 0X40, or CD27.[000206] The intracellular signaling domain of a chimeric antigen receptor of the present disclosure is responsible for activation of at least one of the normal effector functions of the cell in which the CAR has been placed and / or activation of proliferative and cell survival pathways.[000207] It is to be understood that a chimeric antigen receptor as disclosed herein can include a domain (e.g., an extracellular domain, a transmembrane domain, an intracellular (cytoplasmic) domain, a co-stimulatory domain, a signaling domain, or any combination thereof) having a sequence as set forth herein, or a variant thereof, or a fragment thereof, of any one or more of the domains disclosed herein (e.g., a variant and / or fragment that retains the function required for the chimeric antigen receptor activity).[000208] In some embodiments, the present disclosure provides genetically modified immune cells (e.g., T cells, NK cells, or NKT cells) expressing the anti-PRAME / HLA-A2 CAR described herein.(c) T cell Engaging Bispecific Antibodies Targeting PRAME / HLA-A2 complex [000209] In some aspects, the present disclosure provides a multispecific (e.g., bispecific) antibody comprising one or more first antigen binding sites targeting PRAME / HLA-A2 complex, and one or more second binding sites targeting one or more different epitopes on a PRAME HLA-A2 complex. In some aspects, the present disclosure provides a multispecific (e.g., bispecific antibody) comprising one or more first antigen binding sites targeting PRAME / HLA-A2 complex, and one or more second binding sites targeting one or more different antigens.[000210] In some embodiments, the present disclosure provides a bispecific antibody comprising a first antigen binding site targeting PRAME / HLA-A2 complex, and a second binding site. In some embodiments, the present disclosure provides a bispecific antibody comprising a first antigen binding site targeting PRAME / HLA-A2 complex, and a second antigen binding site specifically binds a different epitope on a PRAME HLA-A2 complex. In some embodiments, the present disclosure provides a bispecific antibody comprising a first antigen binding site targeting PRAME / HLA-A2 complex, and a second antigen binding site specifically binds a different epitope on a different antigen. In some embodiments, a bispecific antibody described herein comprises a first antigen binding site comprising an antigen binding site of any one of the anti-PRAME / HLA-A2 complex antibodies described in Table 1. In some embodiments, a bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 of any one of the anti-PRAME / HLA-A2 complex antibodies described in Table 1. In some embodiments, a bispecific antibody described herein comprises a first antigen binding site comprising a VH and / or VL of any one of the anti-PRAME / HLA-A2 complex antibodies described in Table 1.[000211] In some embodiments, a bispecific antibody described herein is a T cell engaging antibody that also targets PRAME / HLA-A2 complex. In some embodiments, a bispecific antibody described herein comprises a first antigen binding site that specifically binds a PRAME / HLA-A2 complex and a second antigen binding site that specifically binds a T cell antigen (referred to as an anti-PRAME / HLA-A2xT cell bispecific antibody. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises a secondantigen binding site that specifically binds a T cell receptor specifically binds a CD3 complex. In some embodiments, the second antigen binding site specifically binds to CD3s of a CD3 complex. In some embodiments, the second antigen binding site specifically binds to CD3y of a CD3 complex. In some embodiments, the second antigen binding site specifically binds to CD35 of a CD3 complex. In some embodiments, the second antigen binding site specifically binds to a CD3s / 5 heterodimer of a CD3 complex. In some embodiments, the second antigen binding site specifically binds to a CD3s / y heterodimer of a CD3 complex. Any suitable antigen binding site that specifically binds to CD3 derived from an anti-CD3 antibody can be combined with an antigen binding site that specifically binds to a PRAME / HLA-A2 complex as described herein to form an anti-PRAME / HLA-A2xT cell bispecific antibody of the present disclosure. In some embodiments, an anti-PRAME / HLA- A2xT cell bispecific antibody comprises a first antigen binding site that specifically binds a PRAME / HLA-A2 complex (e.g., an antigen binding site derived from any one of the anti- PRAME / HLA-A2 complex described herein), and a second antigen binding site that specifically binds to CD3 that is derived from any one of the anti-CD3 antibodies previously described, e.g., in US10968276, US20060275292, WO1997044362, W02005118635, W02007042261, WO2011050262, WO2011078332, WO2012073985, WO2012158818, WO2012098238, WO2012162067, WO2013026835, WO2013026839, WO2013026833, WO2013026831, W02013065708, WO2014047231, W02014012085, WO2015095392, WO2015143079, W02015181098, WO2016116626, W02016020332, W02016180721, WO2016204966, WO2016014974, WO2017127499, WO2017210443, WO2018208864, WO2018237148, W02018052503, WO2019228406, WO2019234241, WO2019224717, WO2019224711, WO2019078697, W02020047176, W02020018820, WO2020212947, WO2022266660, the anti-CD3 antibodies described in each are incorporated herein by reference.