Expression construct
The PGK promoter effectively drives co-expression of CAR and FOXP3 in Tregs, addressing promoter selection challenges by achieving efficient transgene expression and cell expansion, suitable for cell therapy products.
Patent Information
- Application Number
- PCT/GB2025/051471
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2025-06-20
- Filing Date
- 2025-07-03
- Publication Date
- 2026-01-08
AI Technical Summary
Existing technologies face challenges in selecting mammalian promoters that provide sufficient transgene expression and viral vector titre levels for clinical engineered cell products, particularly in less metabolically active cells like regulatory T cells (Tregs), due to issues such as gene silencing and weaker expression compared to viral promoters.
The use of a phosphoglycerate kinase 1 (PGK) promoter operably linked to a first nucleotide sequence encoding a chimeric antigen receptor (CAR) and a second nucleotide sequence encoding a FOXP3 polypeptide, with the first sequence upstream, enabling efficient co-expression and transduction of these proteins in Tregs, even at lower CAR MFI levels compared to viral promoters.
This approach achieves desirable vector titre and cell transduction, along with greater Treg expansion, making it suitable for producing cell therapy products with required expression levels and expansion, surpassing the performance of traditional viral promoters.
Smart Images

Figure IMGF000139_0001 
Figure 00000160_0000 
Figure 00000160_0001
Abstract
Description
[0001]EXPRESSION CONSTRUCT TECHNICAL FIELDThe present disclosure relates generally to the field of expression constructs, nucleic acid molecules,and vectors useful to express polypeptides in cells, particularly in immune cells useful in adoptive celltherapy (ACT). The disclosure provides expression constructs comprising a phosphoglycerate kinase1 (PGK) promoter operably linked to a first nucleotide sequence encoding a chimeric antigen receptor(CAR) and a second nucleotide sequence encoding a FOXP3 polypeptide, wherein the first nucleotidesequence is located upstream of the second nucleotide sequence. The disclosure further providesnucleic acid molecules, vectors and cells comprising said expression constructs, particularly immunecells such as T cells, particularly regulatory T cells (Tregs). A method of making said cells is alsoprovided. The cells, particularly Tregs, may be used for inducing tolerance to a transplant, treatingand / or preventing graft-versus-host disease (GvHD), treating or preventing an infectious, allergic, autoimmune or inflammatory disease, or for inducing immunosuppression, or for promoting tissue repair and / or tissue regeneration. BACKGROUND Immunotherapy is emerging as a beneficial tool for the treatment of many conditions, ranging from cancer, autoimmune and inflammatory diseases, to the prevention of solid organ transplant rejection. In particular, there has been increased clinical activity in the area of adoptive cellular immunotherapy (ACT), particularly in regulatory T cell (Treg) cell therapies, across the autoimmune and inflammatory space. CD4+FOXP3+ regulatory T cells (Tregs) are a lymphocyte subset that is essential for the maintenance of dominant immunological tolerance by inhibiting the function of various effector immune cell subsets such as T effector cells. In addition, Tregs are also known to promote tissue repair and regeneration. Tregs are able to confer immune tolerance through multiple contact-dependent and independent mechanisms. These include production of anti-inflammatory soluble mediators such as IL-10, TGF-β and IL-35, consumption of IL-2, expression of negative regulatory cell surface receptors, such as CTLA- 4, and targeting T cells directly or indirectly through APCs. Importantly, once activated, Tregs can suppress immune responses in a non-antigen specific fashion (bystander suppression), i.e., once activated, Tregs have the ability to modulate the local immune micro-environment and suppress inflammation. Furthermore, they can confer a suppressive phenotype on other cells of the immune system, a process called “infectious tolerance”. Artificial chimeric antigen receptors (CARs) have been used to confer antigen specificity on a cell. CARs are generally composed of an extracellular antigen-binding domain (e.g. a scFv specific for the target antigen), a transmembrane domain, and an intracellular signalling domain which sends signals into thecell and activates it upon binding of the antigen to the extracellular antigen-binding domain. This enablesthe cells to provide a targeted response, for example CAR-Treg cells are able to provide a targeted immune suppression. CAR-Tregs have been reported to have increased suppressive ability compared to polyclonal Tregs. Treg cells express FOXP3 and conventional T cells (Tcon cells) can be differentiated towards aregulatory phenotype ex vivo by expressing FOXP3 in those cells. Loss of FOXP3 expression isassociated with a loss of suppressive function in regulatory T cells and a potential return to an effectorphenotype. It has therefore been proposed to express exogenous FOXP3 in immune cells to provide astable Treg phenotype or to confer a Treg phenotype on the cell. Expression of transgenes in a cell can be obtained by introducing one or more expression constructsencoding the transgenes into the cell. The expression constructs may be comprised within a vector,particularly a viral vector, to enable it to be introduced into a cell. The transgenes may be operablylinked to one or more exogenous promoters which lead to the initiation of transcription of the transgenes.Although a large number of promoters are known in the art and have been used to express transgenesin target cells, many of these promoters are viral in nature which have been reported in the literature tobe more prone to gene silencing. Particularly for clinical engineered cell products, to avoid such issues, selection of a mammalian promoter may be desirable in certain circumstances. However, mammalian promoters typically are weaker than viral promoters and may not provide vector titre levels or geneexpression levels which are necessary to allow production of a dose for a clinical product. Further,other variables, including the number, type and size of transgenes to be expressed, construct design,the formation of secondary structures and the type of cell in which expression is desired, may all affectthe ability of a particular promoter to provide desired expression levels of one or more transgenes, andof an expression construct to be packaged with a desirable titre in a viral vector. It can therefore bechallenging to select a mammalian promoter and construct design which provides sufficient transgeneexpression and for viral vector production, sufficient vector titre. It may be particularly difficult to selecta suitable promoter to obtain the desired level of transgene expression in cells which are less metabolically active such as Tregs. SUMMARYThe present inventors have developed expression constructs for co-expression of a CAR and anexogenous FOXP3 polypeptide in cells, which are operably linked to a mammalian promoter, namely aphosphoglycerate kinase 1 (PGK) promoter. These nucleic acid molecules are particularly suitable forco-expression of a CAR and exogenous FOXP3 in regulatory T cells (Tregs). Surprisingly, the inventorsfound that the mammalian PGK promoter, when combined with a nucleotide sequence encoding a CARand FOXP3, is able to provide desirable levels of viral vector titre, and is able to drive desirable levelsof cell transduction / transgene expression, particularly desirable expression of a CAR and a FOXP3 polypeptide in Tregs, whereas other mammalian promoters were not. Additionally, the inventorsidentified that gene order of CAR and FOXP3 had an unexpected positive impact on the production ofviral vector and the transduction of cells, particularly for bicistronic constructs. Further, the inventorsfound that Tregs transduced with the expression construct of the invention were able to efficientlyexpand and were at least functionally equivalent or highly similar to Tregs transduced with anexpression construct driving co-expression of a CAR and a FOXP3 polypeptide using a viral SFFVpromoter, despite the Tregs transduced with the PGK construct having a lower CAR MFI than the Tregstransduced with the SFFV promoter construct. In addition, the inventors found that greater Treg expansion was obtained with Tregs transduced with the PGK construct compared to Tregs transducedwith the SFFV promoter construct. Thus, the inventors have identified a new expression construct whichutilises a mammalian promoter that is capable of being packaged as a viral vector with desirable titres,resulting in efficient transduction and expansion of Treg cells and expression of CAR and FOXP3transgenes. The new expression construct design is particularly advantageous for the production and use of a cell therapy product, where vector titre, cell transduction and transgene expression, and cellexpansion are required at particular levels to enable the production of a dose of cell product.Accordingly, in one aspect, the present invention provides an expression construct comprising a PGKpromoter operably linked to: (i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the first nucleotide sequence is located upstream of the second nucleotide sequence. The region that lies towards the 5’ end of the DNA coding strand is referred to as “upstream”. Therefore,in other words, the present invention provides an expression construct comprising 5’ to 3’:a PGK promoter operably linked to; (i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide.The first and second nucleotide sequences are operably linked to the same PGK promoter. By “operablylinked to the same promoter” it is meant that there is a functional linkage between the PGK promoterand both the first and second nucleotide sequence that results in expression of the first and secondnucleotide sequences. In other words, transcription of the first and second nucleotide sequences isinitiated from the same PGK promoter and that the nucleotide sequences are positioned and orientedfor transcription to be initiated from the promoter. Polynucleotides operably linked to a promoter are under transcriptional regulation of that promoter.In certain embodiments, the expression construct does not comprise any other coding nucleotidesequence or, alternatively put, does not comprise any other coding nucleotide sequence operably linkedto the same PGK promoter. In other words, the expression construct defined herein may be bicistronicbecause it encodes two discrete proteins (the CAR and the FOXP3 polypeptide encoded by the firstand second nucleotide sequences). By “coding sequence” or “coding region” it is meant the nucleotidesequence that is translated and thus codes for a discrete protein.The polypeptides may be produced in a cell as individual components, i.e., as discrete entities. Thus,the CAR and FOXP3 polypeptides may be separately located, in or on the cell in which they areexpressed, as separate and distinct, or discrete, functional polypeptides. In certain embodiments, this may be achieved by the presence of cleavage sequences in the nucleic acid molecule, in particular self-cleaving sequences, in between the first nucleotide sequence and second nucleotide sequence and / orby the presence of an internal ribosome entry site (IRES) between the first nucleotide sequence andsecond nucleotide sequence. The self-cleavage sequence may be a 2A sequence, optionally selectedfrom P2A, T2A, E2A and F2A. For example, the self-cleavage sequence may be the T2A sequence.As used herein, the term “PGK promoter” refers to a promoter that is derived from an endogenouspromoter operably linked to an endogenous PGK gene in an unmodified or non-engineered cell.Alternatively viewed, the PGK promoter as used herein is derived from an endogenous, wildtype ornaturally occurring PGK promoter. An endogenous, wildtype or naturally occurring PGK promoter iscapable initiating transcription of an endogenous, naturally occurring or wildtype PGK gene. The PGKgene may be the human PGK gene. The PGK promoter as referred to herein may comprise or consist of an identical sequence to an endogenous, wildtype or naturally occurring PGK promoter or may be afunctional variant or functional fragment thereof.The PGK promoter may, for example, comprise, consist essentially of or consist of the sequence ofSEQ ID NO: 195 or a functional variant or functional fragment thereof.By “functional variant” it is meant any variant that is able to function as a promoter (i.e., initiatetranscription and result in expression of the transgene(s) to which it is operably linked). Variantstherefore include PGK promoters that include one or more nucleotide truncations, deletions,substitutions or insertions. By “functional fragment” it is meant a fragment of a reference PGK promoter(e.g. a fragment of an endogenous, wildtype or naturally occurring PGK promoter or a fragment of SEQID NO: 195) which is able to function as a promoter (i.e. initiate transcription and result in expression ofthe transgene to which it is operably linked). A functional fragment may further comprise one or morenucleotide deletions, substitutions or insertions. The functional variant may, for example, have at least about 70% sequence identity to an endogenous, wildtype or naturally occurring PGK promoter or to for example, SEQ ID NO: 195. For example, the functional variant may have at least about 75% or at least about 80% or at least about 85% or at least about 90% or at least about 91% or at least about 92% or at least about 93% or at least about 94% or at least about 95% or at least about 96% or at least about 97% or at least about 98% or at least about 99% sequence identity to an endogenous, wildtype or naturally occurring PGK promoter or to for example, SEQ ID NO: 195.A functional fragment may have at least 20% sequence identity to an endogenous, wildtype or naturallyoccurring PGK promoter or to for example, SEQ ID NO.195. For example, the functional fragment may have at least about 30% or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% sequence identity to an endogenous, wildtype or naturally occurring PGK promoter or to for example, SEQ ID NO:195. As discussed above, a functional fragment may further comprise one or more nucleotide deletions,substitutions or insertions, as compared to an endogenous, wildtype or naturally occurring PGKpromoter or to for example, SEQ ID NO.195, however, the nucleotide sequence of the fragment shouldhave at least 70% (e.g. at least 80, 85, 90, 95, 96, 97, 98 or 99%) sequence identity to its correspondingendogenous, wildtype or naturally occurring PGK promoter fragment. Alternatively viewed, a functional fragment may be referred to as a truncated PGK promoter. Therefore,in certain embodiments, the PGK promoter comprises, consists essentially of or consists of a truncatedPGK promoter or a functional variant thereof, for example a truncated human PGK promoter or afunctional variant thereof. In certain embodiments, the PGK promoter is a truncated human PGKpromoter or a functional variant thereof. By “truncated” it is meant that a portion at the 3’ and / or 5’ end of the PGK promoter has been removed (deleted) such that the nucleotide sequence of the truncated PGK promoter is shorter than the reference PGK promoter. The reference PGK promoter may be an endogenous, wildtype or naturally occurring PGK promoter or SEQ ID NO: 195 or nucleotides 1 to 531 of SEQ ID NO: 274. The truncated PGK promoter may, for example, comprise, consist essentially of or consist of the sequence of SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198 or SEQ ID NO: 199.The functional variant of the truncated PGK promoter may, for example, have at least about 70%sequence identity to a reference truncated PGK promoter. For example, the variant may have at leastabout 75% or at least about 80% or at least about 85% or at least about 90% or at least about 95% orat least about 96% or at least about 97% or at least about 98% or at least about 99% sequence identityto a reference truncated PGK promoter. The reference truncated PGK promoter may, for example, beSEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198 or SEQ ID NO: 199. In certain embodiments, the CAR is a human CAR. By “human CAR” it is meant that all domains of the CAR (e.g. hinge, transmembrane, co-stimulatory and / or signalling domains) are all derived from human proteins. The CAR may comprise an exodomain comprising an antigen recognition domain. The antigen recognition domain may comprise means for specifically binding a target antigen, The antigenrecognition domain may specifically bind to ENTPD3. The antigen recognition domain may comprisemeans for specifically binding to ENTPD3. The antigen recognition domain may be an antibody, an antibody fragment, or derived from an antibody. For example, the antigen recognition domain may be a single chain antibody (scFv). In certain embodiments, the antigen recognition domain comprises: i. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 7, 8 and 9 respectivelyand VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 10, 11 and 12 respectively; ii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 19, 20 and 21respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 22, 23 and 24 respectively; iii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 73, 74 and 75respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 76, 77 and 78 respectively; iv. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 25, 26 and 27respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 28, 29 and 30 respectively; v. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 37, 38 and 39respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 40, 41 and 42 respectively; vi. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 1, 2 and 3 respectivelyand VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 4, 5 and 6 respectively; vii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 13, 14 and 15respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 16, 17 and 18 respectively; viii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 31, 32 and 33respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 34, 35 and 36 respectively; ix. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 43, 44 and 45respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 46, 47 and 48 respectively; x. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 49, 50 and 51respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 52, 53 and 54 respectively; xi. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 55, 56 and 57respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 58, 59 and 60 respectively; xii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 61, 62 and 63respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 64, 65 and 66 respectively;xiii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 67, 68 and 69respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 70, 71 and 72 respectively; or xiv. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 79, 80 and 81respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 82, 83 and 84 respectively; wherein one or more of said CDR sequences of (i) to (xiv) may optionally comprise 1 to 3 amino acid modifications relative to an aforementioned CDR sequence, particularly wherein one or more of said CDR sequences may optionally be modified by substitution, addition or deletion of 1 to 3 amino acids. In certain embodiments, the antigen recognition domain comprises: i. a VH domain comprising the sequence set forth in SEQ ID NO: 87, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 88, or a sequence having at least 70% identity thereto; ii. a VH domain comprising the sequence set forth in SEQ ID NO: 91, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 92, or a sequence having at least 70% identity thereto; iii. a VH domain comprising the sequence set forth in SEQ ID NO: 109, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 110, or a sequence having at least 70% identity thereto; iv. a VH domain comprising the sequence set forth in SEQ ID NO: 93, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 94, or a sequence having at least 70% identity thereto; v. a VH domain comprising the sequence set forth in SEQ ID NO: 97, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 98, or a sequence having at least 70% identity thereto; vi. a VH domain comprising the sequence set forth in SEQ ID NO: 85, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 86, or a sequence having at least 70% identity thereto; vii. a VH domain comprising the sequence set forth in SEQ ID NO: 89, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 90, or a sequence having at least 70% identity thereto;viii. a VH domain comprising the sequence set forth in SEQ ID NO: 95, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 96, or a sequence having at least 70% identity thereto; ix. a VH domain comprising the sequence set forth in SEQ ID NO: 99, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 100, or a sequence having at least 70% identity thereto; x. a VH domain comprising the sequence set forth in SEQ ID NO: 101, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 102, or a sequence having at least 70% identity thereto; xi. a VH domain comprising the sequence set forth in SEQ ID NO: 103, or asequence having at least 70% sequence identity thereto, and a VL domaincomprising the sequence as set forth in SEQ ID NO: 104, or a sequence having at least 70% identity thereto; xii. a VH domain comprising the sequence set forth in SEQ ID NO: 105, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 106, or a sequence having at least 70% identity thereto; xiii. a VH domain comprising the sequence set forth in SEQ ID NO: 107, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 108, or a sequence having at least 70% identity thereto; or xiv. a VH domain comprising the sequence set forth in SEQ ID NO: 111, or asequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 112, or a sequence having at least 70% identity thereto. In certain embodiments, the antigen recognition domain comprises or consists of: i. the sequence set forth in SEQ ID NO: 114 or a sequence having at least 70%sequence identity thereto; ii. the sequence set forth in SEQ ID NO: 116 or a sequence having at least 70%sequence identity thereto; iii. the sequence set forth in SEQ ID NO: 125 or a sequence having at least 70%sequence identity thereto; iv. the sequence set forth in SEQ ID NO: 117 or a sequence having at least 70%sequence identity thereto; v. the sequence set forth in SEQ ID NO: 119 or a sequence having at least 70%sequence identity thereto;vi. the sequence set forth in SEQ ID NO: 113 or a sequence having at least 70%sequence identity thereto; vii. the sequence set forth in SEQ ID NO: 115 or a sequence having at least 70%sequence identity thereto; viii. the sequence set forth in SEQ ID NO: 118 or a sequence having at least 70%sequence identity thereto; ix. the sequence set forth in SEQ ID NO: 120 or a sequence having at least 70%sequence identity thereto; x. the sequence set forth in SEQ ID NO: 121 or a sequence having at least 70%sequence identity thereto; xi. the sequence set forth in SEQ ID NO: 122 or a sequence having at least 70%sequence identity thereto; xii. the sequence set forth in SEQ ID NO: 123 or a sequence having at least 70%sequence identity thereto; xiii. the sequence set forth in SEQ ID NO: 124 or a sequence having at least 70%sequence identity thereto; or xiv. the sequence set forth in SEQ ID NO: 126 or a sequence having at least 70%sequence identity thereto. In certain embodiments, the CAR comprises or consists of the sequence of any one of SEQ ID NOs:127 to 152 or a functional variant having at least 70% sequence identity thereto. For example, the CARmay comprise or consist of the sequence of SEQ ID NO: 128 or 130 or a functional variant having atleast 70% sequence identity thereto. In certain embodiments, the CAR may comprise: a. an exodomain comprising an antigen recognition domain;b. a transmembrane domain; andc. an endodomain comprising an intracellular signalling domain.In certain embodiments, the CAR further comprises a hinge domain and / or one or more co-stimulatory domains. In certain embodiments, the CAR comprises a CD8α or CH2CH3 hinge domain, a CD28, CD8α or CH2CH3 transmembrane domain, a CD28 co-stimulatory domain, and a CD3zeta signalling domain, wherein when the hinge domain is CD8α, the transmembrane domain is CD8α, and when the hinge domain is CH2CH3, the transmembrane domain is CD28 or CH2CH3. In certain embodiments, the FOXP3 polypeptide has the sequence of SEQ ID NO: 200, SEQ ID NO: 201, SEQ ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205 or a variant having at least70% identity thereto. In certain embodiments, the second nucleotide sequence encoding the FOXP3polypeptide has the sequence of SEQ ID NO: 206, SEQ ID NO: 207 or a sequence having at least 70%identity thereto.In certain embodiments, the expression construct comprises, consists essentially of or consists of thesequence of SEQ ID NO: 214 or a sequence having at least 70 % identity thereto. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter;(ii) a first nucleotide sequence encoding a CAR;(iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter;(ii) a first nucleotide sequence encoding a CAR, wherein the CAR has VH CDR1, 2 and 3sequences set forth in SEQ ID NOs: 7, 8 and 9 respectively and VL CDR1, 2 and 3sequences set forth in SEQ ID NOs: 10, 11 and 12 respectively, wherein one or moreof said CDR sequences may optionally comprise 1 to 3 amino acid modifications relative to an aforementioned CDR sequence; (iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter;(ii) a first nucleotide sequence encoding a CAR, wherein the CAR has VH CDR1, 2 and 3sequences set forth in SEQ ID NOs: 19, 20 and 21 respectively and VL CDR1, 2 and 3sequences set forth in SEQ ID NOs: 22, 23 and 24 respectively, wherein one or moreof said CDR sequences may optionally comprise 1 to 3 amino acid modifications relative to an aforementioned CDR sequence; (iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’:(i) a PGK promoter comprising or consisting of the sequence of SEQ ID NO: 195 or afunctional variant or functional fragment thereof, optionally having at least 70% identity thereto; (ii) a first nucleotide sequence encoding a CAR, wherein the CAR has VH CDR1, 2 and 3sequences set forth in SEQ ID NOs: 7, 8 and 9 respectively and VL CDR1, 2 and 3sequences set forth in SEQ ID NOs: 10, 11 and 12 respectively, wherein one or moreof said CDR sequences may optionally comprise 1 to 3 amino acid modifications relative to an aforementioned CDR sequence; (iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide comprising or consistingof the sequence of SEQ ID NO: 200 or a functional variant thereof, optionally having atleast 70% identity thereto; wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter comprising or consisting of the sequence of SEQ ID NO: 195 or afunctional variant or functional fragment thereof, optionally having at least 70% identity thereto; (ii) a first nucleotide sequence encoding a CAR, wherein the CAR has VH CDR1, 2 and 3sequences set forth in SEQ ID NOs: 19, 20 and 21 respectively and VL CDR1, 2 and 3sequences set forth in SEQ ID NOs: 22, 23 and 24 respectively, wherein one or moreof said CDR sequences may optionally comprise 1 to 3 amino acid modifications relative to an aforementioned CDR sequence; (iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide comprising or consistingof the sequence of SEQ ID NO: 200 or a functional variant thereof, optionally having atleast 70% identity thereto; wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence.In certain embodiments, the expression construct may comprise or consist of 5’ to 3’:(i) a PGK promoter comprising or consisting of the sequence of SEQ ID NO: 195 or afunctional variant or functional fragment thereof, optionally having at least 70% identity thereto; (ii) a first nucleotide sequence encoding a CAR encoding a CAR comprising or consistingof the sequence of SEQ ID NO: 128 or a functional variant or functional fragmentthereof, optionally having at least 70% identity thereto;(iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide comprising or consistingof the sequence of SEQ ID NO: 200 or a functional variant thereof, optionally having atleast 70% identity thereto; wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter comprising or consisting of the sequence of SEQ ID NO: 195 or afunctional variant or functional fragment thereof, optionally having at least 70% identity thereto; (ii) a first nucleotide sequence encoding a CAR comprising or consisting of the sequenceof SEQ ID NO: 130 or a functional variant or functional fragment thereof, optionally having at least 70% identity thereto; (iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide comprising or consistingof the sequence of SEQ ID NO: 200 or a functional variant thereof, optionally having atleast 70% identity thereto; wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter having the sequence of SEQ ID NO: 195;(ii) a first nucleotide sequence encoding a CAR having the sequence of SEQ ID NO: 128;(iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide having the sequence ofSEQ ID NO: 200; wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In certain embodiments, the expression construct may comprise or consist of 5’ to 3’: (i) a PGK promoter having the sequence of SEQ ID NO: 195;(ii) a first nucleotide sequence encoding a CAR having the sequence of SEQ ID NO: 130;(iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide having the sequenceof SEQ ID NO: 200; wherein the PGK promoter is operably linked to the first nucleotide sequence and second nucleotide sequence. In a second aspect, the invention provides a nucleic acid molecule comprising the expression construct of the first aspect of the invention, including any embodiment thereof. In certain embodiments, the nucleic acid molecule does not comprise any other coding nucleotide sequence. Alternatively put, the nucleic acid molecule does not comprise any other coding nucleotide sequence operably linked to the same PGK promoter present in the expression construct and does not comprise any other coding nucleotide sequence operably linked to a different promoter. In other words,the nucleic acid molecule defined herein may be bicistronic because it encodes two discrete proteins(the CAR and the FOXP3 polypeptide encoded by the first and second nucleotide sequences in theexpression construct). By “coding sequence” or “coding region” it is meant the nucleotide sequence that is translated and thus codes for a discrete protein.In a third aspect, the invention provides a vector comprising the expression construct of the first aspectof the invention and / or the nucleic acid molecule of the second aspect of the invention, including anyembodiment thereof. The vector may be a plasmid or a viral vector. For example, the vector may be alentiviral vector or a gamma-retroviral vector.In a fourth aspect, the invention provides a cell comprising the expression construct of the first aspectof the invention and / or the nucleic acid molecule of the second aspect of the invention and / or the vectorof the third aspect of the invention, including any embodiment thereof.The cell is thus an engineered cell, or alternatively viewed, a cell which has been modified to introduce the expression construct or the nucleic acid molecule or vector as defined herein. The cell recombinantlyexpresses the expression construct or the nucleic acid molecule. The cell may be a cell for productionof the polypeptide, or for production of the expression construct, nucleic acid molecule or vector, forexample for producing the vector. Accordingly, the cell may be a production host cell. Alternatively, thecell may be a cell intended for use in therapy, particularly ACT. Thus, the cell may be an immune cellor a progenitor or precursor thereof. Optionally, the cell may be a T cell, or a precursor thereof, or astem cell. In particular, the cell may be a Treg, or a precursor thereof, or an iPSC cell. In a specificembodiment, the invention provides a Treg comprising the expression construct, nucleic acid moleculeand / or vector as defined herein. The Treg expresses the CAR and FOXP3 polypeptide encoded by thefirst and second nucleotide sequences in the expression construct.The cell may be provided in a cell population, which forms a further aspect of the invention. In particular,the cell population may comprise a plurality of cells according to the invention, particularly a plurality of T cells (e.g. a plurality of Tregs) according to the invention.The invention also provides a pharmaceutical composition comprising the cell, cell population or vectoraccording to the invention. In another aspect, the invention provides a cell, cell population or pharmaceutical composition accordingto the invention for use in therapy (e.g., for use in induction of tolerance to a transplant, treating and / orpreventing graft-versus-host disease (GvHD), treating and / or preventing an infectious, allergic,autoimmune or inflammatory disease, or for use in inducing immunosuppression, or for use in promotingtissue repair and / or tissue regeneration). The therapy may be adoptive cell transfer therapy.Alternatively viewed, the invention provides a method for inducing tolerance to a transplant, treatingand / or preventing graft-versus-host disease (GvHD), treating and / or preventing an infectious, allergic,autoimmune or inflammatory disease, or for inducing immunosuppression, or for promoting tissue repairand / or tissue regeneration, wherein the method comprises administering a cell to a subject, particularlya Treg cell, a cell population, or a pharmaceutical composition, particularly comprising a Treg, according to the invention. In this respect, the method may comprise the following steps: (i) isolation or provision of a Treg-enriched cell sample from a subject;(ii) introduction into the Treg cells of an expression construct, nucleic acid molecule orvector of the invention; and (iii) administering the Treg cells from (ii) to the subject.The invention also provides use of a cell, cell population or pharmaceutical composition according to the invention in the manufacture of a medicament for inducing tolerance to a transplant, treating and / orpreventing graft-versus-host disease (GvHD), treating and / or preventing an infectious, allergic,autoimmune or inflammatory disease, or for inducing immunosuppression, or for promoting tissue repair and / or tissue regeneration in a subject, particularly wherein the cell is a Treg cell. The autoimmune or inflammatory disease may particularly be type 1 diabetes (T1D). In another aspect, the invention provides a method of making a cell according to the invention, whichcomprises the step of introducing into the cell (e.g., transducing or transfecting a cell with) theexpression construct, nucleic acid molecule or vector according to the invention. The cell may be a Treg cell, and the method may comprise isolating or providing a cell-containing sample comprising Tregs, and / or enriching Tregs or generating Tregs from the cell-containing sample prior to or after the step of introducing the expression construct, nucleic acid molecule or vector into the cell. The invention also provides a cell obtainable by this method, which forms a further aspect of the invention. BRIEF DESCRIPTION OF THE FIGURESFigure 1 shows the expression constructs tested in Examples 1, 2, 3 and 5.Figure 2 shows the % of Tregs expressing the CAR (top plot) and MFI of the CAR in CAR+ cells (bottomplot) following transduction with either the SFFV-CAR-FOXP3 construct or PGK-CAR-FOXP3 construct.Figure 3 shows the % of Tregs expressing FOXP3 (top plot) and MFI of FOXP3 in CD4+ cells (bottomplot) following transduction with either the SFFV-CAR-FOXP3 construct or PGK-CAR-FOXP3 construct.Figure 4 shows % of transduced (CAR+) Tregs expressing the activation marker CD69 followingtransduction with either the SFFV-CAR-FOXP3 construct or PGK-CAR-FOXP3 construct and exposureto antigen (ENTPD3+ HEK, RT4 cells at 10:1, 5:1 and 1:1 and 5, 2, 1 or 0.5 ug / mL of ENTPD3 peptide).As a negative control, cells were exposed to media only (unstimulated) or WT HEK cells. As a positivecontrol, cells were exposed to anti-CD3 / CD28 beads.Figure 5 shows Treg proliferation (indicated by fold change) following transduction with either the SFFV-CAR-FOXP3 construct or PGK-CAR-FOXP3 construct and exposure to antigen (ENTPD3+ HEK, RT4cells at 10:1, 5:1 or 1:1 and 5, 2 or 1 ug / mL of ENTPD3 peptide). As a negative control, cells wereexposed to media only (unstimulated) or WT HEK cells. As a positive control, cells were exposed to anti-CD3 / CD28 beads. Figure 6 shows Teff suppression by Tregs transduced with either the SFFV-CAR-FOXP3 construct (topplot) or PGK-CAR-FOXP3 construct (middle plot) or untransduced (mock) Tregs (bottom plot) followingactivation by CD3 / CD28 beads and / or B cells expressing antigen. As a negative control, cells wereexposed to media only (unstimulated) or exposed to WT (ENTPD3-) B cells.Figure 7 shows IL-2 production by Teffs transduced with either the SFFV-CAR-FOXP3 construct orPGK-CAR-FOXP3 construct or by a construct comprising only SFFV-CAR without FOXP3. The flowcytometry results are shown in the top plot and the supernatant analysis is shown in the bottom plot.Figure 8 shows expansion fold of cells transduced with the PGK-CAR-FOXP3 construct and cells transduced with the SFFV-CAR-FOXP3 construct across the different donors. Figure 9 shows the phenotype analysis of cells transduced with the PGK-CAR-FOXP3 construct and cells transduced with the SFFV-CAR-FOXP3 construct. Figure 10 shows % of transduced (CAR+) Tregs expressing the activation markers CD69, CD137 andGARP following transduction with either the SFFV-CAR-FOXP3 construct or PGK-CAR-FOXP3construct and exposure to antigen (ENTPD3+ HEK cells or EndoC-βH5 cells). As a negative control, cells were exposed to media only (no stim) or WT HEK cells. As a positive control, cells were exposed to anti-CD3 / CD28 beads.Figure 11 shows CD4 and CD8 suppression by Tregs transduced with PGK-CAR-FOXP3 construct (lefthand plots) or SFFV-CAR-FOXP3 construct (middle plots) or untransduced (mock) Tregs (right handplots) following activation by CD3 / CD28 beads and / or B cells expressing antigen. As a negative control, cells were exposed to WT (ENTPD3-) B cells.Figure 12 shows the difference in area under the under (ΔAUC) for CD4 and CD8 suppression shownin Figure 10 (ΔAUC = % suppression when exposed to ENTPD3+ B cells minus % suppression whenexposed to WT B cells).Figure 13 shows depletion of CD80 and CD86 following Treg exposure to either WT B cells or B cellsexpressing ENTPD3. CD80 and CD86 expression in the Treg conditions were normalized to the B cellalone control. % suppression of CD80 and CD86 was plotted and area under the curve calculated. Figure 14 shows the expression constructs tested in Example 4.Figure 15 shows % of transduced (CAR+) Tregs expressing the activation markers CD69, CD137 andGARP following transduction with the constructs shown in Figure 14 and exposure to antigen (peptideof antigen-expressing HEK293 cells). As a negative control, cells were exposed to media only (no stim) or WT HEK cells. As a positive control, cells were exposed to anti-CD3 / CD28 beads. Figure 16 shows Treg proliferation (indicated by fold change) following transduction with the constructs shown in Figure 14 and exposure to antigen-expressing B cells. As a negative control, cells wereexposed to media only (no stim) or WT B cells. As a positive control, cells were exposed to anti-CD3 / CD28 beads. Figure 17 shows Teff suppression by Tregs transduced with either the constructs shown in Figure 14 following activation by CD3 / CD28 beads or B cells expressing antigen. As a negative control, cells were exposed to exposed to WT B cells.Figure 18 shows fold change of CAR+ cells following the survival assay performed in Example 4.Figure 19 shows representative immunofluorescence images of human islet microtissues (hIsMTs) stained for DAPI, NKX6.1, and insulin following 3 days of treatment. Conditions include exposure to a pro-inflammatory cytokine cocktail (CC), co-culture with effector T cells (Teff) and irradiated B cells, orco-culture with Teff cells, irradiated B cells, and Treg cells (1:16 - 1:2 ratios). All images were acquiredusing identical exposure settings to enable direct comparison. Scale bar, 50 μm. Figure 20 shows NKX6.1 and Insulin expression in hIsMTs. Data represent mean ± SEM from one donor, with n = 6-11 technical replicates per condition. Outliers were identified and excluded using the ROUT test (Q = 5%). Statistical analysis was performed using one-way ANOVA followed by Dunnett’s multiple comparisons test, comparing each Treg condition to its corresponding Teff control (denoted by black asterisks). Unpaired t-tests were used to compare the hIsMT group with (1) hIsMT + Cytokine Cocktail (CC) group and (2) the Teff control condition (denoted by red asterisks). *p < 0.05, **p < 0.01, ***p < 0.001. Figure 21 shows the expression constructs tested in Example 1A and 1B. Figure 22 shows % expression of the CAR, CACR and FOXP3 transgenes in SupT1 cells at various vector dilutions.Figure 23 shows % expression of the CAR, CACR and FOXP3 transgenes in SupT1 cells at no vectordilution. DETAILED DESCRIPTIONThe present invention provides an expression construct which encodes polypeptides useful forexpression in cells for ACT, specifically in the context of modifying a cell to express a CAR and a FOXP3polypeptide. The expression constructs are particularly suitable for modifying T cells, particularly Tregs.The present invention provides an expression comprising a PGK promoter operably linked to:(i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the first nucleotide sequence is located upstream of the second nucleotide sequence.A nucleotide sequence that is closer to the 5’ end of a nucleic acid as compared to a second nucleotidesequence is referred to as “upstream”. Therefore, in other words, the present invention provides anexpression construct comprising 5’ to 3’:a PGK promoter operably linked to; (i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide.The first and second nucleotide sequences are operably linked to the same PGK promoter. By “operably linked to the same promoter” it is meant that there is a functional linkage between the PGK promoter and both the first and second nucleotide sequence that results in expression of the first and second nucleotide sequences. In other words, transcription of the first and second nucleotide sequences is initiated from the same PGK promoter and that the nucleotide sequences are positioned and oriented for transcription to be initiated from the promoter. Polynucleotides operably linked to a promoter areunder transcriptional regulation of that promoter. The expression construct thus enables expression ofthe CAR and FOXP3 polypeptide. As used herein, the term “expression construct” refers to a nucleotidesequence in which the coding sequences are operably linked / under the control of the same promoter. The expression construct described herein may be comprised within a nucleic acid molecule. In other words, there is also provided herein a nucleic acid molecule comprising an expression construct asdescribed herein. The term “expression construct” refers to the PGK promoter and any nucleotidesequences operably linked to / under the control of the PGK promoter (e.g. the nucleic acid sequencestarting with the PGK promoter and ending with the sequence encoding the FOXP3 polypeptide).Therefore, there is also provided herein a nucleic acid molecule comprising a PGK promoter operably linked to: (i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the first nucleotide sequence is located upstream of the second nucleotide sequence.Alternatively viewed, there is also provided herein a nucleic acid molecule comprising 5’ to 3’:a PGK promoter operably linked to; (i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide.In certain embodiments, the expression construct does not comprise any other coding nucleotide sequence or, alternatively put, does not comprise any other coding nucleotide sequence operably linked to the same PGK promoter. In other words, the expression construct defined herein may be bicistronic because it encodes two discrete proteins (the CAR and the FOXP3 polypeptide encoded by the first and second nucleotide sequences). By “coding sequence” or “coding region” it is meant the nucleotide sequence that is translated and thus codes for a discrete protein. In certain embodiments, the nucleic acid molecule does not comprise any other coding nucleotide sequence. Alternatively put, the nucleic acid molecule does not comprise any other coding nucleotide sequence operably linked to the same PGK promoter present in the expression construct and does not comprise any other coding nucleotide sequence operably linked to a different promoter. In other words, the nucleic acid molecule defined herein may be bicistronic because it encodes two discrete proteins (the CAR and the FOXP3 polypeptide encoded by the first and second nucleotide sequences in the expression construct). By “coding sequence” or “coding region” it is meant the nucleotide sequence that is translated and thus codes for a discrete protein. In certain embodiments, the nucleic acid molecule or expression construct may comprise one or morefurther coding nucleotide sequences. For example, the nucleic acid molecule or expression constructmay comprise three or more coding sequence (including the first and second nucleotide sequencesencoding the CAR and FOXP3 polypeptide). For example, the nucleic acid molecule or expressionconstruct may be tricistronic (encodes three discrete proteins).Thus, in certain embodiments the expression construct may comprise one or more further codingnucleotide sequences operably linked to the PGK promoter. In certain embodiments, the nucleic acidmolecule may comprise one or more further coding nucleotide sequences, which may be operably linked to one or more further promoters (i.e. in addition to the PGK promoter in the expression construct of the invention). The nucleic acid molecule may therefore comprise an expression construct of the invention and at least a second promoter operably linked to one or more coding sequences. The one or more further promoters may be any promoter capable of initiating transcription of the one or more further coding nucleotide sequences, e.g., a mammalian promoter such as PGK or EF1α (short or long versions). Where the nucleic acid molecule comprises one or more further coding nucleotide sequences, the expression construct may or may not comprise any further coding sequences. The polypeptides may be produced in a cell as individual components, i.e., as discrete entities. Thus, the CAR and FOXP3 polypeptides may be separately located, in or on the cell, as separate and distinct,or discrete, functional polypeptides. Thus, although the polypeptides are encoded by a single nucleicacid molecule or expression construct, through “cleavage” during or after translation, they may beexpressed or produced as separate polypeptides, and thus at the end of the protein production processin the cell, they may be present in the cell as separate entities, or separate polypeptide chains. By“discrete” or “separate” polypeptides, it is meant that the polypeptides are not linked to one another and are physically distinct. In other words they are expressed or produced as separate entities. Indeed, following expression, they are located in different, or separate cellular locations. The CAR and FOXP3 polypeptide are thus ultimately expressed as single and separate components. The CAR is expressedas a cell surface molecule. The FOXP3 is expressed inside the cell, where it can exert its effect as atranscription factor to regulate cell development and / or activity, as described further below.This may be achieved by the presence of or by encoding cleavage sequences in the expressionconstruct, in particular self-cleaving sequences, in between the nucleotide sequences encoding thediscrete polypeptides, particularly between the first nucleotide sequence and second nucleotidesequence of the expression construct of the invention. For example, 2A or 2A-like peptides may beused as the self-cleaving sequences. Although described as “self-cleaving”, such peptides are believed to function by allowing ribosome skipping such that a peptide bond is not formed (skipped) at the C- terminus of the 2A sequence, leading to separation of the 2A sequence and the next polypeptide downstream of it. The term “cleavage” as used herein thus includes the skipping of peptide bond formation. 2A and 2A-like peptides are known and described in the art, for example in Donnelly et al., Journal ofGeneral Virology, 2001, 82, 1027-1041, herein incorporated by reference. As noted above, 2A and 2A-like peptides are believed to cause ribosome skipping, and result in a form of cleavage in which a ribosome skips the formation of a peptide bond between the end of a 2A peptide and the downstream amino acid sequence. The “cleavage” occurs between the Glycine and Proline residues at the C- terminus of the 2A peptide meaning the upstream cistron will have a few additional residues added tothe end, while the downstream cistron will start with the Proline. For avoidance of doubt, the self-cleaving sequences such as the 2A sequences disclosed herein are not considered to be discreteproteins encoded by the expression construct or nucleic acid molecule. Constructs comprising only a first nucleotide sequence encoding a CAR separated from a second nucleotide sequence encoding a FOXP3 polypeptide by a 2A sequence is thus bicistronic. Suitable self-cleaving domains include P2A, T2A, E2A and F2A sequences as shown in SEQ ID NOs:208 to 211 respectively. The sequences may be modified to include the amino acids GSG at the N-terminus of the 2A peptides. Thus, also included as possible options are the sequences corresponding to SEQ ID NOs: 208 to 211, but with GSG at the N termini thereof. Such modified alternative 2A sequences are known and reported in the art. Alternative 2A-like sequences which may be used are shown in Donnelly et al (supra), for example a TaV sequence. In certain embodiments, a nucleotide sequence encoding the T2A self-cleaving sequence is positioned between the first and secondnucleotide sequences in the expression construct described herein.The self-cleaving sequence may include an additional cleavage site, which may be cleaved by common enzymes present in the cell. This may assist in achieving complete removal of the 2A sequences aftertranslation. Such an additional cleavage site may for example comprising a Furin cleavage site RXXR(SEQ ID NO: 212), for example RRKR (SEQ ID NO: 213)Alternatively or additionally, an internal ribosome entry site (IRES) may be present between or encodedby a nucleotide sequence positioned between the first nucleotide sequence and second nucleotidesequence.Where the expression construct includes three or more coding sequences (three or more sequencesencoding and resulting in translation of discrete proteins), a self-cleaving sequence may be encoded between each coding sequence (e.g. between the first and second nucleotide sequence and between the second and third coding sequence). The self-cleaving sequences may be the same or different. For example, they may both be 2A or 2A-like sequence, in particular P2A and / or T2A sequences.In an embodiment, the expression construct may comprise or consist of 5’ to 3’:(i) a PGK promoter;(ii) a first nucleotide sequence encoding a CAR;(iii) a nucleotide sequence encoding a self-cleavage sequence (e.g. a 2A sequence suchas P2A, T2A, E2A or F2A); and (iv) a second nucleotide sequence encoding a FOXP3 polypeptide; wherein the PGK promoter is operably linked to the first nucleotide sequence and secondnucleotide sequence. The PGK promoter, CAR and FOXP3 polypeptide may comprise, consistessentially of or consist of any of the sequences described herein or functional variants or functional fragments thereof, for example having at least 70%, 80%, 90%, 95% or 98% identity thereto. Nucleic acid molecules and polynucleotides / nucleotides / nucleic acid sequences as defined herein may comprise DNA or RNA. They may be single-stranded or double-stranded. It will be understood by a skilled person that numerous different nucleic acid molecules / polynucleotides can encode the same polypeptide as a result of the degeneracy of the genetic code. In addition, it is to be understood that the skilled person may, using routine techniques, make nucleotide substitutions that do not affect the polypeptide sequence encoded by the nucleic acid molecules / polynucleotides / nucleotide sequences as defined herein to reflect the codon usage of any particular host organism in which the polypeptides of the invention are to be expressed. The nucleic acid molecules / polynucleotides / nucleotides may be modified by any method available in the art. Such modifications may be carried out in order to enhance the in vivo activity or lifespan of the nucleic acid molecules / polynucleotides as defined herein. Expression constructs / nucleic acid molecules / polynucleotides / nucleotide sequences such as DNA nucleic acid molecules / polynucleotides / sequences may be produced recombinantly, synthetically or by any means available to those of skill in the art. They may also be cloned by standard techniques. Longer nucleic acid molecules / polynucleotides / nucleotide sequences will generally be produced using recombinant means, for example using polymerase chain reaction (PCR) cloning techniques. This will involve making a pair of primers (e.g. of about 15 to 30 nucleotides) flanking the target sequence which it is desired to clone, bringing the primers into contact with mRNA or cDNA obtained from an animal or human cell, performing a polymerase chain reaction under conditions which bring about amplification of the desired region, isolating the amplified fragment (e.g. by purifying the reaction mixture with an agarose gel) and recovering the amplified DNA. The primers may be designed to contain suitablerestriction enzyme recognition sites so that the amplified DNA can be cloned into a suitable vector.The expression construct / nucleic acid molecule / polynucleotides / nucleotides used in the present invention may be codon-optimised. Codon optimisation has previously been described in WO1999 / 41397 and WO2001 / 79518. Different cells differ in their usage of particular codons. This codon bias corresponds to a bias in the relative abundance of particular tRNAs in the cell type. By altering the codons in the sequence so that they are tailored to match with the relative abundance of corresponding tRNAs, it is possible to increase expression. By the same token, it is possible to decrease expression by deliberately choosing codons for which the corresponding tRNAs are known to be rare in the particular cell type. Thus, an additional degree of translational control is available.As is clear from the above description, in addition to the specific polypeptide and nucleotide sequencesmentioned herein, also encompassed is the use of variants, or derivatives and fragments thereof.In certain embodiments, the expression construct comprises, consists essentially of or consists of thesequence of SEQ ID NO: 214 or a sequence having at least 70% identity thereto. For example, theexpression construct may comprise, consist essentially of or consist of the sequence of SEQ ID NO:214 or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identity thereto. The sequence having at least 70% identity thereto (e.g. at least 75, 80, 85, 90, 95, 96, 97.98 or 99% identity thereto) is a functional variant in that it is able to drive the expression of a functional CAR and functional FOXP3 polypeptide as described herein.The term “derived from” as used herein, in relation to nucleotide or polypeptide sequences means thatthe sequence is the same as the reference nucleotide or polypeptide sequence or includes one or morevariations (e.g. substitutions, insertions, deletions, truncations) compared to the reference nucleotide or polypeptide sequence, provided that the resultant nucleotide or polypeptide sequence retains thedesired function as described below. The reference nucleotide or polypeptide sequence may be anaturally-occurring, endogenous or wildtype sequence.The term “derivative” or “variant” as used interchangeably herein, in relation to promoters, proteins orpolypeptides or nucleic acids of the present invention includes any substitution of, variation of,modification of, replacement of, deletion of and / or addition of one (or more) amino acid residues ornucleotides from or to the sequence providing that the resultant protein or polypeptide or nucleic acidsequence retains the desired function (for example, where the derivative or variant is an antigen bindingdomain, the desired function may be the ability of the antigen binding domain to bind its target antigen (for example, a variant of an antigen binding domain which binds to ENTPD3 retains the ability to bind ENTPD3), where the derivative or variant is a signalling domain, the desired function may be the ability of that domain to signal (e.g. activate or inactivate a downstream molecule), where the derivative or variant is a transcription factor (e.g. FOXP3), the desired function may be the ability of the transcription factor to bind to target DNA and / or to induce transcription, or where the derivative or variant is a PGKpromoter, the desired function may be the ability to initiate transcription or the expression level obtained(e.g. mRNA or protein) of the genes to which it is operably linked. Alternatively viewed, the variants or derivatives referred to herein are functional variants or derivatives. For example, variant or derivative may have at least at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% function compared to the corresponding, reference sequence. The variant or derivative may have a similar or the same level of function as compared to the corresponding reference sequence or may have an increased level of function (e.g. increased by at least 10%, at least 20%, at least 30%, at least 40% or at least 50%). Typically, amino acid substitutions may be made, for example from 1, 2 or 3 to 10 or 20 substitutions provided that the modified sequence retains the required activity or ability. Amino acid substitutions may include the use of non-naturally occurring analogues. For example, the variant or derivative may have at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% activity or ability compared to the corresponding, reference sequence. The variant or derivative may have a similar or the same level of activity or ability as compared to the corresponding, reference sequence or may have an increased level of activity or ability (e.g., increasedby at least 10%, at least 20%, at least 30%, at least 40% or at least 50%).Proteins or peptides may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent protein. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and / or the amphipathic nature of the residues as long as the endogenous function is retained. For example, negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include asparagine, glutamine, serine, threonine and tyrosine. Conservative substitutions may be made, for example according to Table 1 below. Table 1 Nucleic acid molecules may also have deletions, insertions or substitutions of nucleotides. Where the nucleotide sequence is a coding sequence, deletions, insertion or substitutions of nucleotides may result in a silent change in that the amino acid encoded by the nucleotide sequence does not change due to the degeneracy of the genetic code. Coding and non-coding regions of a nucleic acid moleculemay have deletion, insertion or substitution of nucleotides compared to a reference sequence. Thevariant or derivative nucleic acid molecule may retain at least 10%, at least 20%, at least 30%, at least40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of its function compared tothe corresponding, reference sequence. The variant or derivative may have a similar or the same levelof function as compared to the corresponding, reference sequence or may have an increased level offunction (e.g., increased by at least 10%, at least 20%, at least 30%, at least 40% or at least 50%). Forexample, the function of a promoter sequence may be to initiate transcription and result in expressionof transgene so transduction efficiency (e.g. % transduced cells or MFI) may be used to determine thelevel of function of a variant promoter sequence. The derivative may be a homologue. The term “homologue” as used herein means an entity having a certain homology with the wild type amino acid sequence and the wild type nucleotide sequence. The term “homology” can be equated with “identity”.A homologous or variant sequence may include an amino acid or nucleotide sequence which may beat least 70%, 75%, 85% or 90% identical, optionally at least 95%, 96%, 97%, 98% or 99% identical to the subject sequence. Typically, the variants will comprise the same active sites etc. as the subject sequence. Although homology can also be considered in terms of similarity (e.g., amino acid residues having similar chemical properties / functions), in the context herein homology may be expressed in terms of sequence identity. Homology comparisons can be conducted by eye or, more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percentage homology or identity between two or more sequences.Percentage homology or sequence identity may be calculated over contiguous sequences, i.e., onesequence is aligned with the other sequence and each amino acid or nucleotide in one sequence isdirectly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an “ungapped” alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues. Although this is a very simple and consistent method, it fails to take into consideration that, for example,in an otherwise identical pair of sequences, one insertion or deletion in the nucleotide sequence maycause the following codons to be put out of alignment, thus potentially resulting in a large reduction in percent homology when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without penalising unduly the overall homology score. This is achieved by inserting “gaps” in the sequence alignment to try to maximise local homology. However, these more complex methods assign “gap penalties” to each gap that occurs in the alignmentso that, for the same number of identical amino acids or nucleotides, a sequence alignment with as fewgaps as possible, reflecting higher relatedness between the two compared sequences, will achieve a higher score than one with many gaps. “Affine gap costs” are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties will of course produce optimised alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, the default values may be used when using such software for sequence comparisons. For example, when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is -12 for a gap and -4 for each extension. Calculation of maximum percentage homology / sequence identity therefore firstly requires the production of an optimal alignment, taking into consideration gap penalties. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A.; Devereux et al. (1984) Nucleic Acids Res.12: 387). Examples of other software that can perform sequence comparisons include, but are not limited to, the BLAST package (seeAusubel et al. (1999) ibid – Ch. 18), FASTA (Atschul et al. (1990) J. Mol. Biol. 403-410) and theGENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al. (1999) ibid, pages 7-58 to 7-60). However, for some applications, the GCG Bestfit program may be used. Another tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol. Lett. (1999) 174: 247-50; FEMS Microbiol. Lett. (1999) 177: 187-8). Although the final percentage homology can be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity orevolutionary distance. An example of such a matrix commonly used is the BLOSUM62 matrix – thedefault matrix for the BLAST suite of programs. GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see the user manual for further details). For some applications, the public default values for the GCG package may be used, or in the case of other software, the default matrix, such as BLOSUM62. Suitably, the percentage identity is determined across the entirety of the reference and / or the query sequence.Once the software has produced an optimal alignment, it is possible to calculate percentage homology,optionally percentage sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result. “Fragment” typically refers to a selected region of the polypeptide or polynucleotide that is of interest functionally, e.g. is functional or encodes a functional fragment. “Fragment” thus refers to an amino acid or nucleic acid sequence that is a portion (or part) of a full-length polypeptide or polynucleotide. Such variants, derivatives and fragments may be prepared using standard recombinant DNA techniques such as site-directed mutagenesis. Where insertions are to be made, synthetic DNA encoding the insertion together with 5' and 3' flanking regions corresponding to the naturally-occurring sequence either side of the insertion site may be made. The flanking regions will contain convenient restriction sites corresponding to sites in the naturally-occurring sequence so that the sequence may be cut with the appropriate enzyme(s) and the synthetic DNA ligated into the cut. The DNA is then expressed in accordance with the invention to make the encoded protein. These methods are only illustrative of the numerous standard techniques known in the art for manipulation of DNA sequences and other known techniques may also be used. PGK PromoterA “promoter” is a region of DNA where or which defines where transcription of a coding nucleotidesequence or gene is initiated. Promoters are typically located immediately upstream of (or 5’ to) a codingnucleotide sequence or gene position and may control expression of the nucleotide sequence or gene,e.g. by providing a site for the binding of proteins necessary for transcription.The present disclosure provides nucleic acid molecules and / or expression constructs comprising a PGK promoter operably linked to a first nucleotide sequence encoding a CAR and a second nucleotide sequence encoding a FOXP3 polypeptide. By “operably linked to the same promoter” it is meant that there is a functional linkage between the PGK promoter and both the first and second nucleotide sequence that results in expression of the first and second nucleotide sequences. In other words, transcription of the first and second nucleotide sequences is initiated from the same PGK promoter and that the nucleotide sequences are positioned and oriented for transcription to be initiated from the promoter. Polynucleotides operably linked to a promoter are under transcriptional regulation of that promoter.The expression constructs and nucleic acid molecules described herein comprise a phosphoglyceratekinase 1 (PGK) promoter. As used herein, the term “PGK promoter” refers to a promoter that is or isderived from an endogenous promoter operably linked to an endogenous PGK gene in an unmodifiedor non-engineered cell. Alternatively viewed, the PGK promoter as used herein is derived from anendogenous, wildtype or naturally occurring PGK promoter. An endogenous, wildtype or naturallyoccurring PGK promoter is capable initiating transcription of an endogenous, naturally occurring orwildtype PGK gene. The PGK gene may be the human PGK gene. The PGK promoter as referred toherein may comprise, consist essentially of or consist of an identical sequence to an endogenous,wildtype or naturally occurring PGK promoter or may be a functional variant or functional fragment thereof. By “functional variant” it is meant any variant that is able to function as a promoter (i.e., initiate transcription and result in expression of the transgene(s) to which it is operably linked). Variants therefore include PGK promoters that include one or more nucleotide truncations, deletions,substitutions or insertions. The variant may retain at least 10%, at least 20%, at least 30%, at least40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of its function compared to the corresponding, reference sequence (e.g. an endogenous, wildtype or naturally occurring PGKpromoter or SEQ ID NO: 195 or nucleotides 1 to 531 of SEQ ID NO: 274). The variant or derivative mayhave a similar or the same level of function as compared to the corresponding, reference sequence (anendogenous, wildtype or naturally occurring PGK promoter or SEQ ID NO: 195 or nucleotides 1 to 531of SEQ ID NO: 274) or may have an increased level of function (e.g., increased by at least 10%, at least20%, at least 30%, at least 40% or at least 50%). For example, the function of a promoter sequencemay be to initiate transcription and result in expression of transgene so transduction efficiency (e.g. % transduced cells or MFI) may be used to determine the level of function of a variant promoter sequence. By “functional fragment” it is meant a fragment of a reference PGK promoter (e.g. a fragment of anendogenous, wildtype or naturally occurring PGK promoter or a fragment of SEQ ID NO: 195 or afragment of nucleotides 1 to 531 of SEQ ID NO: 274) which is able to function as a promoter (i.e. initiate transcription and result in expression of the transgene to which it is operably linked). A functional fragment may further comprise one or more nucleotide deletions, substitutions or insertions.The functional variant may, for example, have at least about 70% sequence identity to an endogenous,wildtype or naturally occurring PGK promoter. For example, the functional variant may have at least about 75% or at least about 80% or at least about 85% or at least about 90% or at least about 91% or at least about 92% or at least about 93% or at least about 94% or at least about 95% or at least about 96% or at least about 97% or at least about 98% or at least about 99% sequence identity to an endogenous, wildtype or naturally occurring PGK promoter. A functional fragment may have at least 20% sequence identity to an endogenous, wildtype or naturally occurring PGK promoter. For example, the functional fragment may have at least about 30% or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%,or at least about 85%, or at least about 90%, or at least about 95%, or at least about 96%, or at leastabout 97%, or at least about 98%, or at least about 99% sequence identity to an endogenous, wildtype or naturally occurring PGK promoter. As discussed above, a functional fragment may further compriseone or more nucleotide deletions, substitutions or insertions, as compared to an endogenous, wildtypeor naturally occurring PGK promoter, however, the nucleotide sequence of the fragment should have at least 70% (e.g. at least 75, 80, 90, 95, 96, 97, 98 or 99%) sequence identity to its corresponding endogenous, wildtype or naturally occurring PGK promoter fragment. The sequence of human phosphoglycerate kinase 1 (PGK) gene is disclosed as GenBank accession no. AH002937.2 (SEQ ID NO: 274). The coding sequence (CDS) is highlighted in SEQ ID NO: 274 and starts at nucleotide 532.The PGK promoter may therefore comprise, consist essentially of or consist of the sequence ofnucleotides 1 to 531 of SEQ ID NO: 274 or a functional variant or a functional fragment thereof. Thefunctional variant thereof may, for example, have at least about 70% sequence identity to nucleotides 1 to 531 of SEQ ID NO: 274. For example, the functional variant may have at least about 75% or at least about 80% or at least about 85% or at least about 90% or at least about 95% or at least about 96% or at least about 97% or at least about 98% or at least about 99% sequence identity to nucleotides1 to 531 of SEQ ID NO: 274. The functional fragment thereof may, for example, have at least about20% or at least about 30% or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 85%, or at least about 90%, or at least about95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99%sequence identity to nucleotides 1 to 531 of SEQ ID NO: 274. As discussed above, a functional fragmentmay further comprise one or more nucleotide deletions, substitutions or insertions, as compared tonucleotides 1 to 531 of SEQ ID NO: 274, however, the nucleotide sequence of the fragment should have at least 70% (e.g. at least 75, 80, 90, 95, 96, 97, 98 or 99%) sequence identity to its corresponding fragment of SEQ ID NO: 274. The PGK promoter may, for example, comprise, consist essentially of or consist of the sequence of SEQ ID NO: 195 or a functional variant or functional fragment thereof. The functional variant may, for example, have at least about 70% sequence identity to SEQ ID NO: 195. For example, the functional variant may have at least about 75% or at least about 80% or at least about 85% or at least about 90% or at least about 95% or at least about 96% or at least about 97% or at least about 98% or at least about 99% sequence identity to SEQ ID NO: 195. A functional fragment may have at least 20% sequence identity to SEQ ID NO: 195. For example, the functional fragment may have at least about 30% or at least about 40%, or at least about 50%, or atleast about 60%, or at least about 70%, or at least about 80%, or at least about 85%, or at least about90%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or atleast about 99% sequence identity to SEQ ID NO: 195. As discussed above, a functional fragment mayfurther comprise one or more nucleotide deletions, substitutions or insertions, as compared to SEQ IDNO: 195, however, the nucleotide sequence of the fragment should have at least 70% (e.g. at least 75, 80, 90, 95, 96, 97, 98 or 99%) sequence identity to its corresponding fragment of SEQ ID NO: 195.Alternatively viewed, a functional fragment may be referred to as a truncated PGK promoter. In certainembodiments, the PGK promoter comprises, consists essentially of or consists of a truncated PGKpromoter or a functional variant thereof. In certain embodiments, the PGK promoter is a truncatedhuman PGK promoter or a functional variant thereof. By “truncated” it is meant that a portion at the 3’ and / or 5’ end of the PGK promoter has been removed (deleted) such that the nucleotide sequence ofthe truncated PGK promoter is shorter than the reference PGK promoter. The reference PGK promotermay, for example, be an endogenous, wildtype or naturally occurring PGK promoter, nucleotides 1 to531 of SEQ ID NO: 274 and / or the sequence of SEQ ID NO: 195. Exemplary truncated PGK promoters are disclosed in WO 2016 / 115482, the contents of which are incorporated herein by reference. In certain embodiments, at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350,400 nucleotides are removed from the 5’ end of an endogenous, wildtype or naturally occurring PGKpromoter or from the 5’ end of SEQ ID NO: 274 or from the 5’ end of SEQ ID NO: 195. For example,from about 5 to about 450 or from about 10 to about 450 or from about 50 to about 450 or from about100 to about 450 nucleotides may be removed from the 5’ end of an endogenous, wildtype or naturallyoccurring PGK promoter or from the 5’ end of SEQ ID NO: 274 or from the 5’ end of SEQ ID NO: 195. For example, from about 5 to about 400 or from about 10 to about 350 or from about 50 to about 300 or from about 100 to about 250 nucleotides are removed from the 5’ end of an endogenous, wildtype or naturally occurring PGK promoter or from the 5’ end of SEQ ID NO: 274 or from the 5’ end of SEQ ID NO: 195. The truncated PGK promoter may, for example, comprise, consist essentially of or consist of the sequence of SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198 or SEQ ID NO: 199.The variant of the truncated PGK promoter may, for example, have at least about 70% sequence identityto a reference truncated PGK promoter. For example, the variant may have at least about 75% or at least about 80% or at least about 85% or at least about 90% or at least about 95% or at least about 96% or at least about 97% or at least about 98% or at least about 99% sequence identity to a referencetruncated PGK promoter. The reference truncated PGK promoter may, for example, comprise, consistessentially of or consist of the sequence of SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198 or SEQ ID NO: 199. CAR A “chimeric antigen receptor", "CAR" or “CAR construct” refers to engineered receptors which can confer an antigen specificity onto cells (e.g., immune cells, such as Tregs). In particular, a CAR enables a cell to bind specifically to a particular antigen, e.g., a target molecule such as a target protein, whereupon a signal is generated by the endodomain (comprising an intracellular signalling domain) of the CAR, e.g., a signal resulting in activation of the cell. CARs are also known as artificial T-cell receptors, chimeric T-cell receptors or chimeric immunoreceptors. The structure of CARs is well-known in the art and several generations of CARs have been produced. For instance, as a minimum a CAR may contain an extracellular antigen-specific targeting region, antigen binding domain, target binding domain or ligand binding domain, which is or forms part of the exodomain (also known as the extracellular domain or ectodomain) of the CAR, a transmembrane domain, and an intracellular signalling domain (which is, or is comprised within, an endodomain). However, the CAR may contain further domains to improve its functionality, e.g., one or more co- stimulatory domains to improve T cell proliferation, cytokine secretion, resistance to apoptosis, and invivo persistence.Thus, a chimeric receptor or CAR construct generally comprises a binding domain (which may be viewed as an antigen (i.e., target) or ligand binding domain and the terms binding domain, antigen recognition domain, antigen binding domain and ligand binding domain are used interchangeably herein), optionally a hinge domain, which functions as a spacer to extend the binding domain away from the plasma membrane of the cell (e.g., immune cell) on which it is expressed, a transmembrane domain,an intracellular signalling domain (e.g., the signalling domain from the zeta chain of the CD3 molecule(CD3ζ) of the TCR complex, or an equivalent) and optionally one or more co-stimulatory domains, which may assist in signalling or functionality of the cell expressing the CAR. A CAR may also comprise a signal or leader sequence or domain which functions to target the protein to the membrane and may form part of the exodomain of the CAR. The different domains may be linked directly or by linkers, and / or may occur within different polypeptides, e.g., within two polypeptides which associate with one another. When the CAR binds its target antigen, this results in the transmission of an activating signal to the cell in which it is expressed. Thus, the CAR directs the specificity of the engineered cells towards the antigen, particularly towards cells expressing the antigen. The term “directed towards” or “directed against” is synonymous with “specific for” or “anti”. Put anotherway, the CAR recognises the antigen target molecule. Accordingly, it is meant that the CAR is capableof binding specifically to antigen. In particular, the antigen-binding domain of the CAR is capable ofbinding specifically to antigen (more particularly when the CAR is expressed on the surface of a cell,notably an immune effector cell). Specific binding may be distinguished from non-specific binding to a non-target molecule or antigen. Thus, a cell expressing the CAR is directed, or re-directed, to bindspecifically to a target cell, expressing antigen, particularly a target cell expressing antigen on its cellsurface. Particularly, “specific” binding means that binding only or mainly occurs to antigen and not toother proteins or polypeptides (i.e. binding to other proteins or polypeptides is insignificant or weaker). Some cross-reaction with other proteins may occur but this level of binding can be considered asbackground. As mentioned above, the CAR is capable of binding to antigen and of transducing a signalinto a cell in which it is expressed. The cell may then be activated and may exert a suppressive effect within the local environment. Activation of a cell expressing a CAR after antigen binding can be determined by an increased level of CD69 as compared to the same cells expressing a CAR in the absence of antigen. For example, an increase of at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% in CD69. Expression levels of CD69 can be determined using standard techniques, for example FACS, using commercially available antibodies (e.g. FITC anti-human CD69 antibody, Biolegend). Thus, CAR function within a cell can be determined by activation status of the cell in which the CAR is expressed, e.g., by determining CD69 expression. The antigen-binding domain of a CAR may be derived or obtained from any protein or polypeptide which binds (i.e., has affinity for) antigen (e.g. which binds to any region or part of antigen, or alternatively viewed which binds to any epitope within antigen, either in an isolated protein form or when expressed on cells). Particularly, the antigen-binding domain of a CAR may be derived or obtained from any protein or polypeptide which binds (i.e., has affinity for) the extracellular domain of antigen. This may be for example, a ligand of antigen, or a physiological binding protein for antigen, or a part thereof, or a synthetic or derivative protein. The target molecule (antigen) may commonly be expressed on the surface of a cell, for example a target cell, or a cell in the vicinity of a target cell (for a bystander effect), but need not be. The antigen-binding domain is most commonly derived from antibody variable chains (for example itcommonly takes the form of a scFv), but may also be generated from other molecules, such as ligandsor other binding molecules. The CAR is typically expressed as a polypeptide also comprising a signal sequence (also known as a leader sequence), and in particular a signal sequence which targets the CAR to the plasma membrane of the cell. This will generally be positioned next to or close to the antigen binding domain, generally upstream of the antigen binding domain. The extracellular domain, or ectodomain, of the CAR may thuscomprise, consist essentially of or consist of a signal sequence and an antigen binding domain.The antigen binding domain provides the CAR with the ability to bind a predetermined antigen ofinterest. The antigen binding domain preferably targets an antigen of clinical interest or an antigen at a site of disease. The CAR may be directed towards any desired target antigen or molecule. This may be selected according to the intended therapy, and the condition it is desired to treat. It may for example be an antigen or molecule associated with a particular condition, or an antigen or molecule associated with a cell it is desired to target to treat the condition. Typically, the antigen or molecule is a cell-surface antigen or molecule. Antigens which may be targeted by the CAR include, but are not limited to, antigens expressed on cells associated with transplanted organs, autoimmune diseases, infectious diseases, allergic diseases and inflammatory diseases. It will be understood by a skilled person that where the cell engineered to express the nucleic acid molecule is a Treg cell, or a precursor therefor, due to the bystander effect of Treg cells, the antigen may be simply present and / or expressed at the site of transplantation, inflammation or disease. Antigens associated with organ transplants and / or cells associated with transplanted organs include, but are not limited to, a HLA antigen present in the transplanted organ but not in the patient, or an antigen whose expression is upregulated during transplant rejection such as CCL19, MMP9, SLC1A3, MMP7, HMMR, TOP2A, GPNMB, PLA2G7, CXCL9, FABP5, GBP2, CD74, CXCL10, UBD, CD27, CD48, CXCL11.The antigen which may be targeted by the CAR may be HLA-A2. HLA-A2 may particularly be expressedon cells associated with transplanted organs. HLA-A2 may also be referred to herein as HLA-A*02,HLA-A02 and HLA-A*2. HLA-A2 is one particular class I major histocompatibility complex (MHC) allelegroup at the HLA-A locus. Binders and CARs specific for HLA-A2 are described in WO 2019 / 056106,WO 2023 / 019144, WO 2018 / 001874, WO2020 / 201230 and WO2020 / 044055, the contents of whichare incorporated by reference. The CAR encoded by the nucleic acid molecule described herein may thus be a CAR or incorporate an antigen binding domain, CDR, VH and / or VL sequence as describedin WO 2019 / 056106, WO 2023 / 019144, WO 2018 / 001874 or WO2020 / 201230 or WO 2020 / 044055.Antigens expressed on cells associated with neurodegenerative disease and neuroinflammatory disease include antigens expressed in the central nervous system (CNS), for example those presented on glial cells, motor neurons, oligodendrocytes and Schwann cells. p75NTR (p75 neurotrophin receptor) is an example of an antigen to target CAR-Tregs to the CNS and brain as its expression is normally low in adult brain but is upregulated by injury / trauma / stress and increased p75NTR expression has been detected in a wide variety of neurodegenerative diseases. Binders and CARs specific for p75NTR are described in WO 2023 / 047098, the contents of which are incorporated herein by reference. The CAR encoded by the nucleic acid molecule described herein may thus be a CAR or incorporate an antigen binding domain, CDR, VH and / or VL sequence as described in WO 2023 / 047098. Antigens expressed at the site of an inflammatory lesion, for example present in the extracellular matrixof an inflammatory lesion may be associated with inflammatory and / or autoimmune diseases. Forexample, the antigen may be a modified protein or proteins present in the extracellular matrix of an inflammatory lesion, for example a citrullinated protein such as citrullinated vimentin, citrullinatedfilaggrin and citrullinated fibrinogen. For example, the antigen may be citrullinated vimentin, a modifiedform of vimentin that is specifically found in the joints. This target antigen may be useful for the treatment of rheumatoid arthritis, Alzheimer’s disease, sporadic Creutzfeldt-Jakob disease, juvenile idiopathic arthritis, idiopathic pulmonary fibrosis, rheumatoid arthritis associated interstitial lung disease, chronic obstructive pulmonary disease and / or liver fibrosis. For example, citrullinated vimentin may be the targetantigen for treatment of rheumatoid arthritis. Binders and CARs specific for citrullinated vimentin aredescribed in WO 2019 / 157461 and WO 2021 / 030257, the contents of which are incorporated herein byreference. The CAR encoded by the nucleic acid molecule described herein may thus be a CAR orincorporate an antigen binding domain, CDR, VH and / or VL sequence as described in WO 2019 / 157461or WO 2021 / 030257. Binders and CARs specific for citrullinated vimentin, citrullinated filaggrin andcitrullinated fibrinogen are described in WO 2023 / 010122, the contents of which are incorporated herein by reference. The CAR encoded by the nucleic acid molecule described herein may thus be a CAR or incorporate an antigen binding domain, CDR, VH and / or VL sequence as described in WO 2023 / 010122.Antigens associated with type 1 diabetes include antigens present at the site of disease (i.e., thepancreas), for example insulin and antigens expressed on pancreatic beta cells (e.g., ENTPD3,glutamic acid decarboxylase 65 kDA (GAD65) or dipeptidyl-peptidase 6 (DPP6)). Binders and CARsspecific for GAD65 are described in WO 2020 / 097546, WO 2022 / 240797 and WO 2022 / 094614, thecontents of which are incorporated herein by reference. Binders and CARs specific for DPP6 aredisclosed in WO 2022 / 094614 and WO 2022 / 187182, the contents of which are incorporated herein by reference. The CAR encoded by the nucleic acid molecule described herein may thus be a CAR orincorporate an antigen binding domain, CDR, VH and / or VL sequence as described in WO2020 / 097546, WO 2022 / 240797, WO 2022 / 094614, WO 2022 / 094614 or WO 2022 / 187182. The antigen which may be targeted by the CAR may be ENTPD3. ENTPD3 (Ectonucleoside triphosphate diphosphohydrolase 3) is also known as CD39L3, HB6 and NTPDase-3. It is a membrane- bound enzyme that is similar to E-type nucleotidases (NTPases) and is expressed on pancreatic betacells. The amino acid sequence of human ENTPD3 is shown in SEQ ID NO: 218 and the amino acidsequence of mouse ENTPD3 is shown in SEQ ID NO: 219. As noted above, the antigen binding domain may be any protein or peptide that possesses the ability to specifically recognize and bind to antigen (e.g. ENTPD3). The antigen binding domain includes any naturally occurring, synthetic, semi-synthetic, or recombinantly produced binding partner for antigen (e.g. ENTPD3). Illustrative antigen-specific targeting domains include antibodies or antibody fragments or derivatives, or ligands for antigen (e.g. ENTPD3).In an embodiment, the antigen binding domain is, or is derived from, an antibody.The term “antibody” as used herein refers broadly to any immunological binding agent or molecule that comprises an antigen binding domain, including polyclonal and monoclonal antibodies. Depending on the type of constant domain in the heavy chains, whole antibodies are assigned to one of five major classes: IgA, IgD, IgE, IgG and IgM and the antibodies as described herein may be in any one of these classes. Several of these are further divided into subclasses or isotypes such as IgG1, IgG2, IgG3, IgG4 and the like. Generally, IgG or IgM antibodies are the most common antibodies utilised in physiological settings. As will be understood by those in the art, the term “antibody” extends to all antibodies including whole antibodies, dimeric, trimeric and multimeric antibodies; bispecific antibodies; chimeric antibodies; recombinant and engineered antibodies and fragments thereof. An antibody-derived binding domain can be a fragment of an antibody or a genetically engineered product of one or more fragments of the antibody, which fragment is involved in binding with the antigen.Examples include a variable region (Fv), a complementarity determining region (CDR), Fab or F(ab’)2,or the light and heavy chain variable regions can be joined together in a single chain (e.g. as a scFv) and in either orientation (e.g. VL-VH or VH-VL). The VL and / or VH sequences may be modified. In particular, the framework regions may be modified (e.g., substituted, for example to humanise the antigen-binding domain). Other examples include a heavy chain variable region (VH), a light chain variable region (VL), and a single domain antibody (sAb) (which may be referred to as a nanobody). Anexample of a single domain antibody is a camelid heavy-chain antibody (HCAb) which has an antigenrecognition site formed by a single domain, termed VHH. In an embodiment, the antigen-binding domain is a single chain antibody (scFv). The scFv may be murine, human or humanized scFv.In an alternative embodiment, the antigen-binding domain is derived from a camelid heavy-chainantibody (HCAb), for example the antigen-binding domain may be a VHH domain of a HCAb. VHHs have a similar structure to that of VH domains from conventional IgGs and include three variable CDRs, although CDRs 1 and 3 often have more amino acids than those of VH domains. In certain embodiments, the VHH domain may comprise one or more CDRs comprising or consisting of thesequence(s) set forth in SEQ ID NOs: 1 to 84 specified herein, or sequence having at least 70%, 75%,80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. For example, the VHH domain may comprise one, two or three of the VH CDRs comprising or consisting of the sequence(s)set forth in SEQ ID NOs: 1 to 84 specified herein, or sequences having at least 70%, 75%, 80%, 85%,90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. Where the VHH domain comprises two or three VH CDRs of SEQ ID NOs: 1 to 84, the CDRs may be from the same binder described herein(e.g. all from the A8, B2, B7 binder etc).“Complementarity determining region” or “CDR” with regard to an antibody or antigen- binding fragmentthereof refers to a highly variable loop in the variable region of the heavy chain or the light chain of an antibody. CDRs can interact with the antigen conformation and largely determine binding to the antigen (although some framework regions are known to be involved in binding). The heavy chain variable region and the light chain variable region each contain 3 CDRs. "Heavy chain variable region" or "VH" refers to the fragment of the heavy chain of an antibody that contains three CDRs interposed between flanking stretches known as framework regions, which are more highly conserved than the CDRs and form a scaffold to support the CDRs. "Light chain variable region" or "VL" refers to the fragment of the light chain of an antibody that contains three CDRs interposed between framework regions. "Fv" refers to the smallest fragment of an antibody to bear the complete antigen binding site. An Fvfragment consists of the variable region of a single light chain bound to the variable region of a singleheavy chain. "Single-chain Fv antibody" or "scFv" refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another, in either orientation, directly or via a peptide linker sequence. Antibodies that specifically bind a predetermined antigen, e.g., ENTPD3, can be prepared using methods well known in the art. Such methods include phage display, methods to generate human or humanized antibodies, or methods using a transgenic animal or plant engineered to produce human antibodies. Phage display libraries of partially or fully synthetic antibodies are available and can be screened for an antibody or fragment thereof that can bind to the target molecule, e.g., to ENTPD3. Phage display libraries of human antibodies are also available. Once identified, the amino acid sequence or polynucleotide sequence coding for the antibody can be isolated and / or determined. The antigen recognition domain may bind, suitably specifically bind, one or more regions or epitopeswithin the antigen. An epitope, also known as antigenic determinant, is the part of an antigen that isrecognised by an antigen recognition domain (e.g., an antibody). In other words, the epitope is the specific piece of the antigen to which an antibody binds. Suitably, the antigen recognition domain binds, suitably specifically binds, to one region or epitope within the antigen. The antigen recognition domain may comprise at least one CDR (e.g. CDR3), which can be predictedfrom an antibody which binds to an antigen, (or a variant of such a predicted CDR (e.g. a variant withone, two or three amino acid substitutions)). It will be appreciated that molecules containing three or fewer CDR regions (e.g. a single CDR or even a part thereof) may be capable of retaining the antigen- binding activity of the antibody from which the CDR is derived. Molecules containing two CDR regions are described in the art as being capable of binding to a target antigen, e.g. in the form of a minibody (Vaughan and Sollazzo, 2001, Combinational Chemistry & High Throughput Screening, 4, 417-430). Molecules containing a single CDR have been described which can display strong binding activity to target (Nicaise et al, 2004, Protein Science, 13: 1882-91). In this respect, the antigen binding domain may comprise one or more variable heavy chain CDRs, e.g., one, two or three variable heavy chain CDRs. Alternatively, or additionally, the antigen binding domain may comprise one or more variable light chain CDRs, e.g. one, two or three variable light chain CDRs. The antigen binding domain may comprise three heavy chain CDRs and / or three light chain CDRs (and more particularly a heavy chain variable region comprising three CDRs and / or a light chain variable region comprising three CDRs) wherein at least one CDR, optionally all CDRs, may be from an antibody which binds to antigen. The antigen binding domain may comprise any combination of variable heavy and light chain CDRs, e.g. one variable heavy chain CDR together with one variable light chain CDR, two variable heavy chain CDRs together with one variable light chain CDR, two variable heavy chain CDRs together with two or three variable light chain CDRs, three variable heavy chain CDRs together with one or two variable light chain CDRs, one variable heavy chain CDR together with two or three variable light chain CDRs, or three variable heavy chain CDRs together with three variable light chain CDRs. Optionally, the antigen binding domain comprises three variable heavy chain CDRs (CDR1, CDR2 and CDR3) and / or three variable light chain CDRs (CDR1, CDR2 and CDR3). The one or more CDRs present within the antigen binding domain may not all be from the same antibody, as long as the domain has the desired binding activity. Thus, one CDR may be predicted fromthe heavy or light chains of an antibody which binds to antigen (e.g., ENTPD3) whilst another CDRpresent may be predicted from a different antibody which binds to antigen (e.g., ENTPD3). A combination of CDRs may be used from different antibodies, particularly from antibodies that bind to the same desired region or epitope. In an embodiment, the antigen binding domain comprises three CDRs predicted from the variable heavychain sequence of an antibody which binds to a particular antigen and / or three CDRs predicted fromthe variable light chain sequence of an antibody which binds to a particular antigen (optionally the sameantibody).In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.1, 2 and 3 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs.4,5 and 6 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 85, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 86, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 167, or a sequence having at least 70% identity tothe sequence encoded by SEQ ID NO: 167, and a VL domain comprising the sequence encoded bySEQ ID NO: 168, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:168. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 167 and / or the sequence of SEQ ID NO: 168, or a sequenceencoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 167or SEQ ID NO: 168 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.7, 8 and 9 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 10, 11 and 12 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 87, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 88, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 169, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 169, and a VL domain comprising the sequence encoded by SEQ ID NO: 170, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:170. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 169 and / or the sequence of SEQ ID NO: 170, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 169 or SEQ ID NO: 170 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.13, 14 and 15 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 16, 17 and 18 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 89, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 90, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 171, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 171, and a VL domain comprising the sequence encoded by SEQ ID NO: 172, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:172. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 171 and / or the sequence of SEQ ID NO: 172, or a sequenceencoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 171 or SEQ ID NO: 172 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.19, 20 and 21 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 22, 23 and 24 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 91, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 92, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 173, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 173, and a VL domain comprising the sequence encoded by SEQ ID NO: 174, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:174. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 173 and / or the sequence of SEQ ID NO: 174, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 173 or SEQ ID NO: 174 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.25, 26 and 27 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs.28, 29 and 30 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 93, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 94, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 175, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 175, and a VL domain comprising the sequence encoded by SEQ ID NO: 176, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:176. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 175 and / or the sequence of SEQ ID NO: 176, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 175 or SEQ ID NO: 176 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.31, 32 and 33 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 34, 35 and 36 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 95, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 96, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 177, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 177, and a VL domain comprising the sequence encoded by SEQ ID NO: 178, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:178. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 177 and / or the sequence of SEQ ID NO: 178, or a sequenceencoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 177 or SEQ ID NO: 178 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.37, 38 and 39 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 40, 41 and 42 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 97, or a sequence having at least 70%sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 98, ora sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 179, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 179, and a VL domain comprising the sequence encoded by SEQ ID NO: 180, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:180. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 179 and / or the sequence of SEQ ID NO: 180, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 179 or SEQ ID NO: 180 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.43, 44 and 45 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 46, 47 and 48 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences.More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VHdomain comprising the sequence as set forth in SEQ ID NO: 99, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 100, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 181, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 181, and a VL domain comprising the sequence encoded by SEQ ID NO: 182, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:182. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 181 and / or the sequence of SEQ ID NO: 182, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 181 or SEQ ID NO: 182 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.49, 50 and 51 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs.52, 53 and 54 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acidsequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VHdomain comprising the sequence as set forth in SEQ ID NO: 101, or a sequence having at least 70%sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 102, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 183, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 183, and a VL domain comprising the sequence encoded bySEQ ID NO: 184, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:184. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 183 and / or the sequence of SEQ ID NO: 184, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 183 or SEQ ID NO: 184 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.55, 56 and 57 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 58, 59 and 60 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 103, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 104, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 185, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 185, and a VL domain comprising the sequence encoded by SEQ ID NO: 186, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:186. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 185 and / or the sequence of SEQ ID NO: 186, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 185 or SEQ ID NO: 186 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.61, 62 and 63 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 64, 65 and 66 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 105, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 106, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 187, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 187, and a VL domain comprising the sequence encoded by SEQ ID NO: 188, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:188. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 187 and / or the sequence of SEQ ID NO: 188, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 187 or SEQ ID NO: 188 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.67, 68 and 69 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 70, 71 and 72 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 107, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 108, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 189, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 189, and a VL domain comprising the sequence encoded by SEQ ID NO: 190, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:190. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 189 and / or the sequence of SEQ ID NO: 190, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 189 or SEQ ID NO: 190 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.73, 74 and 75 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 76, 77 and 78 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acid sequence modifications in any of the aforementioned sequences. More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 109, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 110, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domain comprising the sequence encoded by SEQ ID NO: 191, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 191, and a VL domain comprising the sequence encoded by SEQ ID NO: 192, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO:192. For example, the first nucleotide sequence in the nucleic acid molecule described herein maycomprise the sequence of SEQ ID NO: 191 and / or the sequence of SEQ ID NO: 192, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 191 or SEQ ID NO: 192 respectively.In an embodiment, the antigen-binding domain comprises VH CDR1, 2 and 3 sequences as set forth inSEQ ID NOs.79, 80 and 81 respectively and VL CDR1, 2 and 3 sequences as set forth in SEQ ID NOs. 82, 83 and 84 respectively, or the CDRs may contain 1 to 3, or more particularly 1 or 2 amino acidsequence modifications in any of the aforementioned sequences.More particularly, in such an embodiment the antigen binding domain of the CAR comprises a VH domain comprising the sequence as set forth in SEQ ID NO: 111, or a sequence having at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 112, or a sequence having at least 70% sequence identity thereto. For example, in such an embodiment, the antigen binding domain of the CAR comprises a VH domaincomprising the sequence encoded by SEQ ID NO: 193, or a sequence having at least 70% identity tothe sequence encoded by SEQ ID NO: 193, and a VL domain comprising the sequence encoded by SEQ ID NO: 194, or a sequence having at least 70% identity to the sequence encoded by SEQ ID NO: 194. For example, the first nucleotide sequence in the nucleic acid molecule described herein may comprise the sequence of SEQ ID NO: 193 and / or the sequence of SEQ ID NO: 194, or a sequence encoding a VH or VL domain having at least 70% identity to the sequence encoded by SEQ ID NO: 193 or SEQ ID NO: 194 respectively. Where a CDR does contain an amino acid sequence modification, this may be a deletion, addition, or substitution of an amino acid residue of the CDR sequence as set out in the above-mentioned SEQ ID NOs. More particularly, the modification may be an amino acid substitution, for example a conservative amino acid substitution, e.g., as set out above. A longer CDR may tolerate more amino acid residuemodifications. In the case of CDRs which are 5 or more, or 7 or more, amino acid residues long, themodifications may be of 0, 1, 2 or 3 residues, e.g.2 residues. In general, there may be 0, 1, 2, or 3 modifications to any particular CDR sequence. Further, in an embodiment, CDRs 1 and 2 may be modified, and CDR3 may be unmodified. In another embodiment all 3 CDRs may be modified. In another embodiment, the CDRs are not modified.The antigen binding domain may be in the form of a scFv comprising the VH and VL domain sequencesas set out above, in either order, for example VH-VL. The VH and VL sequences may be linked by a linker sequence. Suitable linkers can be readily selected and can be of any of a suitable length, such as from 1 amino acid (e.g. Gly) to 30 amino acids, e.g. from any one of 2, 3, 4, 5, 6, 7,8, 9, or 10 amino acids to any one of 12, 15, 18, 20, 21, 25, 30 amino acids, for example, 5-30, 5-25, 6-25, 10-15, 12-25, 15 to 25 etc. Exemplary linkers include glycine polymers (G), glycine-serine polymers, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art, as discussed above. The linker may comprise 1 or more “GS” domains as discussed above. The linker sequence may be a flexible linker sequence. Flexible linkers are a category of linker sequences well known and described in the art. Linker sequences are generally known as sequences which may be used to link, or join together, proteins or protein domains, to create for example fusion proteins or chimeric proteins, or multifunctional proteins or polypeptides. They can have different characteristics, and for example may be flexible, rigid or cleavable. Protein linkers are reviewed forexample in Chen et al., 2013, Advanced Drug Delivery Reviews 65, 1357-1369, which compares thecategory of flexible linkers with those of rigid and cleavable linkers. Flexible linkers are also described in Klein et al., 2014, Protein Engineering Design and Selection, 27(10), 325-330; van Rosmalen et al., 2017, Biochemistry, 56,6565-6574; and Chichili et al., 2013, Protein Science, 22, 153-167. A flexible linker is a linker which allows a degree of movement between the domains, or components, which are linked. They are generally composed of small non-polar (e.g. Gly) or polar (e.g. Ser or Thr) amino acid residues. The small size of the amino acids provides flexibility and allows for mobility of the connected parts (domains or components). The incorporation of polar amino acids can maintain the stability of the linker in aqueous environments by forming hydrogen bonds with water molecules. The most commonly used flexible linkers have sequences primarily composed of Ser and Gly residues (so-called “GS linkers”). However, many other flexible linkers have also been described (see Chen et al,.2013, supra, for example), which may contain additional amino acids such as Thr and / or Ala, and / or Lys and / or Glu which may improve solubility. Any flexible linker known and reported in the art may be used.Although the length of the linker is not critical, it may in some embodiments be desirable to have ashorter linker sequence. For example, the linker sequence may have a length of no more than 25, optionally no more than 24, 23, 22 or 21 amino acids. In other embodiments, a longer linker sequence may be desired, for example composed of, or comprising, multiple repeats of a GS domain. In some embodiments the linker may be from any one of 2, 3, 4, 5 or 6 to any one of 24, 23, 22 or 21 amino acids in length. In other embodiments it may be from any one of 2, 3, 4, 5 or 6 to any one of 21, 20, 19, 18, 17, 16, or 15 amino acids in length. In other embodiments it may be intermediate between these ranges, from example from 6 to 21, 6 to 20, 7 to 20, 8-20, 9-20, 10-20, 8-18, 9-18, 10-18, 9-17, 10-17, 9-16, 10-16 etc. It may accordingly be in a range made up from any of the integers listed above. The use of GS linkers, or more particularly GS (“Gly-Ser”) domains in linkers, may allow the length of the linker readily to be varied by varying the number of GS domain repeats, and so such linkers represent one class of linkers. However, flexible linkers are not limited to those based on “GS” repeats, and other linkers comprising Ser and Gly residues dispersed throughout the linker sequence have been reported, including in Chen et al., supra. Accordingly, in one embodiment the linker sequence may comprise at least 40% Gly or Gly and Ser residues. In another embodiment, the linker sequence may comprise Ser and / or Gly residues, and no more than 15 other amino acid residues, optionally no more than 14, 13, 12, 11, 10, 9, 8, 6, 7, 5, or 4 other amino acid residues. It will be understood than an “other” amino acid residue may be any amino acid which is not Ser or Gly. Pro residues in linkers tend to confer rigidity and so in one embodiment the linker sequence does not comprise any Pro residues. However, this is not absolute, as depending on the sequence context, a flexible linker sequence may contain one or more Pro residues. In one embodiment, the linker sequence comprises at least one Gly-Ser domain composed solely of Ser and Gly residues. In such an embodiment, the linker may