[000212] In some embodiments, a need for recruiting a T cell to a cancer cell expressing PRAME for killing the cancer cell exists. In some embodiments, the present disclosure provides means for engaging a T cell to a cancer cell expressing PRAME. In some embodiments, the means for engaging a T cell to a cancer cell expressing PRAME is an anti- PRAME / HLA-A2xT cell bispecific antibody described herein. In some embodiments, the present disclosure provides means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME. In some embodiments, the means for eliciting cytotoxic T cell immunity against cancer cells expressing PRAME is an anti-PRAME / HLA-A2xT cell bispecific antibody described herein.[000213] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises a second antigen binding site that specifically binds to CD3, wherein the improvement comprises a first antigen binding site that specifically binds to a PRAME / HLA- A2 complex that comprises any one of the anti-PRAME / A2 binding site derived from any of the anti-PRAME / A2 antibodies described herein (e.g., any one of the anti-PRAME / HLA-A2 antibody described in Table 1).[000214] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site that specifically binds to a PRAME / HLA-A2 complex. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR1, a HC CDR2 and a HC CDR3 of a heavy chain variable domain (VH) having the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a LC CDR1, a LC CDR2 and a LC CDR3 of a light chain variable domain (VL) having the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. [000215] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR3 having theamino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR1, a HC CDR2, and a HC CDR3, having the amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, columns A and B of Table 9. Alternatively or in addition, in some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a LC CDR, a LC CDR2, and a LC CDR3 having the amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described hereincomprises a first antigen binding site comprising a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 having the amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, columns A and B of Table 9.[000216] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18,antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000217] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000218] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HCCDR1, the HC CDR2, and the HC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation); and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1, the LC CDR2, and the LC CDR3 amino acid sequences of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000219] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a HC CDR1 at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1; a HC CDR2 at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR2; and / or a HC CDR3 at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR3 amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30, antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column A of Table 9. Alternatively or in addition, an anti- PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a LC CDR1 at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR1; a LC CDR2 at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR2,; and / or a LC CDR3 at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC CDR3 amino acid sequence of antibody #1 in row 1, antibody #2 in row 2, antibody #3 in row 3, antibody #4 in row 4, antibody #5 in row 5, antibody #6 in row 6, antibody #7 in row 7, antibody #8 in row 8, antibody #9 in row 9, antibody #10 in row 10, antibody #11 in row 11, antibody #12 in row 12, antibody #13 in row 13, antibody #14 in row 14, antibody, antibody #15 in row 15, antibody #16 in row 16, antibody #17 in row 17, antibody #18 in row 18, antibody #19 in row 19, antibody #20 in row 20, antibody #21 in row 21, antibody #22 in row 22, antibody #23 in row 23, antibody #24 in row 24, antibody #25 in row 25, antibody #26 in row 26, antibody #27 in row 27 antibody #28 in row 28, antibody #29 in row 29, antibody #30 in row 30,antibody #31 in row 31, antibody #32 in row 32, or antibody #33 in row 33, column B of Table 9.[000220] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VH comprising the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VL comprising the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VH and a VL comprising the amino acid sequences of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A and B of Table 10.[000221] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000222] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody#5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000223] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in the amino acid sequence of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of and / or a VL of the amino acid sequences of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A and column B of Table 10 excluding any of the CDR sequences therein. In some embodiments, an anti- PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 inrow 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000224] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10. Alternatively or in addition, an anti- PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a VL comprising an amino acid sequence that is at least 80% (e.g., atleast 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table lOexcluding any of the CDR sequences therein. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a first antigen binding site comprising a heavychain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column A of Table 10, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of antibody #1 in row 34; antibody #2 in row 35, antibody #3 in row 36, antibody #4 in row 37, antibody #5 in row 38, antibody #6 in row 39, antibody #7 in row 40, antibody #8 in row 41, antibody #9 in row 42, antibody #10 in row 43, antibody #11 in row 44, antibody #12 in row 45, antibody #13 in row 46, antibody #14 in row 47, antibody #15 in row 48, antibody #16 in row 49, antibody #17 in row 50, antibody #18 in row 51, antibody #19 in row 52, antibody #20 in row 53, antibody #21 in row 54, antibody #22 in row 55, antibody #23 in row 56, antibody #24 in row 57, antibody #25 in for 58, antibody #26 in row 59, antibody #27 in row 60, antibody #28 in row 61, antibody #29 in row 62, antibody #30 in row 63, antibody #31 in row 64, antibody #32 in row 65, or antibody #33 in row 66, column B of Table 10.[000225] In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody described herein comprises a second antigen binding site that specifically binds to CD3. [000226] Typically, each of the two antigen binding sites is present within an “arm” of a bispecific antibody. In some embodiments, an arm of a bispecific antibody is configured as a monospecific antibody, e.g., a full-length IgG or a fragment thereof. In some embodiments, a bispecific antibody comprises two arms, one or each of which is configured as an Fv region that confers specificity to distinct antigen residues. In some embodiments, a bispecific antibody comprises two arms of the same configuration in any other suitable format. In some embodiments, a bispecific antibody comprises two arms of two different configurations. Insome embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab, a Fab’, or a scFv and that comprises the first antigen binding site. In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a second arm that is configured as a Fab, a Fab’, or a scFv and that comprises the second antigen binding site. In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as an scFv that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab’ that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex). In some embodiments, an anti- PRAME / HEA-A2xT cell bispecific antibody comprises a second arm that is configured as an scFv that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a second arm that is configured as a Fab that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a second arm that is configured as a Fab’ that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3).[000227] In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as an scFv that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex) and a second arm that is configured as an scFv that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti- PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as an scFv that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as a Fab that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as an scFv that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as a Fab’ that comprises a second antigenbinding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HLA-A2 complex), and a second arm that is configured as a Fab’ that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as an scFv that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as a Fab that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab’ that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as a Fab’ that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3) that is a Fab’. In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab’ that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as a Fab that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises a first arm that is configured as a Fab’ that comprises a first antigen binding site (e.g., a first antigen binding site that specifically binds PRAME / HEA-A2 complex), and a second arm that is configured as an scFv that comprises a second antigen binding site (e.g., a second antigen binding site that specifically binds CD3). [000228] In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody does not comprise an Fc region. In some embodiments, the two arms of an anti-PRAME / HEA- A2xT cell bispecific antibody are linked directly. In some embodiments, the two arms of an anti-PRAME / HEA-A2xT cell bispecific antibody are linked by a linker. In some embodiments, an anti-PRAME / HEA-A2xT cell bispecific antibody comprises an Fc region, e.g., a dimeric Fc or a monomeric Fc. In some embodiments, an anti-PRAME / HEA-A2xTcell bispecific antibody comprises a monomeric Fc. In some embodiments, an anti- PRAME / HLA-A2xT cell bispecific antibody comprises one arm linked to one end (e.g., the N terminal) of a monomeric Fc and a second arm linked to the other end (e.g., the C terminal) of the monomeric Fc. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises a dimeric Fc region. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises two arms that are oriented symmetrically around an Fc region (e.g., each Fc monomer of a dimeric Fc region is linked to one arm). In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises two distinct heavy chains and two distinct light chains, with each heavy chain / light chain pair having different antigen binding specificity. In some embodiments, an anti-PRAME / HLA-A2xT cell bispecific antibody comprises two arms that are oriented asymmetrically around an Fc (e.g., the two arms of the anti-PRAME / HLA-A2xT cell bispecific antibody are linked to one of the monomers of a dimeric Fc region).[000229] In some embodiments, an anti-PRAME / HLA-A2x T cell bispecific antibody comprises a monomeric Fc containing mutations whic...