contain no more than 15 other amino acid residues, optionally no more than 14, 13, 12, 11, 10, 9, 8, 6, 7, 5, or 4 other amino acid residues. The Gly-Ser domain may have the formula: (S)q-[(G)m-(S)m]n-(G)p wherein q is 0 or 1; m is an integer from 1-8; n is an integer of at least 1 (e.g. from 1 to 8, ormore particularly 1 to 6); and p is 0 or an integer from 1 to 3.More particularly, the Gly-Ser domain may have the formula: (i) S-[(G)m-S]n; (ii) [(G)m-S]n; or (iii) [(G)m-S]n-(G)p wherein m is an integer from 2-8 (for example 3-4); n is an integer of at least 1 (for example from 1 to 8, or more particularly 1 to 6); and p is 0 or an integer from 1 to 3. In a representative example, the Gly-Ser domain may have the formula: S-[G-G-G-G-S]n wherein n is an integer of at least one (optionally 1 to 8, or 1-6, 1-5, 1-4, or 1-3). A representative sequence GGGS is shown in SEQ ID NO.220. A linker sequence may be composed solely of, or may consist of, one or more Gly-Ser domains as described or defined above. However, as noted above, in another embodiment, the linker sequencemay comprise one or more Gly-Ser domains, and additional amino acids. The additional amino acidsmay be at one or both ends of a Gly-Ser domain, or at one or both ends of a stretch of repeating Gly- Ser domains. Thus, the additional amino acid, which may be other amino acids, may lie at one or both ends of the linker sequence, e.g. they may flank the Gly-Ser domain(s). In other embodiments, the additional amino acids may lie between Gly-Ser domains. For example, two Gly-Ser domains may flank a stretch of other amino acids in the linker sequence. Further, as also noted above, in other linkers, GS domains need not be repeated, and G and / or S residues, or a short domain such as GS, may simply be distributed along the length or the sequence. Representative exemplary linker sequences are listed below: ETSGGGGSRL (SEQ ID NO.221) SGGGGSGGGGSGGGGS (SEQ ID NO.222) S(GGGGS)1-5 (where GGGGS is SEQ ID NO.223) (GGGGS)1-5 (where GGGGS is SEQ ID NO.223) S(GGGS)1-5 (where GGGS is SEQ ID NO.220) (GGGS)1-5 (where GGGS is SEQ ID NO.220) S(GGGGGS)1-5(where GGGGGS is SEQ ID NO.224) (GGGGGS)1-5 (where GGGGGS is SEQ ID NO.224) S(GGGGGGS)1-5 (where GGGGGGS is SEQ ID NO.225) (GGGGGGS)1-5 (where GGGGGGS is SEQ ID NO.225) GGGGSGGGGSGGGGS (SEQ ID NO: 226) GGGGG (SEQ ID NO: 227) GGGGSGGGGS (SEQ ID NO: 228) GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 229) GGGGGGG (SEQ ID NO: 230) G6 (SEQ ID NO.231) G8 (SEQ ID NO.232) KESGSVSSEQLAQFRSLD (SEQ ID NO.233) EGKSSGSGSESKST (SEQ ID NO.234)GSAGSAAGSGEF (SEQ ID NO.235)SGGGGSAGSAAGSGEF (SEQ ID NO.236) SGGGLLLLLLLLGGGS (SEQ ID NO.237) SGGGAAAAAAAAGGGS (SEQ ID NO.238) SGGGAAAAAAAAAAAAAAAAGGGS (SEQ ID NO.239) SGALGGLALAGLLLAGLGLGAAGS (SEQ ID NO.240) SLSLSPGGGGGPAR (SEQ ID NO.241)SLSLSPGGGGGPARSLSLSPGGGGG (SEQ ID NO. 242)GSSGSS (SEQ ID NO.243) GSSSSSS (SEQ ID NO.244) GGSSSS (SEQ ID NO.245) GSSSSS (SEQ ID NO.246) SGGGGS (SEQ ID NO.247). In certain embodiments, the linker has the sequence (GGGGS)3 (SEQ ID NO: 226). Although the linker sequences, as defined above, are flexible sequences, the present disclosure includes also other polypeptides, including those which comprise linkers which are not flexible, and / or which do not meet the definitions and requirements set out above. A further example of a linker that may be used to join the VH and VL domains is KLEEGEFSEARV (SEQ ID NO: 248) or a sequence having at least about 60% identity thereto, for example a sequencehaving at least about 65% or at least about 70% or at least about 75% or at least about 80% or at leastabout 85% or at least about 90% or at least about 95% identity thereto. Alternatively, the linker mayhave the sequence of SEQ ID NO: 248 or a sequence that differs by no more than 6, for example nomore than 5 or no more than 4 or no more than 3 or no more than 2 or no more than 1 amino acid. In particular, this linker may be truncated or elongated at the N terminus and / or the C terminus by one or more amino acids (e.g. see Schmiedl A. et al (Protein Eng.2000 Oct; 13(10): 725-34 where this linker is shortened by one amino acid at each terminus compared to SEQ ID NO: 248). In order to improve the stability of this linker and to delete the two putative trypsin cleavage sites (lysine and arginine), thelinker may be modified by exchanging lysine (K) against isoleucine (I), arginine (R) against glycine (G)and valine (V) against cysteine (C). The resulting linker has the amino acid sequence ILEEGEFSEAGC (SEQ ID NO: 249). Any peptide linker carrying the consensus amino acid sequence X1LEEGEFSEAX2X3 (SEQ ID NO: 250) wherein X1 is K or I, X2 is R or G and X3 is V or C, may also be used. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequenceas set forth in SEQ ID NO.85 linked via a linker of sequence (X)n, where X is any amino acid and n isan integer of between 15 and 25, to the VL sequence of SEQ ID NO.86. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.87 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.88. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.89 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.90. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.91 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.92. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.93 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.94. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.95 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.96. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.97 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.98. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.99 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.100. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.101 linked via a linker of sequence (X)n, where X is any amino acid and nis an integer of between 15 and 25, to the VL sequence of SEQ ID NO.102.Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.103 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.104.Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequenceas set forth in SEQ ID NO.105 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.106. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.107 linked via a linker of sequence (X)n, where X is any amino acid and nis an integer of between 15 and 25, to the VL sequence of SEQ ID NO.108.Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequenceas set forth in SEQ ID NO.109 linked via a linker of sequence (X)n, where X is any amino acid and n is an integer of between 15 and 25, to the VL sequence of SEQ ID NO.110. Accordingly in one embodiment the antigen binding domain may comprise, or consist of, a VH sequence as set forth in SEQ ID NO.111 linked via a linker of sequence (X)n, where X is any amino acid and nis an integer of between 15 and 25, to the VL sequence of SEQ ID NO.112.In this respect, in one embodiment, the antigen binding domain of the CAR comprises or consists of thesequence as set forth in SEQ ID NO: 113 or a sequence having at least 70% or 80% identity thereto.In another embodiment, in one embodiment, the antigen binding domain of the CAR comprises orconsists of the sequence as set forth in SEQ ID NO: 114 or a sequence having at least 70% or 80%identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 115 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 116 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 117 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 118 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 119 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 120 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 121 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 122 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 123 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 124 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 125 or a sequence having at least 70% or 80% identity thereto. In a further embodiment, in one embodiment, the antigen binding domain of the CAR comprises or consists of the sequence as set forth in SEQ ID NO: 126 or a sequence having at least 70% or 80% identity thereto. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 153 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 153. For example, the antigen binding domain of the CAR may comprise of consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g myc-tag and / or his-tag) is removed from SEQ ID NO: 153 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQID NO: 153 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 153. For example, the first nucleotidesequence encoding the CAR may comprise the sequence remaining after the sequence encoding thesignal sequence any / or any tag sequence is removed from SEQ ID NO: 153.In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 154 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 154. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 154 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 154 or a sequence encoding an amino acid sequence having at least 80% identity to the aminoacid sequence encoded by the sequence set forth in SEQ ID NO: 154. For example, the first nucleotidesequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 154. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 155 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 155. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 155 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 155 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 155. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 155. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 156 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 156. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 156. For example, thefirst nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 156 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 156. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 156. In one embodiment, the antigen binding domain comprises or consists of the CAR is the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 157 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO:157. For example, the antigen binding domain of the CAR may comprise or consist of the amino acidsequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 157 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 157 or a sequence encoding an amino acid sequence having at least 80% identity to the aminoacid sequence encoded by the sequence set forth in SEQ ID NO: 157. For example, the first nucleotidesequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 157. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 158 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO:158. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 158 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 158 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 158. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 158. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 159 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 159. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 159 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 159 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 159. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 159. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 160 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 160. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 160 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQID NO: 160 or a sequence encoding an amino acid sequence having at least 80% identity to the aminoacid sequence encoded by the sequence set forth in SEQ ID NO: 160. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 160. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 161 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 161. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 161 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 161 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 161. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 161. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 162 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 162. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 162 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 162 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 162. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 162. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 163 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 163. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 163 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 163 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 163. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 163. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 164 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 164. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 164 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQ ID NO: 164 or a sequence encoding an amino acid sequence having at least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 164. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding thesignal sequence any / or any tag sequence is removed from SEQ ID NO: 164.In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 165 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 165. For example, the antigen binding domain of the CAR may comprise or consist of the amino acidsequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 165 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQID NO: 165 or a sequence encoding an amino acid sequence having at least 80% identity to the aminoacid sequence encoded by the sequence set forth in SEQ ID NO: 165. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 165. In one embodiment, the antigen binding domain of the CAR comprises or consists of the amino acidsequence encoded by a sequence as set forth in SEQ ID NO: 166 or an amino acid sequence havingat least 80% identity to the amino acid sequence encoded by the sequence set forth in SEQ ID NO: 166. For example, the antigen binding domain of the CAR may comprise or consist of the amino acid sequence encoded by the sequence remaining after the sequence encoding the signal sequence and / orany tag sequence (e.g. myc-tag and / or his-tag) is removed from SEQ ID NO: 166 or variant thereof. Forexample, the first nucleotide sequence encoding the CAR may comprise the sequence set forth in SEQID NO: 166 or a sequence encoding an amino acid sequence having at least 80% identity to the aminoacid sequence encoded by the sequence set forth in SEQ ID NO: 166. For example, the first nucleotide sequence encoding the CAR may comprise the sequence remaining after the sequence encoding the signal sequence any / or any tag sequence is removed from SEQ ID NO: 166. In a further embodiment, the CAR construct may comprise, or consist of, a sequence as set forth in any one of SEQ ID NOs: 127 to 152, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. In certain embodiments, the CAR construct may comprise, or consist of, a sequence as set forth in SEQ ID NO: 128, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. In certain embodiments, the CAR construct may comprise, or consist of, a sequence as set forth in SEQ ID NO: 130, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. In certain embodiments, the CAR construct may comprise, or consist of, a sequence as set forth in SEQ ID NO: 131, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. In certain embodiments, the CAR construct may comprise, or consist of, a sequence as set forth in SEQ ID NO: 133, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. In certain embodiments, the CAR construct may comprise, or consist of, a sequence as set forth in SEQ ID NO: 139, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. In certain embodiments, the CAR construct may comprise, or consist of, a sequence as set forth in SEQ ID NO: 143, or a variant thereof, e.g. a sequence having at least 70% or 80% identity thereto. The variant sequences disclosed and described herein, including the variant CAR, VH, VL, antigen binding domain sequences, may have at least 75, 80, 85, 90, 92, 95, 96, 97, 98, or 99% sequenceidentity to the specified SEQ ID NOs. The variant sequences disclosed and described herein may befunctional variants or functional fragments of the reference CAR, VH, VL, antigen binding domainsequences described herein. The CAR also optionally comprises a hinge domain to hold the extracellular domain, particularly the antigen binding domain, away from the cell surface, and further comprises a transmembrane domain.The hinge and transmembrane domains may comprise the hinge and transmembrane sequences fromany protein which has a hinge domain and / or a transmembrane domain, including any of the type I, type II or type III transmembrane proteins. The hinge domain may be selected from the hinge regions of CD28, CD8alpha, CD4, CD7, CH2CH3, an immunoglobulin, or a part or variant thereof. Typically, the hinge may be derived from CD8, particularly, CD8alpha, or from CH2CH3. In one embodiment, the hinge may comprise one or more cysteine residues e.g., to allow disulphide bonding. For example, the CD8 hinge may comprise one or more cysteine residues e.g., one cysteine residue, two cysteine residues or three cysteine residues. The transmembrane domain of the CAR may also comprise an artificial hydrophobic sequence. The transmembrane domains of the CAR may be selected so as not to dimerize. Additional transmembrane domains will be apparent to those of skill in the art. Examples of transmembrane (TM) regions used in CAR constructs are: 1) The CD28 TM region (Pule et al, Mol Ther, 2005, Nov;12(5):933-41; Brentjens et al, CCR, 2007, Sep 15;13(18 Pt 1):5426-35; Casucci et al, Blood, 2013, Nov 14;122(20):3461-72.); 2) The OX40 TM region (Pule et al, Mol Ther, 2005, Nov;12(5):933-41); 3) The 4-1BB TM region (Brentjens et al, CCR, 2007, Sep 15;13(18 Pt 1):5426-35); 4). The CD3 zeta TM region (Pule et al, Mol Ther, 2005, Nov;12(5):933-41; Savoldo B, Blood, 2009, Jun 18;113(25):6392-402.); 5) The CD8α TM region (Maher et al, Nat Biotechnol, 2002, Jan;20(1):70-5.; Imai C, Leukemia, 2004, Apr;18(4):676-84; Brentjens et al, CCR, 2007, Sep 15;13(18 Pt 1):5426-35; Milone et al, Mol Ther, 2009, Aug;17(8):1453- 64.). Other transmembrane domains which may be used include those from ICOS, CD4, CD45, CD9, CD16, CD22, CD33, CD64, CD80, CD86, CD154 or CH2CH3. Optionally, the transmembrane domain may be derived from CD4, CD28, CD8α or CH2CH3.In one embodiment, the CAR may not comprise a dimerisation domain which binds to a regulatingmolecule. A regulating molecule is any molecule that can bind to at least one dimerisation domain in a CAR and can prevent the interaction, or cause the interaction, of a pair of dimerisation domains. Examples of regulating molecules include soluble proteins (e.g., cytokines, TGF-beta, VEGF) or small molecules. In a further embodiment, when dimerisation with other CAR molecules occurs, it may not be controlled. In another embodiment, monovalent binding of the CAR to an antigen may allow activation of the cell in which the CAR is expressed. A hinge domain may conveniently be obtained from the same protein as the transmembrane domain. In one embodiment, where the transmembrane domain is derived from the CD8α transmembrane domain, the hinge domain is derived from the CD8α hinge domain. In an alternative embodiment, where the transmembrane domain is derived from the CH2CH3 transmembrane domain, the hinge domain is derived from the CH2CH3 hinge domain.Alternatively, the hinge domain may be obtained from a different protein to the transmembrane domain.For example, the hinge domain may be derived from the CH2CH3 hinge domain and the transmembrane domain may be derived from the CD28 transmembrane domain. For example, the hinge domain may be derived from the CD8α hinge domain and may comprise the amino acid sequence shown in SEQ ID NO: 251, or a variant thereof which is at least 80% identical to SEQ ID NO; 251. Suitably, the variant may be at least 85, 90, 95, 97, 98 or 99% identical to SEQ ID NO: 251. An example of a modified CD8α hinge domain is shown in SEQ ID NO: 252.For example, the hinge domain may comprise the amino acid sequence shown in SEQ ID NO: 253 orencoded by the nucleotide sequence shown in SEQ ID NO: 254, or a variant thereof which is at least80% identical to SEQ ID NO: 253 or SEQ ID NO: 253. Suitably, the variant may be at least 85, 90, 95,97, 98 or 99% identical to SEQ ID NO: 253 or SEQ ID NO: 254.For example, the transmembrane domain may be derived from the CD8α transmembrane domain andmay comprise the amino acid sequence shown as SEQ ID NO: 255 which represents amino acids 183to 203 of human CD8α, or a variant which is at least 80% identical to SEQ ID NO: 255. Suitably, thevariant may be at least 85, 90, 95, 97, 98 or 99% identical to SEQ ID NO: 255. The CD8α transmembrane domain may be combined with a CD8α hinge domain. In an embodiment, the CAR comprises a combined CD8α hinge and transmembrane domain sequence as shown in SEQID NO.256 or SEQ ID NO. 257, or a variant thereof which has at least 80% sequence identity thereto.The variant may be at least 85, 90, 95, 97, 98 or 99% identical to SEQ ID NO: 256 or SEQ ID NO.257respectively. SEQ ID NO. 256 comprises a modified hinge domain comprising 2 amino acidmodifications of cysteine residues relative to the wild-type CD8α hinge sequence. The modified CD8α hinge domain sequence is shown in SEQ ID NO.256. The wildtype CD8α hinge and transmembranedomain sequence is shown in SEQ ID NO. 257. The 6 amino acids at the end of SEQ ID NO.256 and257, when present, are not located in the membrane and form part of the endodomain of the CAR. Avariant of such hinge sequences having at least 80% sequence identity to SEQ ID NO.256 or 257 maybe used. For example, the hinge domain may be derived from the CH2CH3 hinge domain and may comprise thesequence shown in SEQ ID NO.258 or 259 or a variant thereof which is at least 80% identical to SEQID NO.258 or 259 respectively. The variant may be at least 85, 90, 95, 97, 98 or 99% identical to SEQID NO. 258 or 259 respectively.Alternatively, an example of a CD28 hinge and transmembrane sequence which may be used is SEQID NO: 260 or a variant thereof which is at least 80% identical to SEQ ID NO: 260. The variant may beat least 85, 90, 95, 97, 98 or 99% identical to SEQ ID NO: 260. By way of further example, the CAR may comprise a native or modified CD8α hinge domain and a CD28 transmembrane domain, or a CD28 hinge domain and CD8α transmembrane domain, for example based on the sequences given above. In one embodiment, a CH2CH3 hinge sequence comprising one or more cysteine residues may be used. For example, a CH2CH3 hinge sequence comprising one, two, three, four or more cysteine residues. Other hinge domains which may be used include those from CD4, CD7, or an immunoglobulin, or a part or variant thereof. These hinge domains may comprise one or more cysteine residues, for example one, two, three, four or more cysteine residues. In one embodiment, the transmembrane domain may be derived from the CD4 transmembrane domainand may comprise the sequence shown in SEQ ID NO: 261 or a variant thereof which is at least 80%identical to SEQ ID NO: 261. The variant may be at least 85, 90, 95, 97, 98 or 99% identical to SEQ ID NO: 261. The CAR may further comprise a signal (or alternatively termed, leader) sequence which targets it to the endoplasmic reticulum pathway for expression on the cell surface. An illustrative signal / leader sequence is MALPVTALLLPLALLLHAAAP as shown in SEQ ID NO. 262. This comprises a single amino acid substitution compared to the wild type CD8^ sequence MALPVTALLLPLALLLHAARP as shown in SEQ ID NO. 263. Either sequence, or a variant sequence having at least 70% sequenceidentity thereto may be used. For example, a variant sequence may have at least 75, 80, 85, 90, 95,97, 98 or 99% sequence identity thereto. The endodomain of a CAR as described herein comprises motifs necessary to transduce the effector function signal and direct a cell expressing the CAR to perform its specialized function upon antigen binding. Particularly, the endodomain may comprise one or more (e.g. two or three) Immunoreceptor tyrosine-based activation motifs (ITAMs), typically comprising the amino acid sequence of YXXL / I,where X can be any amino acid. Examples of intracellular signaling domains include, but are not limitedto, ζ chain endodomain of the T-cell receptor or any of its homologs (e.g., η chain, FcεR1γ and β chains, MB1 (Igα) chain, B29 (Igβ) chain, etc.), CD3 polypeptide domains (∆, δ and ε), syk family tyrosine kinases (Syk, ZAP 70, etc.), src family tyrosine kinases (Lck, Fyn, Lyn, etc.) and other molecules involved in T-cell transduction, such as CD2, CD5 and CD28. The intracellular signaling domain may comprise human CD3 zeta chain endodomain, FcyRIII, FcsRI, cytoplasmic tails of Fc receptors, immunoreceptor tyrosine-based activation motif (ITAM) bearing cytoplasmic receptors or combinations thereof. Commonly, the intracellular signaling domain comprises the intracellular signaling domain of a human CD3 zeta chain. The sequence of the intracellular signaling domain of human CD3 zeta chain is set out in SEQ ID NO.264. The CAR may comprise a CD3ζ signalling domain comprising or consisting of asequence as set out in SEQ ID NO. 264 or a sequence having at least 80, 85, 90, 95, 97, 98 or 99%identity to SEQ ID NO: 264. In an embodiment the signaling domain comprises or consists of SEQ ID NO.264.Other signaling domains which may be used include the signaling domains of CD28 or CD27 or variantsthereof. Additional intracellular signaling domains will be apparent to those of skill in the art and may be used in connection with alternate embodiments of the invention. In one embodiment, the present CAR may not comprise a costimulatory domain derived from 4-1BB within the endodomain. The present CAR may comprise a compound endodomain comprising a fusion of the intracellular part of a T-cell co-stimulatory molecule to that of e.g. CD3ζ. Such a compound endodomain may be referredto as a second-generation CAR which can transmit an activating and co-stimulatory signalsimultaneously after antigen recognition. The co-stimulatory domain most commonly used is that ofCD28. This supplies the most potent co-stimulatory signal - namely immunological signal 2, whichtriggers T-cell proliferation. The CAR endodomain may also comprise one or more TNF receptor family signalling domain, such as the signalling domain of ICOS, (CD134) OX40, 4-1BB, CD27 or TNFRSF25, or a part or variant thereof, although optionally the CAR may not comprise an endodomain comprising the signalling domains of both CD28 and 4-1BB. An intracellular signaling domain of CD28 which may be used as a co-stimulatory domain is shown inSEQ ID NO.265. Illustrative sequences for OX40, 4-1BB, ICOS and TNFRSF25 signalling domains areshown in SEQ ID NO: 266 to 269. The CAR may comprise one or more co-stimulatory domainscomprising or consisting of the sequence of any one of SEQ ID NO: 265, 266, 267, 268, 269 or a variantthereof having at least 80, 85, 90, 95, 97, 98 or 99% sequence identity thereto.In certain embodiments, the transmembrane domain and the intracellular signalling domain derived from a T-cell co-stimulatory molecule may be derived from the same protein. For example, in certain embodiments, the transmembrane domain and intracellular signalling domain derived from a T-cell co- stimulatory molecule may be derived from CD28. For example, the CAR may comprise a combined CD28 transmembrane and CD28 intracellular signalling domain as shown in SEQ ID NO: 270, or avariant thereof having at least 80% sequence identity thereto. The variant may be at least 85, 90, 95,97, 98 or 99% identical to SEQ ID NO: 270. In one embodiment, the CAR comprises a human CD8 hinge domain or a variant thereof and a human CD8 transmembrane domain. Alternatively, or additionally, the CAR comprises an endodomain comprising, consisting essentially of or consisting of a human CD28 co-stimulatory domain and a human CD3 zeta signalling domain. In one embodiment the CAR comprises a hinge, transmembrane, and intracellular (or endo) domains as follows: (i) a CH2CH3 hinge sequence comprising or consisting of the sequence as set forth in SEQID NO. 258 or SEQ ID NO. 259, or a sequence having at least 80% sequence identitythereto; (ii) a CD28 transmembrane and co-stimulatory domain