Claims
CLAIMSWhat is claimed is:
1. An antibody that specifically binds PRAME (PReferentially expressed Antigen in MElanoma) / HLA-A2 complex (PRAME / HLA-A2) comprising:(a) a heavy chain complementarity determining region 1 (HC CDR1), a heavy chain complementarity determining region 2 (HC CDR2), and a heavy chain complementarity determining region 3 (HC CDR3) of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 27, and a light chain complementarity determining region 1 (LC CDR1), a light chain complementarity determining region 2 (LC CDR2), and a light chain complementarity determining region 3 (LC CDR3) of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 28;(b) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 31, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 28;(c) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 38, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 32;(d) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 42, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 32;(e) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 39, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 32;(f) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 87, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 88;(g) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 91, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 92;(h) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 95, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 96;(i) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 102, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 103;(j) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 105, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 106;(k) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 110, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 111;(l) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 115, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 116;(m) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 120, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 121;(n) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 123, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 124;(o) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 126, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 127;(p) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 128, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 129;(q) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 134, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 135;(r) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 138, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 139;(s) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 140, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 141;(t) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 144, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 145;(u) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 149, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 150;(v) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 153, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 154;(w) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 155, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 156;(x) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 159, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 160;(y) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 161, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 162;(z) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 164, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 165;(aa) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 166, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 167;(bb) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 170, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 171;(cc) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 172, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 173;(dd) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 174, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 175;(ee) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 179, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 180; or(ff) a HC CDR1, a HC CDR2, a HC CDR3 of a VH comprising the amino acid sequence of SEQ ID NO: 184, and a LC CDR1, LC CDR2, LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 185.
2. The antibody of claim 1, wherein the antibody comprises:(a) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 22, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 23, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 26;(b) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 22, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 30, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 26;(c) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 33, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 34, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(d) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 40, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(e) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 33, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; or(f) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 82, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 83, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 81, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 86;(g) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 89, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 83, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 77, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 85, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90;(h) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 89, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 93, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 94, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90;(i) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 97, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 98, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90;(j) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 89, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 83, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 101, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90;(k) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 80, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 98, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 84, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 104;(l) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 40, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 107, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 108, a LC CDR1 comprising the amino acid sequence of SEQID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 109, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(m) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 112, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 113, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114;(n) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 117, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 118, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 119, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114;(o) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 117, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 119, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 122, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114;(p) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 33, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 125, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 119, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 114;(q) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 40, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 108, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 109, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(r) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 131, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 79, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 133, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(s) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 136, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 137, a HC CDR3 comprising theamino acid sequence of SEQ ID NO: 79, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(t) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 132, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(u) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 142, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 143, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(v) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 146, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 147, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 148, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(w) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 151, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 78, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 152, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(x) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 132, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(y) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 157, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 158;(z) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 157, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(aa) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 163, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 132, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(bb) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 151, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 125, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(cc) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 168, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 169, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(dd) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 151, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(ee) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 130, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 41, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 35, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37;(ff) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 176, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 177, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 178, a LC CDR1 comprising the amino acid sequenceof SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 37; or(gg) a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 181, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 182, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 183, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 24, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 25, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 90.
3. The antibody of claim 1 or 2, wherein the antibody comprises:(a) a VH comprising the amino acid of SEQ ID NO: 27, and / or a VL comprising the amino acid sequence of SEQ ID NO: 28;(b) a VH comprising the amino acid of SEQ ID NO: 31, and / or a VL comprising the amino acid sequence of SEQ ID NO: 28;(c) a VH comprising the amino acid of SEQ ID NO: 38, and / or a VL comprising the amino acid sequence of SEQ ID NO: 32;(d) a VH comprising the amino acid of SEQ ID NO: 42, and / or a VL comprising the amino acid sequence of SEQ ID NO: 32;(e) a VH comprising the amino acid of SEQ ID NO: 39, and / or a VL comprising the amino acid sequence of SEQ ID NO: 32;(f) a VH comprising the amino acid sequence of SEQ ID NO: 87, and / or a VL comprising the amino acid sequence of SEQ ID NO: 88;(g) a VH comprising the amino acid sequence of SEQ ID NO: 91, and / or a VL comprising the amino acid sequence of SEQ ID NO: 92;(h) a VH comprising the amino acid sequence of SEQ ID NO: 95, and / or a VL comprising the amino acid sequence of SEQ ID NO: 96;(i) a VH comprising the amino acid sequence of SEQ ID NO: 102, and / or a VL comprising the amino acid sequence of SEQ ID NO: 103;(j) a VH comprising the amino acid sequence of SEQ ID NO: 105, and / or a VL comprising the amino acid sequence of SEQ ID NO: 106;(k) a VH comprising the amino acid sequence of SEQ ID NO: 110, and / or a VL comprising the amino acid sequence of SEQ ID NO: 111;(l) a VH comprising the amino acid sequence of SEQ ID NO: 115, and / or a VL comprising the amino acid sequence of SEQ ID NO: 116;(m) a VH comprising the amino acid sequence of SEQ ID NO: 120, and / or a VL comprising the amino acid sequence of SEQ ID NO: 121;(n) a VH comprising the amino acid sequence of SEQ ID NO: 123, and / or a VL comprising the amino acid sequence of SEQ ID NO: 124;(o) a VH comprising the amino acid sequence of SEQ ID NO: 126, and / or a VL comprising the amino acid sequence of SEQ ID NO: 127;(p) a VH comprising the amino acid sequence of SEQ ID NO: 128, and / or a VL comprising the amino acid sequence of SEQ ID NO: 129;(q) a VH comprising the amino acid sequence of SEQ ID NO: 134, and / or a VL comprising the amino acid sequence of SEQ ID NO: 135;(r) a VH comprising the amino acid sequence of SEQ ID NO: 138, and / or a VL comprising the amino acid sequence of SEQ ID NO: 139;(s) a VH comprising the amino acid sequence of SEQ ID NO: 140, and / or a VL comprising the amino acid sequence of SEQ ID NO: 141;(t) a VH comprising the amino acid sequence of SEQ ID NO: 144, and / or a VL comprising the amino acid sequence of SEQ ID NO: 145;(u) a VH comprising the amino acid sequence of SEQ ID NO: 149, and / or a VL comprising the amino acid sequence of SEQ ID NO: 150;(v) a VH comprising the amino acid sequence of SEQ ID NO: 153, and / or a VL comprising the amino acid sequence of SEQ ID NO: 154;(w) a VH comprising the amino acid sequence of SEQ ID NO: 155, and / or a VL comprising the amino acid sequence of SEQ ID NO: 156;(x) a VH comprising the amino acid sequence of SEQ ID NO: 159, and / or a VL comprising the amino acid sequence of SEQ ID NO: 160;(y) a VH comprising the amino acid sequence of SEQ ID NO: 161, and / or a VL comprising the amino acid sequence of SEQ ID NO: 162;(z) a VH comprising the amino acid sequence of SEQ ID NO: 164, and / or a VL comprising the amino acid sequence of SEQ ID NO: 165;(aa) a VH comprising the amino