comprising or consisting of thesequence as set forth in SEQ ID NO.270, or a sequence having at least 80% sequence identity thereto; (iii) a CD3ζ signalling domain comprising or consisting of the sequence as set forth in SEQ IDNO. 264, or a sequence having at least 80% sequence identity thereto.In an alternative embodiment the CAR comprises a hinge, transmembrane, and intracellular (or endo) domains as follows: (i) a CD8α hinge and transmembrane domain sequence comprising or consisting of thesequence as set forth in SEQ ID NO. 256 or SEQ ID NO: 257, or a sequence having atleast 80% sequence identity thereto; (ii) a CD28 co-stimulatory domain comprising or consisting of the sequence as set forth in SEQID NO.265, or a sequence having at least 80% sequence identity thereto; (iii) a CD3ζ signalling domain comprising or consisting of the sequence as set forth in SEQ IDNO.270, or a sequence having at least 80% sequence identity thereto. The CAR, as encoded and expressed, may further comprise a leader sequence comprising or consisting of a sequence as set out in SEQ ID NO.263, or a sequence having at least 80% sequence identity thereto.The antigen binding domain of the CAR may comprise or consist of a sequence as set out in SEQ IDNO.113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126 or a sequence having at least 80% sequence identity thereto which is capable of binding to ENTPD3. Thus, in its entirety one representative CAR may comprise: (i) a leader sequence comprising or consisting of a sequence as set out in SEQ ID NO. 263,or a sequence having at least 80% sequence identity thereto; (ii) an antigen binding domain comprising or consisting of a sequence as set out in SEQ IDNO.113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126 or a sequence having at least 80% sequence identity thereto; (iii) a CH2CH3 hinge domain sequence comprising or consisting of the sequence as set forthin SEQ ID NO.258 or 259, or a sequence having at least 80% sequence identity thereto;(iv) a CD28 transmembrane and co-stimulatory domain comprising or consisting of thesequence as set forth in SEQ ID NO.270, or a sequence having at least 80% sequence identity thereto; (v) a CD3ζ signalling domain comprising or consisting of the sequence as set forth in SEQ IDNO.264, or a sequence having at least 80% sequence identity thereto. An alternative representative CAR may comprise: (i) a leader sequence comprising or consisting of a sequence as set out in SEQ ID NO. 263,or a sequence having at least 80% sequence identity thereto; (ii) an antigen binding domain comprising or consisting of a sequence as set out in SEQ IDNO.113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, or a sequence having at least 80% sequence identity thereto; (iii) a CD8 hinge and transmembrane domain sequence comprising or consisting of thesequence as set forth in SEQ ID NO. 256 or 257, or a sequence having at least 80%sequence identity thereto; (iv) a CD28 co-stimulatory domain comprising or consisting of the sequence as set forth in SEQID NO.265, or a sequence having at least 80% sequence identity thereto; (v) a CD3ζ signalling domain comprising or consisting of the sequence as set forth in SEQ IDNO.264, or a sequence having at least 80% sequence identity thereto. The CAR of the present invention may comprise, or consist of, any one or more of the sequences asset out in SEQ ID NOs. 127 to 152, or a variant thereof having at least about 70% or 80% identitythereto. For example, any variant may have at least about 85, 90, 95, 97, 98 or 99% identity to SEQ ID NOs 127 to 152. The CARs of SEQ ID NOs 127 to 152, or variants thereof, may further comprise asignal sequence, for example a signal sequence having the sequence set out in SEQ ID NO: 262 or263. The variant sequences disclosed and described herein, including the variant CAR domain sequences (e.g. leader sequence, antigen binding domain sequence, hinge domain sequence, transmembrane domain sequence, co-stimulatory domain sequence and / or intracellular signalling sequence), may have at least 75, 80, 85, 90, 92, 95, 96, 97, 98, or 99% sequence identity to the specified SEQ ID NOs. The variant sequences disclosed and described herein may be functional variants or functional fragments of the reference domain sequences described herein. The CAR may be capable of binding to ENTPD3 and of transducing a signal into a cell in which it is expressed. The CAR may be a human CAR. By “human CAR” it is meant that all domains of the CAR (e.g. hinge, transmembrane, co-stimulatory and / or signalling domains) are all derived from human proteins. The cell may express only one type of CAR, i.e., where the cell expresses more than one CAR molecule, the amino acid sequences of each of these expressed molecules are identical to one another. Thus, the nucleic acid molecule described herein may encode only one type of CAR. The endodomain of a CAR may contain further domains. For example, the CAR may comprise domains that confer the ability on the CAR to provide a productive IL signal to the cell in which it is expressed in an antigen specific manner, without requiring exogenous IL to be administered. For example, it may comprise a domain comprising a STAT5 association motif, a JAK1 and / or JAK 2 binding motif and optionally a JAK 3 binding motif. In such an embodiment the endodomain may comprise one or more sequences from an endodomain of a cytokine receptor, for example an interleukin receptor (IL) receptor. Such CARs are described in WO2020 / 044055 (also incorporated herein by reference). Exemplary amino acid sequences derived from IL-2 receptor beta that include STAT5 association motif and JAK binding motifs are provided in SEQ ID NOs: 271-273. The inclusion of such domains confers the ability on the CAR to provide a productive IL signal to the cell in which it is expressed in an antigen-specific manner, without requiring exogenous IL to be administered. For example, IL-2 is important for the survival, proliferation and persistence of Treg cells, but IL-2 levels may frequently be low or impaired in patients needing treatment. A CAR may thus comprise a sequence corresponding to all or part of a β chain endodomain of an IL receptor or a variant thereof, such as the IL2 receptor, optionally in combination with the γ chain endodomain of an IL receptor or a variant thereof, such as the IL2 receptor. FOXP3The nucleic acid molecule of the present invention may be designed to increase FOXP3 expression incells (e.g., Tregs) by introducing into the cells a nucleotide sequence encoding FOXP3, which term is synonymous with the term “a FOXP3 polypeptide”. The nucleic acid molecule, and constructs and vectors containing it, thus provide a means for increasing FOXP3 in a cell, e.g., in a Treg or a CD4+ cell. Thus, the invention provides a cell comprising a nucleic acid molecule comprising a nucleotide sequence encoding a CAR and a nucleotide sequence encoding FOXP3, particularly a pluripotent cell (e.g. an iPSC), an HPC cell (e.g. expressing CD34), a CD4+ T cell or a Treg cell.“FOXP3” is the abbreviated name of the forkhead box P3 protein. FOXP3 is a member of the FOXprotein family of transcription factors and functions as a master regulator of the regulatory pathway in the development and function of regulatory T cells. “FOXP3” as used herein encompasses variants, isoforms, and functional fragments of FOXP3. “Increasing FOXP3 expression” means to increase the levels of FOXP3 mRNA and / or protein in a cell (or population of cells) in comparison to a corresponding cell which has not been modified (or population of cells) by introduction of the nucleic acid molecule or vector. For example, the level of FOXP3 mRNA and / or protein in a cell modified according to the present invention (or a population of such cells) may be increased to at least 1.5-fold, at least 2-fold, at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 150-fold greater than the level in a corresponding cell which has not been modifiedaccording to the present invention (or population of such cells). Optionally the cell is a Treg or thepopulation of cells is a population of Tregs. Suitably, the level of FOXP3 mRNA and / or protein in a modified cell (or a population of such cells) may be increased to at least 1.5-fold greater, 2-fold greater, or 5-fold greater than the level in a correspondingcell which has not been so modified (or population of such cells). Optionally the cell is a Treg or thepopulation of cells is a population of Tregs. Techniques for measuring the levels of specific mRNA and protein are well known in the art. mRNAlevels in a population of cells, such as Tregs, may be measured by techniques such as the Affymetrixebioscience prime flow RNA assay, Northern blotting, serial analysis of gene expression (SAGE) orquantitative polymerase chain reaction (qPCR). Protein levels in a population of cells may be measuredby techniques such as flow cytometry, high-performance liquid chromatography (HPLC), liquid chromatography-mass spectrometry (LC / MS), Western blotting or enzyme-linked immunosorbent assay (ELISA).A “FOXP3 polypeptide” is a polypeptide having FOXP3 activity i.e., a polypeptide able to bind FOXP3target DNA and function as a transcription factor regulating development and function of Tregs. Particularly, a FOXP3 polypeptide may have the same or similar activity to wildtype FOXP3 (SEQ ID NO.200), e.g., may have at least 40, 50, 60, 70, 80, 90, 95, 100, 110, 120, 130, 140 or 150% of the activity of the wildtype FOXP3 polypeptide. Thus, a FOXP3 polypeptide encoded by the nucleotidesequence in the nucleic acid molecule described herein may have increased or decreased activitycompared to wildtype FOXP3. Techniques for measuring transcription factor activity are well known in the art. For example, transcription factor DNA-binding activity may be measured by ChIP. The transcription regulatory activity of a transcription factor may be measured by quantifying the level of expression of genes which it regulates. Gene expression may be quantified by measuring the levels of mRNA and / or protein produced from the gene using techniques such as Northern blotting, SAGE, qPCR, HPLC, LC / MS, Western blotting or ELISA. Genes regulated by FOXP3 include cytokines such as IL-2, IL-4 and IFN-γ (Siegler et al. Annu. Rev. Immunol.2006, 24: 209-26, incorporated herein byreference). As discussed in detail below, FOXP3 or a FOXP3 polypeptide includes functionalfragments, variants, and isoforms thereof, e.g., of SEQ ID NO.200.A “functional fragment of FOXP3” may refer to a portion or region of a FOXP3 polypeptide or apolynucleotide (i.e., nucleotide sequence) encoding a FOXP3 polypeptide that has the same or similar activity to the full-length FOXP3 polypeptide or polynucleotide. The functional fragment may have at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the activity of the full-length FOXP3 polypeptide or polynucleotide. A person skilled in the art would be able to generate functional fragments based on the known structural and functional features ofFOXP3. These are described, for instance, in Song, X., et al., 2012. Cell reports, 1(6), pp.665-675;Lopes, J.E., et al., 2006. The Journal of Immunology, 177(5), pp.3133-3142; and Lozano, T., et al, 2013. Frontiers in oncology, 3, p.294. Further, a N and C terminally truncated FOXP3 fragment is described within WO2019 / 241549 (incorporated herein by reference), for example, having the sequence SEQ IDNO. 201 as discussed below.A “FOXP3 variant” may include an amino acid sequence or a nucleotide sequence which may be at least 50%, at least 55%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85% or at least90% identical, optionally at least 95% or at least 97% or at least 99% identical to a FOXP3 polypeptideor a polynucleotide encoding a FOXP3 polypeptide, e.g., to SEQ ID NO.200. FOXP3 variants may have the same or similar activity to a wildtype FOXP3 polypeptide or polynucleotide, e.g., may have at least 40, 50, 60, 70, 80, 90, 95, 100, 110, 120, 130, 140 or 150% of the activity of a wildtype FOXP3 polypeptide or polynucleotide. A person skilled in the art would be able to generate FOXP3 variants based on the known structural and functional features of FOXP3 and / or using conservative substitutions. FOXP3 variants may have similar or the same turnover time (or degradation rate) within a Treg cell as compared to wildtype FOXP3, e.g., at least 40, 50, 60, 70, 80, 90, 95, 99 or 100% of the turnover time (or degradation rate) of wildtype FOXP3 in a Treg. Some FOXP3 variants may have a reduced turnover time (or degradation rate) as compared to wildtype FOXP3, for example, FOXP3 variants having amino acid substitutions at amino acid 418 and / or 422 of SEQ ID NO.200, for example S418E and / or S422A, as described in WO2019 / 241549 (incorporated herein by reference) and are setout in SEQ ID NO.s 202 to 204, which represent the aa418, aa422 and aa418 and aa422 mutantsrespectively. Suitably, the FOXP3 polypeptide encoded by a nucleic acid molecule, construct or vector as described herein may comprise or consist of the polypeptide sequence of a human FOXP3, such as UniProtKB accession Q9BZS1 (SEQ ID NO: 200), or a functional fragment or variant thereof. In some embodiments of the invention, the FOXP3 polypeptide comprises or consists of an amino acid sequence which is at least 70% identical to SEQ ID NO: 200 or a functional fragment thereof. Suitably,the FOXP3 polypeptide comprises or consists of an amino acid sequence which is at least 80%, at least85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 200 or a functionalfragment thereof. In some embodiments, the FOXP3 polypeptide comprises or consists of SEQ ID NO:200 or a functional fragment thereof.In some embodiments, as discussed above, the FOXP3 polypeptide may comprise mutations at residues 418 and / or 422 of SEQ ID NO.200, as set out in SEQ ID NO.202, SEQ ID NO.203, or SEQ ID NO.204. In some embodiments of the invention, the FOXP3 polypeptide may be truncated at the N and / or C terminal ends, resulting in the production of a functional fragment. Particularly, an N and C terminally truncated functional fragment of FOXP3 may comprise or consist of an amino acid sequence of SEQID NO. 201 or a functional variant thereof having at least 80, 85, 90, 95 or 99% identity thereto.Suitably, the FOXP3 polypeptide may be a variant of SEQ ID NO: 200, for example a natural variant. Suitably, the FOXP3 polypeptide is an isoform of SEQ ID NO: 200. For example, the FOXP3 polypeptide may comprise a deletion of amino acid positions 72-106 relative to SEQ ID NO: 200. Alternatively, theFOXP3 polypeptide may comprise a deletion of amino acid positions 246-272 relative to SEQ ID NO:200.Suitably, the FOXP3 polypeptide comprises SEQ ID NO: 205 or a functional fragment thereof. SEQ IDNO: 205 represents an illustrative FOXP3 polypeptide.Suitably the FOXP3 polypeptide comprises or consists of an amino acid sequence which is at least 70%identical to SEQ ID NO: 205 or a functional fragment thereof. Suitably, the FOXP3 polypeptidecomprises an amino acid sequence which is at least 80%, at least 85%, at least 90%, at least 95%, atleast 98% or at least 99% identical to SEQ ID NO: 205 or a functional fragment thereof. In someembodiments, the FOXP3 polypeptide comprises or consists of SEQ ID NO: 205 or a functionalfragment thereof. Suitably, the FOXP3 polypeptide may be a variant of SEQ ID NO: 205, for example a natural variant.Suitably, the FOXP3 polypeptide is an isoform of SEQ ID NO: 205 or a functional fragment thereof. Forexample, the FOXP3 polypeptide may comprise a deletion of amino acid positions 72-106 relative to SEQ ID NO: 205. Alternatively, the FOXP3 polypeptide may comprise a deletion of amino acid positions 246-272 relative to SEQ ID NO: 205.Suitably, the polynucleotide encoding a FOXP3 polypeptide comprises or consists of a nucleotidesequence set forth in SEQ ID NO: 206, which represents an illustrative FOXP3 nucleotide sequence.In some embodiments of the invention, the polynucleotide encoding the FOXP3 polypeptide or variantcomprises nucleotide sequence which is at least 70% identical to SEQ ID NO: 206 or a fragment thereofwhich encodes a functional FOXP3 polypeptide. Suitably, the polynucleotide encoding the FOXP3polypeptide or variant comprises a polynucleotide sequence which is at least 80%, at least 85%, atleast 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 206 or a fragment thereofwhich encodes a functional FOXP3 polypeptide. In some embodiments of the invention, the polynucleotide encoding the FOXP3 polypeptide or variant comprises or consists of SEQ ID NO: 206 or a fragment thereof which encodes a functional FOXP3 polypeptide.Suitably, the polynucleotide encoding a FOXP3 polypeptide comprises or consists of a polynucleotidesequence set forth in SEQ ID NO: 207, which represents another illustrative FOXP3 nucleotide. In some embodiments of the invention, the polynucleotide encoding the FOXP3 polypeptide or variantcomprises a nucleotide sequence which is at least 70% identical to SEQ ID NO: 207 or a fragmentthereof which encodes a functional FOXP3 polypeptide. Suitably, the polynucleotide encoding theFOXP3 polypeptide or variant comprises a polynucleotide sequence which is at least 80%, at least85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 207 or a fragmentthereof which encodes a functional FOXP3 polypeptide. In some embodiments of the invention, the polynucleotide encoding the FOXP3 polypeptide or variant comprises or consists of SEQ ID NO: 207 or a fragment thereof which encodes a functional FOXP3 polypeptide. A skilled person will appreciate that FOXP3 expression within a Treg may be increased indirectly by introducing a polynucleotide into the cell which encodes a protein which increases transcription and / or translation of FOXP3 or which increases the half life (e.g. by at least 10, 20, 30, 40, 50, 60, 70, 80 or 90%) or function of FOXP3 (e.g. determined by suppressive ability of a transduced Treg, measured as previously discussed). For example, it may be possible to introduce a polynucleotide into a Treg which increases transcription of endogenous FOXP3 by interacting with the endogenous FOXP3 promoter or non-coding sequences (CNS, e.g. CNS1, 2 or 3) which are found upstream of the coding region. Suitably, the polynucleotide encoding the FOXP3 polypeptide or functional fragment or variant thereof may be codon optimised. Suitably, the polynucleotide encoding the FOXP3 polypeptide or functionalfragment or variant thereof may be codon optimised for expression in a human cell. Other TransgenesIn certain embodiments, the expression construct and / or the nucleic acid molecule of the invention doesnot comprise any further coding sequences (in addition to the sequences encoding the CAR and the FOXP3 polypeptide). In alternative embodiments, the expression construct and / or the nucleic acid molecule of the invention comprises one or more further coding sequences (in addition to the sequences encoding the CAR and the FOXP3 polypeptide). In certain embodiments, the expression construct and / or the nucleic acid molecule of the invention comprises one further coding sequence(s).The further coding sequence(s) may be selected from sequences which encode a molecule whichincreases the persistence of cells in which it is expressed, a safety switch polypeptide or a selectablemarker. The molecule which may be introduced into the cell or population of cells in order to improve persistenceof the cells may provide a productive IL signal to the cell without requiring exogenous IL to beadministered. Such IL signal may be constitutive or inducible. Exemplary technologies may, forexample, involve the use of engineered or chimeric receptors that can transmit an IL signal without requiring exogenous IL to be administered. For example, inducible engineered receptors such as those described in WO 2018 / 111834, WO 2019 / 169290 and WO 2020 / 264039; or constitutive engineered receptors such as those described in WO 2018 / 038954, WO 2019 / 102207, WO 2019 / 053420, WO 2020 / 180694 and WO 2017 / 218850; chimeric cytokine receptors such as those described in WO 2020 / 183131, WO 2017 / 029512, WO 2012 / 138858, WO 2014 / 172584, WO 2017 / 068360, WO 2021 / 023987, WO 2020 / 180664 and WO 2020 / 044239; or engineered receptors having a tethered activation molecule such as those described in WO 2017 / 201432 and WO 2019 / 183389. The safety switch polypeptide provides a cell in or on which it is expressed with a suicide moiety. This is useful as a safety mechanism which allows a cell which has been administered to a subject to be deleted should the need arise, or indeed more generally, according to desire or need, for example once a cell has performed or completed its therapeutic effect. A suicide moiety possesses an inducible capacity to lead to cellular death, or more generally to elimination or deletion of a cell. An example of a suicide moiety is a suicide protein, encoded by a suicide gene, which may be expressed in or on a cell alongside a desired transgene, in this case the CAR, which when expressed allows the cell to be deleted to turn off expression of the transgene (CAR). A suicide moiety herein is a suicide polypeptide that is a polypeptide that under permissive conditions, namely conditions that are induced or turned on, is able to cause the cell to be deleted.The suicide moiety may be a polypeptide, or amino acid sequence, which may be activated to performa cell-deleting activity by an activating agent which is administered to the subject, or which is active to perform a cell-deleting activity in the presence of a substrate which may be administered to a subject. In a particular embodiment, the suicide moiety may represent a target for a separate cell-deleting agent which is administered to the subject. By binding to the suicide moiety, the cell-deleting agent may be targeted to the cell to be deleted. In particular, the suicide moiety may be recognised by an antibody, and binding of the antibody to the safety switch polypeptide, when expressed on the surface of a cell, causes the cell to be eliminated, or deleted. The suicide moiety may be HSV-TK or iCasp9. However, the suicide moiety may be, or comprise, an epitope which is recognised by a cell-deleting antibody or other binding molecule capable of eliciting deletion of the cell. In such an embodiment, the safety switch polypeptide is expressed on the surface of a cell. The term “delete” as used herein in the context of cell deletion is synonymous with “remove” or “ablate” or “eliminate”. The term is used to encompass cell killing, or inhibition of cell proliferation, such that the number of cells in the subject may be reduced.100% complete removal may be desirable but may not necessarily be achieved. Reducing the number of cells, or inhibiting their proliferation, in the subject may be sufficient to have a beneficial effect. In particular, the suicide moiety may be a CD20 epitope which is recognised by the antibody Rituximab. Thus, in the safety switch polypeptide the suicide moiety may comprise a minimal epitope based on the epitope from CD20 that is recognised by the antibody Rituximab. Biosimilars for Rituximab are available and may be used. A person of skill in the art is readily able to use routine methods to prepare an antibody having the binding specificity of Rituximab using the available amino acid sequences therefor. CAR-cells specific for antigen, which also express a safety switch polypeptide comprising this sequence can be selectively killed using the antibody Rituximab, or an antibody having the binding specificity of Rituximab. The safety switch polypeptide is expressed on the cell surface and when the expressed polypeptide is exposed to or contacted with Rituximab, or an antibody with the same binding specificity, death of the cell ensues. Thus, Rituximab, or an antibody having the binding specificity thereof, may be provided for use in ACT in combination with a cell of the invention. The cell or nucleic acid or vector or construct for production of the cell and the Rituximab or equivalent antibody may be provided in a kit, or as a combination product. For example, the suicide constructs of WO2013 / 153391 or WO2021 / 239812 (both incorporated herein by reference) may be used in a cell or cell population (e.g., Treg or Treg population) as described herein.A further coding sequence may encode a selectable marker. Suitably selectable markers are wellknown in the art and include, but are not limited to, fluorescent proteins – such as GFP. Suitably, theselectable marker may be a fluorescent protein, for example GFP, YFP, RFP, tdTomato, dsRed, or variants thereof. In some embodiments the fluorescent protein is GFP or a GFP variant. Suitably, the selectable marker / reporter domain may be a luciferase-based reporter, a PET reporter (e.g. Sodium Iodide Symporter (NIS)), or a membrane protein (e.g. CD34, or Thy1.1). The use of a selectable marker is advantageous as it allows cells (e.g., Tregs) in which an expressionconstruct, nucleic acid molecule or vector of the present invention has been successfully introduced(such that the encoded CAR and FOXP3 are expressed) to be selected and isolated from a starting cell population using common methods, e.g., flow cytometry. Vector A vector is a tool that allows or facilitates the transfer of an entity from one environment to another. As used herein, and by way of example, some vectors used in recombinant nucleic acid techniques allow entities, such as a segment of nucleic acid (e.g., a heterologous DNA segment, such as a heterologous cDNA segment), to be transferred into a target cell. Vectors may be non-viral or viral. Examples of vectors used in recombinant nucleic acid techniques include, but are not limited to, plasmids, mRNA molecules (e.g., in vitro transcribed mRNAs), chromosomes, artificial chromosomes and viruses. The vector may also be, for example, a naked nucleic acid (e.g., DNA). In its simplest form, the vector may itself be a nucleic acid molecule. The vectors used herein may be, for example, plasmid, mRNA or virus vectors and may include a promoter (as described above) for the expression of a nucleic acid molecule / polynucleotide and optionally a regulator of the promoter. In an embodiment the vector is a viral vector, for example a retroviral, e.g., a lentiviral vector or a gamma retroviral vector. The vectors may further comprise additional promoters, for example, in one embodiment, the promotermay be a LTR, for example, a retroviral LTR or a lentiviral LTR. Long terminal repeats (LTRs) areidentical sequences of DNA that repeat hundreds or thousands of times found at either end of retrotransposons or proviral DNA formed by reverse transcription of retroviral RNA. They are used by viruses to insert their genetic material into the host genomes. Signals of gene expression are found in LTRs: enhancer, promoter (can have both transcriptional enhancers or regulatory elements),transcription initiation (such as capping), transcription terminator and polyadenylation signal. Suitably,the vector may include a 5’LTR and a 3’LTR.The vector may comprise one or more additional regulatory sequences which may act pre- or post-transcriptionally. “Regulatory sequences” are any sequences which facilitate expression of the polypeptides, e.g., act to increase expression of a transcript or to enhance mRNA stability. Suitable regulatory sequences include for example enhancer elements, post-transcriptional regulatory elements and polyadenylation sites. Suitably, the additional regulatory sequences may be present in the LTR(s). Suitably, the vector may comprise a Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element (WPRE), e.g., operably linked to the promoter. Vectors comprising the present expression constructs and / or nucleic acid molecules may be introduced into cells using a variety of techniques known in the art, such as transformation and transduction. Several techniques are known in the art, for example infection with recombinant viral vectors, such as retroviral, lentiviral, adenoviral, adeno-associated viral, baculoviral and herpes simplex viral vectors; direct injection of nucleic acids and biolistic transformation. Non-viral delivery systems include but are not limited to DNA transfection methods. Here, transfection includes a process using a non-viral vector to deliver a gene to a target cell. Non-viral delivery systems can include liposomal or amphipathic cell penetrating peptides, optionally complexed with a nucleic acid molecule or construct. Typical transfection methods