acid sequence of SEQ ID NO: 166, and / or a VL comprising the amino acid sequence of SEQ ID NO: 167;(bb) a VH comprising the amino acid sequence of SEQ ID NO: 170, and / or a VL comprising the amino acid sequence of SEQ ID NO: 171;(cc) a VH comprising the amino acid sequence of SEQ ID NO: 172, and / or a VL comprising the amino acid sequence of SEQ ID NO: 173;(dd) a VH comprising the amino acid sequence of SEQ ID NO: 174, and / or a VL comprising the amino acid sequence of SEQ ID NO: 175;(ee) a VH comprising the amino acid sequence of SEQ ID NO: 179, and / or a VL comprising the amino acid sequence of SEQ ID NO: 180; or(ff) a VH comprising the amino acid sequence of SEQ ID NO: 184, and / or a VL comprising the amino acid sequence of SEQ ID NO: 185.
4. The antibody of any one of claims 1-3, wherein the antibody is a full-length IgG, a Fab fragment, a F(ab') fragment, a F(ab’)2 fragment, a scFv, or a Fv.
5. The antibody of any one of claims 1-4, wherein the antibody comprises a heavy chain constant region of the isotype IgGl, IgG2, IgG3, or IgG4.6 An antibody that specifically binds members of a set of complexes of peptides bound by HLA-A2, each complex comprising a different peptide bound by HLA-A2, wherein each peptide has an amino acid sequence defined by a formula set forth as X56X57X58X59HLIGX60 (SEQ ID NO: 18), wherein:X56 is S, G, A, T, Q, H, or Y when X57 is L, X58 is L, X59 is Q, and Xeo is L;X57 is M or L when X56 is S, X58 is L, X59 is Q, and Xeo is L (SEQ ID NO: 288);X58 is D, M, W, Y, L, N, Q, F, H, A, or T when X56 is S, X57 is L, X59 is Q, and Xeo is L (SEQ ID NO: 289);X59 is E, P, N, Q, S, G, K, T, or A when X56 is S, X57 is L, X58 is L, and Xeo is L (SEQ ID NO: 290); orXeo is Y, I, T, L, or A when X56 is S, X57 is L, X58 is L, and X59 is Q (SEQ ID NO: 291).
7. The antibody of claim 6, wherein at least one member of the set of complexes comprises a PRAME peptide.
8. The antibody of claim 7, wherein the PRAME peptide comprises the amino acid sequence consisting of SLLQHLIGL (SEQ ID NO: 19).
9. The antibody of any one of claims 6-8, wherein the antibody is obtained by a process comprising:(1) exposing members of the set of complexes to a library of antibodies under conditions in which at least one antibody of the library that specifically binds to the members of the set of complexes is detected;(2) obtaining the sequence of a heavy chain variable domain of an antibody detected in step (1) that specifically binds the members of the set of complexes; and(3) producing an antibody having at least a heavy chain complementarity determining region 3 (HC CDR3) of the heavy chain variable domain of step (2), thereby obtaining the antibody that specifically binds to the members of the set of complexes.
10. The antibody of claim 10, wherein the process further comprising (4) confirming that the antibody obtained by step (3) binds a PRAME peptide bound by HLA-A2.
11. A bispecific antibody comprising a first antigen binding site comprising the antibody of anyone of claims 1-10, and a second antigen binding site.
12. The bispecific antibody of claim 11, wherein the second antigen binding site specifically binds to a T cell antigen.
13. The bispecific antibody of claim 12, wherein the T cell antigen is a CD3 complex.
14. The bispecific antibody of any one of claims 11-13, wherein the second antigen binding site specifically binds CD35 of a CD3 complex.