include electroporation, DNA biolistics, lipid-mediated transfection, compacted DNA-mediated transfection, liposomes, immunoliposomes, lipofectin, cationic agent- mediated transfection, cationic facial amphiphiles (CFAs) (Nat. Biotechnol. (1996) 14: 556) and combinations thereof.Although the present expression constructs and nucleic acid molecules are designed to be used assingle constructs, and this would be contained in a single vector, it is not precluded that they are introduced into a cell in conjunction with other vectors, for example encoding other polypeptides it may be desired also to introduce into the cell.Engineered cells may be generated by introducing an expression construct, nucleic acid molecule, orvector as defined herein, by one of many means including transduction with a viral vector, andtransfection with DNA or RNA. Cells The cell may be an immune cell, or a precursor therefor. A precursor cell may be a progenitor cell.Representative immune cells thus include T-cells, in particular, cytotoxic T-cells (CTLs; CD8+ T-cells),helper T-cells (HTLs; CD4+ T-cells) and regulatory T cells (Tregs). Other populations of T-cells are also useful herein, for example naive T-cells and memory T-cells. Other immune cells include NK cells, NKT cells, tolerogenic NK or NKT cells, dendritic cells, MDSC, neutrophils, and macrophages. Precursors of immune cells include pluripotent stem cells, e.g., induced PSC (iPSC), or more committed progenitors including multipotent stem cells (e.g. HPCs), or cells which are committed to a lineage. Precursor cellscan be induced to differentiate into immune cells in vivo or in vitro. In one aspect, a precursor cell maybe a somatic cell which is capable of being transdifferentiated to an immune cell of interest. Most notably, the immune cell may be an NK cell, a dendritic cell, a MDSC, or a T cell, such as a cytotoxic T lymphocyte (CTL), helper T cell or a Treg cell. In an embodiment the immune cell is a Treg cell. “Regulatory T cells (Treg) or T regulatory cells” are immune cells with immunosuppressive function that control cytopathic immune responses and are essential for the maintenance of immunological tolerance. As used herein, the term Treg refers to a T cell with immunosuppressive function. A T cell as used herein is a lymphocyte including any type of T cell, such as an alpha beta T cell (e.g., CD8 or CD4+), a gamma delta T cell, a memory T cell, a Treg cell.Suitably, immunosuppressive function may refer to the ability of the Treg to reduce or inhibit one ormore of a number of physiological and cellular effects facilitated by the immune system in response to a stimulus such as a pathogen, an alloantigen, or an autoantigen. Examples of such effects include increased proliferation of conventional T cell (Tconv) and secretion of proinflammatory cytokines. Any such effects may be used as indicators of the strength of an immune response. A relatively weaker immune response by Tconv in the presence of Tregs would indicate an ability of the Treg to suppress immune responses. For example, a relative decrease in cytokine secretion would be indicative of a weaker immune response, and thus indicative of the ability of Tregs to suppress immune responses.Tregs can also suppress immune responses by modulating the expression of co-stimulatory moleculeson antigen presenting cells (APCs), such as B cells, dendritic cells and macrophages. Expression levelsof CD80 and CD86 can be used to assess suppression potency of activated Tregs in vitro after co-culture. Assays are known in the art for measuring indicators of immune response strength, and thereby the suppressive ability of Tregs. In particular, antigen-specific Tconv cells may be co-cultured with Tregs, and a peptide of the corresponding antigen added to the co-culture to stimulate a response from the Tconv cells. The degree of proliferation of the Tconv cells and / or the quantity of the cytokine IL-2 they secrete in response to addition of the peptide may be used as indicators of the suppressive abilities of the co-cultured Tregs. Antigen-specific Tconv cells co-cultured with Tregs as disclosed herein may proliferate 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 90%, 95% or 99% less than the same Tconv cells cultured in the absence of the Tregs. For example, antigen-specific Tconv cells co-cultured with the present Tregs may proliferate 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 90%, 95% or 99% less than the same Tconv cells cultured in the presence of non-engineered Tregs. The cells comprising the nucleic acid, expression construct or vector as defined herein, e.g., Tregs, may have an increased suppressive activity as compared to non-engineered Tregs (e.g., an increased suppressive activity of at least 5, 10, 20, 30, 40, 50, 60, 70, 80 or 90%). Antigen-specific Tconv cells co-cultured with the Tregs herein may express at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% less effector cytokine than corresponding Tconv cells cultured in the absence of the Tregs (e.g., in the presence of non-engineered Tregs).The effector cytokine may be selected from IL-2, IL-17, TNFα, GM-CSF, IFN-γ, IL-4, IL-5, IL-9, IL-10 and IL- 13. Suitably the effector cytokine may be selected from IL-2, IL-17, TNFα, GM-CSF and IFN-γ. Several different subpopulations of Tregs have been identified which may express different or different levels of particular markers. Tregs generally are T cells which express the markers CD4, CD25 and FOXP3 (CD4+CD25+FOXP3+). Tregs may also express CTLA-4 (cytotoxic T-lymphocyte associated molecule-4) or GITR (glucocorticoid-induced TNF receptor). Treg cells are present in the peripheral blood, lymph nodes, and tissues and Tregs for use herein include thymus-derived, natural Treg (nTreg) cells, peripherally generated Tregs, and induced Treg (iTreg) cells. A Treg may be identified using the cell surface markers CD4 and CD25 in the absence of or in combination with low-level expression of the surface protein CD127 (CD4+CD25+CD127−or CD4+CD25+CD127low). The use of such markers to identify Tregs is known in the art and described inLiu et al. (JEM; 2006; 203; 7(10); 1701-1711), for example.A Treg may be a CD4+CD25+FOXP3+T cell, a CD4+CD25+CD127−T cell, or a CD4+CD25+FOXP3+CD127− / lowT cell. Suitably, the Treg may be a natural Treg (nTreg). As used herein, the term “natural T reg” means a thymus-derived Treg. Natural Tregs are CD4+CD25+FOXP3+Helios+Neuropilin 1+. Compared with iTregs, nTregs have higher expression of PD-1 (programmed cell death-1, pdcd1), neuropilin 1 (Nrp1), Helios (Ikzf2), and CD73. nTregs may be distinguished from iTregs on the basis of the expression of Helios protein or Neuropilin 1 (Nrp1) individually. The Treg may have a demethylated Treg-specific demethylated region (TSDR). The TSDR is an important methylation-sensitive element regulating Foxp3 expression (Polansky, J.K., et al., 2008. European journal of immunology, 38(6), pp.1654-1663).Further suitable Tregs include, but are not limited to, Tr1 cells (which do not express Foxp3, and havehigh IL-10 production); CD8+FOXP3+T cells; and γδ FOXP3+T cells. Different subpopulations of Tregs are known to exist, including naïve Tregs (CD45RA+FoxP3low), effector / memory Tregs (CD45RA-FoxP3high) and cytokine-producing Tregs (CD45RA-FoxP3low). “Memory Tregs” are Tregs which express CD45RO and which are considered to be CD45RO+. These cells have increased levels of CD45RO as compared to naïve Tregs (e.g. at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% more CD45RO) and which optionally do not express or have low levels of CD45RA (mRNA and / or protein) as compared to naïve Tregs (e.g. at least 80, 90 or 95% less CD45RA as compared to naïve Tregs). “Cytokine-producing Tregs” are Tregs which do not express or have very low levels of CD45RA (mRNA and / or protein) as compared to naïve Tregs (e.g. at least 80, 90 or 95% less CD45RA as compared to naïve Tregs), and which have low levels of FOXP3 as compared to Memory Tregs, e.g. less than 50, 60, 70, 80 or 90% of the FOXP3 as compared to Memory Tregs. Cytokine-producing Tregs may produce interferon gamma and may be less suppressive in vitro as compared to naïve Tregs (e.g., less than 50, 60, 70, 80 or 90% suppressive than naïve Tregs). Reference to expression levels herein may refer to mRNA or protein expression. Particularly, for cell surface markers such as CD45RA, CD25, CD4, CD45RO etc, expression may refer to cell surface expression, i.e., the amount or relative amount of a marker protein that is expressed on the cell surface. Expression levels may be determined by any known method of the art. For example, mRNA expression levels may be determined by Northern blotting / array analysis, and protein expression may be determined by Western blotting, or optionally by FACS using antibody staining for cell surface expression. Particularly, the Treg may be a naïve Treg. “A naïve regulatory T cell, a naïve T regulatory cell, or a naïve Treg” as used interchangeably herein refers to a Treg cell which expresses CD45RA (particularly which expresses CD45RA on the cell surface). Naïve Tregs are thus described as CD45RA+. Naïve Tregs generally represent Tregs which have not been activated through their endogenous TCRs bypeptide / MHC, whereas effector / memory Tregs relate to Tregs which have been activated by stimulationthrough their endogenous TCRs. Typically, a naïve Treg may express at least 10, 20, 30, 40, 50, 60,70, 80 or 90% more CD45RA than a Treg cell which is not naïve (e.g., a memory Treg cell). Alternativelyviewed, a naïve Treg cell may express at least 2, 3, 4, 5, 10, 50 or 100-fold the amount of CD45RA ascompared to a non-naïve Treg cell (e.g., a memory Treg cell). The level of expression of CD45RA can be readily determined by methods of the art, e.g., by flow cytometry using commercially available antibodies. Typically, non-naïve Treg cells do not express CD45RA or low levels of CD45RA. Particularly, naïve Tregs may not express CD45RO, and may be considered to be CD45RO-. Thus, naïve Tregs may express at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% less CD45RO as compared to a memory Treg, or alternatively viewed at least 2, 3, 4, 5, 10, 50 or 100 fold less CD45RO than a memory Treg cell. Although naïve Tregs express CD25 as discussed above, CD25 expression levels may be lower than expression levels in memory Tregs, depending on the origin of the naïve Tregs. For example, for naïve Tregs isolated from peripheral blood, expression levels of CD25 may be at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% lower than memory Tregs. Such naïve Tregs may be considered to express intermediate to low levels of CD25. However, a skilled person will appreciate that naïve Tregs isolated from cord blood may not show this difference. Typically, a naïve Treg as defined herein may be CD4+, CD25+, FOXP3+, CD127low, CD45RA+. Low expression of CD127 as used herein refers to a lower level of expression of CD127 as comparedto a CD4+ non-regulatory or Tcon cell from the same subject or donor. Particularly, naïve Tregs mayexpress less than 90, 80, 70, 60, 50, 40, 30, 20 or 10% CD127 as compared to a CD4+non-regulatoryor Tcon cell from the same subject or donor. Levels of CD127 can be assessed by methods standardin the art, including by flow cytometry of cells stained with an anti-CD127 antibody. Typically, naïve Tregs do not express, or express low levels of CCR4, HLA-DR, CXCR3 and / or CCR6. Particularly, naïve Tregs may express lower levels of CCR4, HLA-DR, CXCR3 and CCR6 than memory Tregs, e.g., at least 10, 20, 30, 40, 50, 60, 70, 80 or 90% lower level of expression. Naïve Tregs may further express additional markers, including CCR7+and CD31+. Isolated naïve Tregs may be identified by methods known in the art, including by determining the presence or absence of a panel of any one or more of the markers discussed above, on the cell surface of the isolated cells. For example, CD45RA, CD4, CD25 and CD127 low can be used to determinewhether a cell is a naïve Treg. Methods of determining whether isolated cells are naïve Tregs or havea desired phenotype can be carried out as discussed below in relation to additional steps which maybe carried out, and methods for determining the presence and / or levels of expression of cell markersare well-known in the art and include, for example, flow cytometry, using commercially available antibodies. Suitably, the cell, such as a Treg, is isolated from peripheral blood mononuclear cells (PBMCs) obtained from a subject. Suitably the subject from whom the PBMCs are obtained is a mammal, optionally a human. Suitably the cell is matched (e.g. HLA matched) or is autologous to the subject to whom the engineered cell is to be administered. Suitably, the subject to be treated is a mammal, optionally ahuman. The cell may be generated ex vivo either from a patient’s own peripheral blood (1st party), orin the setting of a haematopoietic stem cell transplant from donor peripheral blood (2nd party), or peripheral blood from an unconnected donor (3rd party). Suitably the cell is autologous to the subject to whom the engineered cell is to be administered. Suitably, the Treg is part of a population of cells. Suitably, the population of Tregs comprises at least 70 % Tregs, such as at least 75, 85, 90, 95, 97, 98 or 99 % Tregs. Such a population may be referred to as an “enriched Treg population”.In some aspects, the Treg may be derived from ex-vivo differentiation of inducible progenitor cells (e.g.iPSCs) or embryonic progenitor cells to the Treg. An expression construct, nucleic acid molecule orvector as described herein may be introduced into the inducible progenitor cells or embryonic progenitorcells prior to, or after, differentiation to a Treg. Suitable methods for differentiation are known in the art and include that disclosed in Haque et al, J Vis Exp., 2016, 117, 54720 (incorporated herein by reference). As used herein, the term “conventional T cell” or Tcon or Tconv (used interchangeably herein) means a T lymphocyte cell which expresses an αβ T cell receptor (TCR) as well as a co-receptor which may be cluster of differentiation 4 (CD4) or cluster of differentiation 8 (CD8) and which does not have an immunosuppressive function. Conventional T cells are present in the peripheral blood, lymph nodes, and tissues. Suitably, the engineered Treg may be generated from a Tcon by introducing the nucleic acid which includes a sequence coding for FOXP3. Alternatively, the engineered Treg may begenerated from a Tcon by in vitro culture of CD4+CD25-FOXP3- cells in the presence of IL-2 and TGF-β. In another embodiment the target cell into which the nucleic acid molecule, expression construct or vector is introduced is not a cell intended for therapy. In an embodiment the cell is a production hostcell. The cell may be for production of the expression construct or nucleic acid, e.g., cloning, or vector,or polypeptides. The invention also provides a cell population comprising a cell as defined or described herein. It will be appreciated that a cell population may comprise both cells of the invention comprising a nucleic acid molecule, expression construct or vector as defined herein, and cells which do not comprise a nucleic acid molecule, expression construct or vector of the invention, e.g., untransduced or untransfected cells. Although in an embodiment, all the cells in a population may comprise a nucleic acid, expression construct or vector of the invention, cell populations having at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 95 or 99% of cells comprising a nucleic acid, expression construct or vector of the invention are provided. Further, the population of cells may comprise more than one cell type, although in an embodiment, at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 95 or 99% of the cells are of the same type. Particularly, a cell population may comprise at least 70, 80, 90, 95 or 99% of Tcells, more particularly Tregs. Additionally, at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 95 or 99% of the Tcells, particularly Tregs may comprise a nucleic acid, expression construct or vector of the invention. In particular, the invention provides a cell population comprising a plurality of cells comprising anexpression construct or nucleic acid molecule of the invention.Methods of Making The present cell may be made by: introducing to a cell (e.g. by transduction or transfection) theexpression construct, nucleic acid molecule or vector as defined herein.Suitable cells are discussed further above, but the cell may be from a sample isolated from a subject. The subject may be a donor subject, or a subject for therapy (i.e., the cell may be an autologous cell, or a donor cell, for introduction to another recipient, e.g., an allogeneic cell). The cell may be generated by a method comprising the following steps: (i) isolation of a cell-containing sample from a subject or provision of a cell-containing sample; and (ii) introduction into (e.g., by transduction or transfection) the cell-containing sample of anexpression construct, nucleic acid molecule or vector as defined herein, to provide a population ofengineered cells. A target cell-enriched sample may be isolated from, enriched, and / or generated from the cell-containing sample prior to and / or after step (ii) of the method. For example, isolation, enrichment and / or generation of Tregs (or other target cells) may be performed prior to and / or after step (ii) to isolate, enrich or generate a Treg-enriched sample. Isolation and / or enrichment from a cell-containing sample may beperformed after step (ii) to enrich for cells and / or Tregs (or other target cells) comprising the expressionconstruct, nucleic acid molecule or the vector as described herein.A Treg-enriched sample may be isolated or enriched by any method known to those of skill in the art, for example by FACS and / or magnetic bead sorting. A Treg-enriched sample may be generated from the cell-containing sample by any method known to those of skill in the art, for example, from Tcon cells by introducing DNA or RNA coding for FOXP3 and / or from ex-vivo differentiation of inducible progenitor cells or embryonic progenitor cells. Methods for isolating and / or enriching other target cells are knownin the art.Suitably, an engineered target cell may be generated by a method comprising the following steps: (i) isolation of a target-cell enriched sample from a subject or provision of a target cell-enriched sample; and (ii) introduction into (e.g., by transduction or transfection) the target cell-enriched sample of a nucleic acid, expression construct or vector as defined herein, to provide a population of engineered target cells. The target cell may be a Treg cell, or precursor or a progenitor thereof. An “engineered cell” means a cell which has been modified to comprise or express a polynucleotide which is not naturally encoded by the cell. Methods for engineering cells are known in the art and include, but are not limited to, genetic modification of cells e.g., by transduction such as retroviral orlentiviral transduction, transfection (such as transient transfection – DNA or RNA based) includinglipofection, polyethylene glycol, calcium phosphate and electroporation, as discussed above. Anysuitable method may be used to introduce an expression construct or nucleic acid into a cell. Non-viraltechnologies such as amphipathic cell penetrating peptides may be used to introduce nucleic acid. A cell may also be genetically modified e.g. using any known gene editing technique to insert anexpression construct, nucleotide, polynucleotide or nucleic acid sequence as described herein into thegenome, e.g. using CRISPR, Talens or Zn fingers. Accordingly, the expression construct or nucleic acid molecule as described herein is not naturally expressed by a corresponding, unmodified cell. Indeed, the expression construct or nucleic acidmolecule encoding the CAR is an artificial construct such that it could not occur or be expressednaturally. Suitably, an engineered cell is a cell which has been modified e.g., by transduction or by transfection. Suitably, an engineered cell is a cell which has been modified or whose genome has been modified e.g., by transduction or by transfection. Suitably, an engineered cell is a cell which has been modified or whose genome has been modified by retroviral transduction. Suitably, an engineered cell is a cell which has been modified or whose genome has been modified by lentiviral transduction.As used herein, the term “introduced” refers to methods for inserting foreign nucleic acid, e.g., DNA orRNA, into a cell. As used herein the term introduced includes both transduction and transfection methods. Transfection is the process of introducing nucleic acids into a cell by non-viral methods. Transduction is the process of introducing foreign DNA or RNA into a cell via a viral vector. Engineeredcells may be generated by introducing an expression construct or nucleic acid as described herein byone of many means including transduction with a viral vector, transfection with DNA or RNA. Cells maybe activated and / or expanded prior to, or after, the introduction of an expression construct or nucleicacid as described herein, for example by treatment with an anti-CD3 monoclonal antibody or both anti- CD3 and anti-CD28 monoclonal antibodies. The cells may also be expanded in the presence of anti- CD3 and anti-CD28 monoclonal antibodies in combination with IL-2. Suitably, IL-2 may be substituted with IL-15. Other components which may be used in a cell (e.g., Treg) expansion protocol include, but are not limited to rapamycin, all-trans retinoic acid (ATRA) and TGFβ. As used herein “activated” means that a cell has been stimulated, causing the cell to proliferate. As used herein “expanded” means that a cell or population of cells has been induced to proliferate. The expansion of a population of cells may be measured for example by counting the number of cells present in a population. The phenotype of the cells may be determined by methods known in the art such as flow cytometry.Pharmaceutical Compositions and Therapeutic UsesThere is also provided a pharmaceutical composition comprising a cell or cell population as defined or described herein, or a vector as defined herein. The vector may be used for gene therapy. Thus, rather than administering a cell, a vector may be administered instead, to modify endogenous cells in the subject to express the introduced nucleic acid molecule. Vectors suitable for use in gene therapy are known in the art, and include viral vectors. Thus, in a further aspect, the invention provides a cell, cell population or pharmaceutical composition as defined herein for use in therapy. A pharmaceutical composition is a composition that comprises or consists of a therapeutically effective amount of a pharmaceutically active agent, i.e., the cell (e.g., Treg), cell population or vector. Itoptionally includes a pharmaceutically acceptable carrier, diluent or excipient (including combinationsthereof). Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985). The choice of pharmaceutical carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice. Thepharmaceutical compositions may comprise as - or in addition to - the carrier, excipient or diluent anysuitable binder(s), lubricant(s), suspending agent(s), coating agent(s) or solubilising agent(s). By “pharmaceutically acceptable” it is included that the formulation is sterile and pyrogen free. The carrier, diluent, and / or excipient must be “acceptable” in the sense of being compatible with the cell or vector and not deleterious to the recipients thereof. Typically, the carriers, diluents, and excipients will be saline or infusion media which will be sterile and pyrogen free, however, other acceptable carriers, diluents, and excipients may be used. Examples of pharmaceutically acceptable carriers include, for example, water, salt solutions, alcohol, silicone, waxes, petroleum jelly, vegetable oils, polyethylene glycols, propylene glycol, liposomes, sugars, gelatin, lactose, amylose, magnesium stearate, talc, surfactants, silicic acid, viscous paraffin, perfume oil, fatty acid monoglycerides and diglycerides, petroethral fatty acid esters, hydroxymethyl- cellulose, polyvinylpyrrolidone, and the like. The cells, cell population or pharmaceutical compositions may be administered in a manner appropriate for treating and / or preventing the desired disease or condition. The quantity and frequency of administration will be determined by such factors as the condition of the subject, and the type and severity of the subject's disease or condition, although appropriate dosages may be determined by clinical trials. The pharmaceutical composition may be formulated accordingly. The cell, cell population or pharmaceutical composition as described herein can be administered parenterally, for example, intravenously or intrathecally, or they may be administered by infusion techniques. The cell, cell population or pharmaceutical composition may be administered in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood. The aqueous solution may be suitably buffered (optionally to a pH of from 3 to 9). The pharmaceutical composition may be formulated accordingly. The preparation of suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well-known to those skilled in the art. The pharmaceutical compositions may comprise cells in infusion media, for example sterile isotonic solution. The pharmaceutical composition may be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. The cell, cell population or pharmaceutical composition may be administered in a single or in multiple doses. Particularly, the cell, cell population or pharmaceutical composition may be administered in a single, one-off dose. The pharmaceutical composition may be formulated accordingly. Depending upon the disease / condition and subject to be treated, as well as the route of administration, the cell, cell population or pharmaceutical composition may be administered at a specific stage of disease.In type 1 diabetes, for example, pancreatic beta cells are destroyed such that they cannot produceinsulin. Therefore, an optimum time to administer the cell, cell population or pharmaceutical composition of the invention may be at an early stage of the disease before all pancreatic beta cells have been destroyed, in order to maintain at least some functioning pancreatic beta cells (with residual pancreatic beta cell function) and maintain production of insulin. Particularly, at least 10, 20, 30, 40, 50, 60, 70,80, 90 or 95% of pancreatic beta cells may be present at the time of administration of the cell, cellpopulation or pharmaceutical composition described herein. Alternatively viewed, less than 5, 10, 20,30, 40, 50, 60, 70, 80 or 90% of the pancreatic beta cells may have been destroyed beforeadministration of the cell, cell population or pharmaceutical composition described herein. The pharmaceutical composition may further comprise one or more active agents. The pharmaceutical composition may further comprise one or more other therapeutic agents, such as lympho-depletive agents (e.g. thymoglobulin, campath-1H, anti-CD2 antibodies, anti-CD3 antibodies, anti-CD20 antibodies, cyclophosphamide, fludarabine), inhibitors of mTOR (e.g. sirolimus, everolimus), drugsinhibiting costimulatory pathways (e.g. anti-CD40 / CD40L, CTAL4Ig), and / or drugs inhibiting specificcytokines (IL-6, IL-17, TNFalpha, IL18). Depending upon the disease / condition and subject to be treated, as well as the route of administration, the cell, cell population or pharmaceutical composition may be administered at varying doses (e.g. measured in cells / kg or cells / subject). The physician in any event will determine the actual dosagewhich will be most suitable for any individual subject and it will vary with the age, weight and responseof the particular subject. Typically, however, for the cells herein, doses of 5x107to 3x109cells, or 108to 2x109cells per subject may be administered. The cell may be appropriately modified for use in a pharmaceutical composition. For example, cells may be cryopreserved and thawed at an appropriate time, before being infused into a subject. The invention further includes the use of kits comprising the cell, cell population and / or pharmaceutical composition herein. Optionally said kits are for use in the methods and uses as described herein, e.g.,the therapeutic methods as described herein. Optionally said kits comprise instructions for use of thekit