15. The bispecific antibody of any one of claims 11-13, wherein the second antigen binding site specifically binds CD3s of a CD3 complex.
16. The bispecific antibody of any one of claims 11-13, wherein the second antigen binding site specifically binds CD3y of a CD3 complex.17 The bispecific antibody of any one of claims 11-13, wherein the second antigen binding site specifically binds a CD3s / 5 heterodimer of a CD3 complex.
18. The bispecific antibody of any one of claims 11-13, wherein the second antigen binding site specifically binds a CD3s / y heterodimer of a CD3 complex.
19. The bispecific antibody of any one of claims 11-18, wherein the bispecific antibody comprises a first arm that is configured as a Fab, a Fab’, or a scFv and that comprises the first antigen binding site.
20. The bispecific antibody of any one of claims 11-19, wherein the bispecific antibody comprises a second arm that is configured as a Fab, a Fab’, or a scFv and that comprises the second antigen binding site.
21. The bispecific antibody of any one of claims 11-20, wherein the bispecific antibody comprises a first arm that is configured as a Fab and a second arm that is configured as a scFv.
22. The bispecific antibody of any one of claims 11-20, wherein the bispecific antibody comprises a first arm that is configured as a scFv and a second arm that is configured as a Fab.
23. The bispecific antibody of any one of claims 11-20, wherein the ratio between the first antigen binding site and the second antigen binding site is 1:1, 1:2, 1:3, 2:1 or 3:1.
24. A chimeric antigen receptor (CAR) comprising the antibody of any one of claims 1- 10.
25. An isolated nucleic acid encoding the VH and / or VL of the antibody of any one of claims 1-10, the bispecific antibody of any one of claims 11-23, or the CAR of claim 24.
26. The isolated nucleic acid of claim 25, wherein the isolated nucleic acid comprises:(a) the nucleic acid sequence of SEQ ID NO: 43, and / or the nucleic acid sequence of SEQ ID NO: 44;(b) the nucleic acid sequence of SEQ ID NO: 45, and / or the nucleic acid sequence of SEQ ID NO: 44;(c) the nucleic acid sequence of SEQ ID NO: 46, and / or the nucleic acid sequence of SEQ ID NO: 47;(d) the nucleic acid sequence of SEQ ID NO: 16, and / or the nucleic acid sequence of SEQ ID NO: 47;(e) the nucleic acid sequence of SEQ ID NO: 48, and / or the nucleic acid sequence of SEQ ID NO: 47;(f) the nucleic acid sequence of SEQ ID NO: 232, and / or the nucleic acid sequence of SEQ ID NO: 233;(g) the nucleic acid sequence of SEQ ID NO: 234, and / or the nucleic acid sequence of SEQ ID NO: 235;(h) the nucleic acid sequence of SEQ ID NO: 235, and / or the nucleic acid sequence of SEQ ID NO: 236;(i) the nucleic acid sequence of SEQ ID NO: 237, and / or the nucleic acid sequence of SEQ ID NO: 238;(j) the nucleic acid sequence of SEQ ID NO: 239, and / or the nucleic acid sequence of SEQ ID NO: 240;(k) the nucleic acid sequence of SEQ ID NO: 241, and / or the nucleic acid sequence of SEQ ID NO: 242;(l) the nucleic acid sequence of SEQ ID NO: 243, and / or the nucleic acid sequence of SEQ ID NO: 244;(m) the nucleic acid sequence of SEQ ID NO: 245, and / or the nucleic acid sequence of SEQ ID NO: 246;(n) the nucleic acid sequence of SEQ ID NO: 247, and / or the nucleic acid sequence of SEQ ID NO: 248;(o) the nucleic acid sequence of SEQ ID NO: 249, and / or the nucleic acid sequence of SEQ ID NO: 250;(p) the nucleic acid sequence of SEQ ID NO: 251, and / or the nucleic acid sequence of SEQ ID NO: 252;(q) the nucleic acid sequence of SEQ ID NO: 253, and / or the nucleic acid sequence of SEQ ID NO: 254;(r) the nucleic acid sequence of SEQ ID NO: 255, and / or the nucleic acid sequence of SEQ ID NO: 256;(s) the nucleic acid sequence of SEQ ID NO: 257, and / or the nucleic acid sequence of SEQ ID NO: 258;(t) the nucleic acid sequence of SEQ ID NO: 259, and / or the nucleic acid sequence of SEQ ID NO: 260;(u) the nucleic acid sequence of SEQ ID NO: 260, and / or the nucleic acid sequence of SEQ ID NO: 261;(v) the nucleic acid sequence of SEQ ID NO: 262, and / or the nucleic acid sequence of SEQ ID NO: 263;(w) the nucleic acid sequence of SEQ ID NO: 264, and / or the nucleic acid sequence of SEQ ID NO: 265;(x) the nucleic acid sequence of SEQ ID NO: 266, and / or the nucleic acid sequence of SEQ ID NO: 267;(y) the nucleic acid sequence of SEQ ID NO: 268, and / or the nucleic acid sequence of SEQ ID NO: 269(z) the nucleic acid sequence of SEQ ID NO: 270, and / or the nucleic acid sequence of SEQ ID NO: 271;(aa) the nucleic acid sequence of SEQ ID NO: 272, and / or the nucleic acid sequence of SEQ ID NO: 273;(bb) the nucleic acid sequence of SEQ ID NO: 274, and / or the nucleic acid sequence of SEQ ID NO: 275;(cc) the nucleic acid sequence of SEQ ID NO: 276, and / or the nucleic acid sequence of SEQ ID NO: 277;(dd) the nucleic acid sequence of SEQ ID NO: 278, and / or the nucleic acid sequence of SEQ ID NO: 279;(ee) the nucleic acid sequence of SEQ ID NO: 280, and / or the nucleic acid sequence of SEQ ID NO: 281;(ff) the nucleic acid sequence of SEQ ID NO: 282, and / or the nucleic acid sequence of SEQ ID NO: 283;(gg) the nucleic acid sequence of SEQ ID NO: 284, and / or the nucleic acid sequence of SEQ ID NO: 285.
27. An expression vector comprising the isolated nucleic acid of claim 25 or 26.
28. A host cell comprising the antibody of any one of claims 1-10, the bispecific antibody of any one of claims 11-23, the CAR of claim 24, the isolated nucleic acid of claim 25 or 26, or the expression vector of claim 27.
29. An engineered cell expressing the antibody of any one of claims 1-10, the bispecific antibody of any one of claims 11-23, or the CAR of claim 24.
30. The engineered cell of claim 16, wherein the engineered cell is a T cell, a NK cell, or a NKT cell.
31. A composition comprising the antibody of any one of claims 1-10, the bispecific antibody of any one of claims 11-23, the CAR of claim 24, the isolated nucleic of claim 25 or 26, the expression vector of claim 27, the host cell of claim 28, or the engineered cell of claim 29 or 30.
32. The composition of claim 31, further comprising a pharmaceutically acceptable carrier.33 A method of treating cancer, the method comprising administering to a subject in need thereof an effective amount of the antibody of any one of claims 1-10, the bispecific antibody of any one of claims 11-23, the CAR of claim 24, the isolated nucleic of claim 25 or 26, the expression vector of claim 27, the host cell of claim 28, the engineered cell of claim 29 or 30, or the composition of claim 31 or 32.
Citation Information
Patent Citations
Monoclonal antibodies and diagnostic uses thereof
WO2011062634A2
T cell receptor-like antibodies specific for a prame peptide
WO2016191246A2
Multi-domain binding molecules
WO2024038183A1