components.The cell, cell population and pharmaceutical composition of the invention may find particular utility inthe treatment of disorders associated with cells that express antigen (e.g., ENTPD3), or with disorderswhere antigen (e.g., ENTPD3) is localised at or near the site of disease, particularly disorders that wouldbenefit from the immunosuppressive activity or target killing activity of the cells of the invention. The cells, cell populations, compositions and vectors herein may be for use in treating, preventing or reducing the risk of a disease or condition in a subject, notably a disease or condition which may be treated by or with the CAR. The cells and compositions containing them are for adoptive cell therapy (ACT). Various conditions may be treated by administration of cells, including particularly Treg cells, expressing a CAR according to the present disclosure. As noted above, this may be conditions responsive to immunosuppression, and particularly the immunosuppressive effects of Tregs cells. The cells, cell populations, compositions and vectors described herein may thus be used for inducing, or achieving, immunosuppression in a subject. The Treg cells administered, or modified in vivo, may betargeted by expression of the CAR. Conditions suitable for such treatment include inducing toleranceto a transplant, treating and / or preventing graft-versus-host disease (GvHD), infectious, allergic, autoimmune or inflammatory diseases (e.g. type I diabetes), or more broadly a condition associated with any undesired or unwanted or deleterious immune response. Additionally, the cells, cell populations, compositions and vectors herein may be for use in promoting tissue repair and / or tissue regeneration. Conditions to be treated or prevented include inflammation, or alternatively put, an inflammatory disease or a condition associated with or involving inflammation. Inflammation may be chronic or acute.Furthermore, the inflammation may be low-level or systemic inflammation. For example, theinflammation may be inflammation which occurs in the context of a metabolic disorder, for example metabolic syndrome, or in the context of insulin resistance, or type II diabetes or obesity and such like. As used herein, the term “inflammatory disease” refers to a disease or condition characterized by aberrant inflammation (e.g . an increased level of inflammation compared to a control such as a healthy person not suffering from a disease). Examples of inflammatory diseases include autoimmune diseases, arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, diabetes mellitus type 1, Guillain-Barre syndrome, Hashimoto’s encephalitis, Hashimoto’s thyroiditis, ankylosing spondylitis, psoriasis, Sjogren’s syndrome, vasculitis, glomerulonephritis, auto-immune thyroiditis, Behcet’s disease, bullous pemphigoid, sarcoidosis, ichthyosis, Graves ophthalmopathy, Addison’s disease,Vitiligo, asthma, allergic asthma, acne vulgaris, chronic prostatitis, pelvic inflammatory disease,reperfusion injury, ischemia reperfusion injury, stroke, sarcoidosis, transplant rejection, interstitial cystitis, atherosclerosis, scleroderma, and atopic dermatitis. As used herein, the term “autoimmune disease” refers to a disease or condition in which a subject’s immune system has an aberrant immune response against a substance that does not normally elicit an immune response in a healthy subject. Examples of autoimmune diseases include Acute Disseminated Encephalomyelitis (ADEM), Acute necrotizing hemorrhagic leukoencephalitis, Addison’s disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM / Anti-TBM nephritis, Antiphospholipid syndrome (APS), Autoimmune angioedema, Autoimmune aplastic anemia, Autoimmune dysautonomia, Autoimmune hepatitis, Autoimmune hyperlipidemia, Autoimmune immunodeficiency, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune thrombocytopenic purpura (ATP), Autoimmune thyroid disease, Autoimmune urticaria, Axonal or neuronal neuropathies, Balo disease, Behcet’s disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Chagas disease, Chronic fatigue syndrome, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, Cicatricial pemphigoid / benign mucosal pemphigoid, Cogans syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic’s disease (neuromyelitis optica), Discoid lupus, Dressler’s syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibromyalgia, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture’s syndrome, Granulomatosis with Polyangiitis (GPA) (formerly called Wegener’s Granulomatosis), Graves’ disease, Guillain-Barre syndrome, Hashimoto’s encephalitis, Hashimoto’s thyroiditis, Flemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile diabetes (Type 1 diabetes), Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (SLE), Lyme disease, chronic, Meniere’s disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren’s ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic’s), Neutropenia, Ocular cicatricialpemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric Autoimmune NeuropsychiatricDisorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis (peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatica, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Reiter’s syndrome, Relapsing polychondritis, Restless legs syndrome, Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Sarcoidosis, Schmidt syndrome, Scleritis, Scleroderma, Sjogren’ssyndrome, Sperm & testicular autoimmunity, Stiff person syndrome, Subacute bacterial endocarditis(SBE), Susac’s syndrome, Sympathetic ophthalmia, Takayasu’s arteritis, Temporal arteritis / Giant cell arteritis, Thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, Transverse myelitis, Type 1 diabetes, Undifferentiated connective tissue disease (UCTD), Uveitis, Vasculitis, Vesiculobullous dermatosis, Vitiligo, or Wegener’s granulomatosis ( / . e. , Granulomatosis with Polyangiitis (GPA). The autoimmune or allergic disease may be selected from inflammatory skin diseases including psoriasis and dermatitis (e.g. atopic dermatitis); allergic conditions such as food allergy, eczema andasthma; rheumatoid arthritis; systemic lupus erythematosus (SLE) (including lupus nephritis, cutaneouslupus); diabetes mellitus (e.g. type 1 diabetes mellitus or insulin dependent diabetes mellitus); multiple sclerosis; neurodegenerative disease, for example Amylotrophic Lateral Sclerosis (ALS); neuroinflammatory disease; Chronic inflammatory demyelinating polyneuropathy (CIPD) and juvenile onset diabetes. As used herein, the term “neurodegenerative disorder” refers to a disease or condition in which the function of a subject’s nervous system becomes impaired. Examples of neurodegenerative diseases that may be treated with a compound, pharmaceutical composition, or method described herein include Alexander's disease, Alper's disease, Alzheimer's disease, Amyotrophic lateral sclerosis, Ataxiatelangiectasia, Batten disease (also known as Spielmeyer- Vogt-Sjogren-Batten disease), Bovinespongiform encephalopathy (BSE), Canavan disease, chronic fatigue syndrome, Cockayne syndrome, Corticobasal degeneration, Creutzfeldt-Jakob disease, frontotemporal dementia, Gerstmann- Straussler-Scheinker syndrome, Huntington's disease, HIV-associated dementia, Kennedy's disease, Krabbe's disease, kuru, Lewy body dementia, Machado-Joseph disease (Spinocerebellar ataxia type 3), Multiple sclerosis, Multiple System Atrophy, myalgic encephalomyelitis, Narcolepsy, Neuroborreliosis, Parkinson's disease, Pelizaeus-Merzbacher Disease, Pick's disease, Primary lateral sclerosis, Prion diseases, Refsum's disease, Sandhoffs disease, Schilder's disease, Subacutecombined degeneration of spinal cord secondary to Pernicious Anaemia, Schizophrenia, Spinocerebellar ataxia (multiple types with varying characteristics), Spinal muscular atrophy, Steele- Richardson-Olszewski disease, progressive supranuclear palsy, or Tabes dorsalis.The term “target cell” refers to any cell expressing antigen (e.g., ENTPD3) to which the cell of theinvention is to be directed to exert its therapeutic effect. In some embodiments, the target cell functions as a marker of a disease site, i.e. to attract the cells of the invention to provide an immunosuppressive effect. In some embodiments, the target cell is killed or abrogated by the cells of the invention. As noted above, in some embodiments, the target cell will be a pancreatic beta cell. In particular, the disease or disorder to be treated may be type 1 diabetes. Other diseases or disorders that may be treated using the ENTPD3-specific CARs described herein include, for example, autoimmune pancreatitis, type 2 diabetes and insulinomas. Particularly the CARs may be expressed in cells having immunosuppressive function (e.g. CD4+ or CD8+ T-regulatory cells, tolerogenic NK or NKT cells, gamma-delta cells and immune regulatory 1 cells (Tr1) and other cells secreting immune modulatory cytokines such as IL-10, TGFbeta, IL-35 or amphiregulin) in order to treat type 1 diabetes, autoimmune pancreatitis or type 2 diabetes. The CARs may be expressed in cells having effector functions (e.g. T-effector cells, NK cells, NKT cells) in order to treat insulinomas. Further, the CARs described herein may be used to prevent rejection of transplanted cells expressingantigen (e.g., ENTPD3) (e.g. beta cell replacements including allogeneic islet transplants, xenogeneicislet transplants and stem cell derived beta cells). Particularly, the CARs may be expressed in cells having immunosuppressive function (e.g. CD4+ or CD8+ T-regulatory cells, tolerogenic NK or NKT cells, gamma-delta cells and immune regulatory 1 cells (Tr1) and other cells secreting immunemodulatory cytokines such as IL-10, TGFbeta, IL-35 or amphiregulin) in order to prevent rejection oftransplanted cells expressing antigen (e.g., ENTPD3). The engineered cells, e.g., Tregs, may be administered to a subject with a disease in order to lessen,reduce, or improve at least one symptom of disease such as hyperglycaemia. The at least one symptommay be lessened, reduced, or improved by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%, or the at least one symptom may be completely alleviated. The engineered cells, e.g., Tregs may be administered to a subject with a disease in order to slow down, reduce, or block the progression of the disease. The progression of the disease may be slowed down, reduced, or blocked by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50% compared to a subject in which the engineered cells are not administered, or progression of the disease may be completely stopped. As used herein “inducing tolerance to a transplant” refers to inducing tolerance to a transplanted organ in a recipient. In other words, inducing tolerance to a transplant means to reduce the level of a recipient’s immune response to a donor transplant organ. Inducing tolerance to a transplanted organ may reducethe amount of immune suppressive drugs that a transplant recipient requires, or may enable thediscontinuation of immunosuppressive drugs.In one embodiment, the subject is a transplant recipient undergoing immunosuppression therapy. CAR-Tregs specific for HLA-A2 may be able to traffic to sites of HLA-A2 expression present on transplanted organs but not in the transplant recipient. The transplant may be a liver, kidney, heart, lung, pancreas,intestine, stomach, bone marrow, vascularized tissue graft, or skin transplant. For example thetransplant may be a liver transplant. In particular, the disease to be treated may be type 1 diabetes. As mentioned above, CAR-Tregs specific for ENTPD3 may be able to traffic to sites of ENTPD3 expression and control inflammation, via their bystander effect, to slow down the rate of pancreatic beta cell destruction. Type 1 diabetes is a chronic autoimmune disease in which pancreatic beta cells, which are responsible for the production of insulin, are destroyed by the immune system. This is triggered by genetic and environmental factors. Destruction of beta cells reduces or eliminates production of insulin by the bodyand results in inflammation in the pancreatic islets. Insulin is a hormone required to regulate glucoselevels in the bloodstream and, before treatment, subjects with type 1 diabetes will have excessively high blood sugar levels (hyperglycaemia). Type 1 diabetes is a serious and lifelong condition. Patients with type 1 diabetes currently need to closely monitor their blood glucose levels and take an appropriate dose insulin (e.g. by injection or pump). This therapy is not a cure and must be continuously administered. Over time, irregularities in blood sugar levels, including large fluctuations in glycaemic level, can result in long-term complications such as damage to the heart, eyes, feet and kidneys, as well as a reduction in life expectancy. It is noted that glycaemic control is particularly poor in younger subjects, particularly subjects between the ages of approximately 16 and 25 years and the therapies described herein may therefore particularly be useful for this population. Type 1 diabetes is a continuum that progresses sequentially at variable but predictable rates through distinct identifiable stages prior to the onset of symptoms. This is described in more detail in Insel et al, Diabetes Care.2015; 38(10): 1964-1974. The ability to screen for risk and to stage type 1 diabetes prior to symptomatic type 1 diabetes provides an opportunity to intervene early to delay and ultimately prevent the onset of clinical symptoms. Individuals at increased risk of developing type 1 diabetes can be identified by genetic screening. The HLA region on chromosome 6 accounts for about 30-50% of the genetic risk of type 1 diabetes, withthe greatest association with HLA class II haplotypes RB1*0301-DQB1*0201 (DR3-DQ2)and DRB1*0401-DQB1*0302 (DR4-DQ8). The remaining genetic risk for type 1 diabetes can beattributed to approximately 50 non-HLA genes or loci identified by candidate gene and genome-wide association study approaches. The highest non-HLA genetic contribution arises from the INS, PTPN22, CTLA4 and IL2RA genes. Individuals who have been identified at increased risk of type 1 diabetes, but have not yet developed any signs of disease (i.e. pre-stage 1) may be prophylactically administered CAR-Tregs as described herein. Stage 1 represents individuals who have developed two or more type 1 diabetes-associated isletautoantibodies (to insulin, GAD65, IA-2 and / or ZnT8) but have normal blood glucose levels.Stage 2 represents individuals who have developed two or more type 1 diabetes-associated islet autoantibodies (to insulin, GAD65, IA-2 and / or ZnT8) but whose disease has progressed to the development of glucose intolerance, or dysglycemia, from loss of functional pancreatic beta cell mass. Dysglycemia may be defined as fasting blood glucose levels equal to or greater than 5.6 mmol / L, or 2 hour plasma glucose with a 75g oral glucose tolerance test (OGTT) equal to or greater than 7.8 mmol / L, high glucose levels at intermediate time points on OGTT (30, 60, 90 minute levels equal to or greater than 11.1 mmol / L), and / or HbA1c levels equal to or greater than 5.7% (39 mmol / mol). Stage 3 represents individuals who have typical clinical symptoms and signs of diabetes, which include, for example, polyuria, polydipsia, weight loss, fatigue and diabetic ketoacidosis (DKA). The CAR-Tregs described herein may, for example, be used to treat subjects at stage 1, stage 2 and / or stage 3 of disease. Alternatively, the CAR-Tregs described herein may be used to treat a subject at risk of T1D, i.e., before Stage 1. Where the subject is at stage 3 of disease, CAR-Treg treatment should begin as soon as possible to minimize pancreatic beta cell destruction and maximize residual pancreatic beta cell function. This may, for example, be determined by measuring blood insulin levels or blood C-peptide levels in the subject. It may, for example, be a requirement that the subject has a minimum stimulated C-peptide of 0.2 pmol / mL, or for example a minimum stimulated C-peptide of 0.4 pmol / mL from a mixed meal tolerance test at the time of CAR-Treg administration. These subjects may be considered to have “recent-onsettype 1 diabetes”.For example, where the subject is at stage 3 of disease, CAR-Treg treatment may begin no more than about 24 weeks after the onset of symptoms or after diagnosis, for example no more than about 20weeks or no more than about 16 weeks or no more than about 15 weeks or no more than about 14weeks or no more than about 12 weeks or no more than about 8 weeks or no more than about 6 weeks after the onset of symptoms or after diagnosis. For example, CAR-Treg treatment may begin equal to or less than 100 days after the onset of symptoms or after diagnosis. The subject may, for example, be at any age. For example, the subject may be under 30 years of age or under 25 years of age or under 20 years of age or under 18 years of age or under 16 years of age. Particularly, the subject may be from 8-30 years old, particularly from 8-25 years old, from 8-16 years old or from 16-25 years old. Disease progression and pancreatic beta cell death may, for example, be monitored by a number of methods.For example, imaging of pancreatic beta cells can be used to highlight beta cell integrity. The CAR-Tregs described herein may, for example, maintain or increase the number of pancreatic beta cells present in a subject after they are administered. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. For example, insulin levels in a subject can be monitored. Normal fasting blood insulin levels (blood insulin levels after the subject has fasted (not eaten or drunk anything except water) for at least 8 hours) may be considered to be around 2 to 20 mIU / mL. The CAR-Tregs described herein may, for example, maintain or increase fasting blood insulin levels in a subject after they are administered to the subject, for example within the normal range for fasting blood insulin. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. Insulin cell-free DNA (cfDNA) and unmethylated insulin may also be detected. C-peptide levels in a subject can be monitored. The beta cells of the pancreas first produce a protein called “proinsulin”. Each proinsulin breaks down to one molecule of insulin and one molecule of C- peptide. Both are released when blood sugar levels are raised. Insulin and C-peptide are released in equal amounts but are broken down differently. Therefore, C-peptide can be employed as a surrogate marker of beta cell function. The liver breaks down insulin at a variable rate, while the kidneys break down C-peptide at a fairly steady rate. C-peptide may therefore be a more reliable measure of insulin production and beta cell function. Normal fasting (i.e. after fasting for at least 8 hours) C-peptide levels may be considered to be around 0.8 to 3.85 ng / mL. The CAR-Tregs described herein may, for example, maintain or increase fasting C-peptide levels in a subject after they are administered to the subject, for example within the normal range for fasting C-peptide. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. Further, blood glucose levels in a subject can be monitored. Normal fasting blood glucose levels (i.e. after fasting for at least 8 hours). Normal fasting blood glucose levels may be considered to be around 3.9 to 6.9 mmol / L. Alternatively or additionally, an oral glucose tolerance test could be performed and blood glucose levels measured (e.g. using 75g oral glucose).2 hours following oral glucose, normal blood glucose levels may be considered to be less than around 7.8 mmol / L. At intermediate time points prior to the 2 hours (e.g. 30 minutes, 60 minutes, 90 minutes), normal blood glucose levels may be considered to be less than around 11.1 mmol / L. The CAR-Tregs described herein may, for example, maintain or reduce fasting blood glucose or OGTT blood glucose levels in a subject after they are administered to the subject, for example within the normal range for fasting blood glucose and / or OGTT blood glucose. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. Haemoglobin (Hb) HbA1c levels in a subject can be monitored. HbA1c is created when glucose binds to haemoglobin and is a measure of average blood sugar levels over the preceding 2 to 3 months.Normal HbA1c values are considered to be approximately 4.0 to 5.6% (20 – 38 mmol / mol). The CAR-Tregs may, for example, maintain or reduce HbA1c levels in a subject after they are administered tothe subject, for example within the normal range for HbA1c. This may, for example, be observed whenthe subject is receiving a reduced dose or no dose of exogenous insulin. Suitably, the subject is a mammal. Suitably, the subject is a human. Suitably, the cell may be an engineered Treg cell and the cell population may be a population of engineered Treg cells, which have been engineered to express a CAR as described herein. Suitably, the CAR may comprise an antigen binding domain which is capable of specifically binding to ENTPD3, i.e., the antigen is ENTPD3. A method for treating a disease or condition relates to the therapeutic use of the cells herein. In this respect, the cells may be administered to a subject having an existing disease or condition in order to lessen, reduce or improve at least one symptom associated with the disease or condition and / or to slow down, reduce or block the progression of the disease.Suitably, inducing tolerance to a transplant, treating and / or preventing graft-versus-host disease(GvHD), and treating and / or preventing an infectious, allergic, autoimmune or inflammatory disease may refer to administering an effective amount of the cells (e.g., Tregs) such that the amount of existing medication (e.g. exogenous insulin) that a subject with said disease requires is reduced, or may enable the discontinuation of the subject’s existing medication. Preventing a disease or condition relates to the prophylactic use of the cells herein. In this respect, the cells may be administered to a subject who has not yet contracted or developed the disease or condition and / or who is not showing any symptoms of the disease or condition to prevent the disease or condition or to reduce or prevent development of at least one symptom associated with the disease or condition. The subject may have a predisposition for, or be thought to be at risk of developing, the disease or condition (e.g. pre-stage 1 type 1 diabetes).As used herein, the term “treatment” refers to clinical intervention designed to alter the natural courseof the individual being treated during the course of clinical pathology. Desirable effects of treatment include decreasing the rate of progression, ameliorating or palliating the pathological state, and remission or improved prognosis of a particular disease, disorder, or condition. An individual is successfully “treated”, for example, if one or more symptoms associated with a particular disease, disorder, or condition are mitigated or eliminated.An “effective amount” refers to at least an amount effective, at dosages and for periods of timenecessary, to achieve the desired therapeutic or prophylactic result. An effective amount can be provided in one or more administrations.A “therapeutically effective amount” is at least the minimum concentration required to affect ameasurable improvement of a particular disease, disorder, or condition. A therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the chimeric receptors to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the cell, cell population or pharmaceutic compositions are outweighed by the therapeutically beneficial effects.The terms “subject”, “patient” and “individual” are used interchangeably herein and refer to a mammal,optionally a human. In particular, the terms subject, patient and individual refer to a human having a disease or disorder as defined herein in need of treatment. In some embodiments of the invention, the patient may be subjected to other treatments prior to,contemporaneously with, or after the treatments of the present invention. For instance, in someembodiments, the patient may be treated with other procedures for the treatment of symptoms associated with the disease or disorder. The medical use of or method herein may involve the steps of: (i) isolating a cell-containing sample or providing a cell-containing sample; (ii) introducing a nucleic acid molecule, expression construct or a vector as defined herein to the cell; and (iii) administering the cells from (ii) to a subject. The cell may be a Treg as defined herein. An enriched Treg population may be isolated and / or generated from the cell containing sample prior to, and / or after, step (ii) of the method. For example, isolation and / or generation may be performed prior to and / or after step (ii) to isolate and / or generate anenriched Treg sample. Enrichment may be performed after step (ii) to enrich for cells and / or Tregscomprising the CAR, the polynucleotide, and / or the vector as described herein. Suitably, the cell may be autologous. Suitably, the cell may be allogenic. Suitably, the cell (e.g., the engineered Treg) may be administered in combination with one or more other therapeutic agents, such as lympho-depletive agents (e.g., as discussed above). The engineered cell, e.g., Treg, may be administered simultaneously with or sequentially with (i.e., prior to or after) the one or more other therapeutic agents. Cells, e.g., Tregs, may be activated and / or expanded prior to, or after, the introduction of an expressionconstruct nucleic acid molecule as described herein, for example by treatment with an anti-CD3monoclonal antibody or both anti-CD3 and anti-CD28 monoclonal antibodies. Expansion protocols are discussed above. The cell, e.g., Tregs, may be washed after each step of the method, in particular after expansion.The population of engineered cells, e.g., Treg cells may be further enriched by any method known tothose of skill in the art, for example by FACS or magnetic bead sorting. The steps of the method of production may be performed in a closed and sterile cell culture system. Further Uses The invention may also provide a method for increasing the stability and / or suppressive function of a cell comprising the step of introducing a nucleic acid molecule, an expression construct or vector as provided herein into the cell. An increase in suppressive function can be measured as discussed above, for example by co-culturing activated antigen-specific Tconv cells with cells of the invention, and for example measuring the levels the cytokines produced by the Tconv cells. An increase in suppressive function may be an increase of at least 10, 20, 30, 40, 50, 60, 70, 80, or 90% as compared to a non- engineered Treg. An increase in stability of a cell, e.g., a Treg as defined herein, refers to an increase in the persistenceor survival of those cells or to an increase in the proportion of cells retaining a Treg phenotype over atime period (e.g., to cells retaining Treg markers such as FOXP3 and Helios) as compared to a non- engineered Treg. An increase in stability may be an increase in stability of at least 10, 20, 30, 40, 50, 60, 70, 80 or 90%, and may be measured by techniques known in the art, e.g., staining of Treg cell markers within a population of cells, and analysis by FACS. The invention also provides a method for increasing the expression of a CAR and / or FOXP3 polypeptidein a cell, the method comprising the step of introducing an expression construct, nucleic acid moleculeor vector as provided herein to the cell. An increase in CAR and / or FOXP3 can be measured asdiscussed herein, for example by flow cytometry. The increase in expression may be an increase in %transduction, for example an increase of at least 5% (percentage points), 10% (percentage points), 15%(percentage points), 20% (percentage points) or 25% (percentage points). The increase in expression may be an increase in MFI, for example an increase of at least 10, 20, 30, 40, 50, 60, 70, 80, or 90%.The increase may be as compared to the expression levels in a cell which an expression construct,nucleic acid molecule or vector has been introduced, wherein the expression construct comprises aPGK promoter operably linked to a first nucleotide sequence encoding the CAR and second nucleotide sequence encoding the FOXP3 polypeptide, where the second nucleotide sequence is located upstream of the first nucleotide sequence. Alternatively, the increase may be as compared to theexpression levels in a cell which an expression construct, nucleic acid molecule or vector has beenintroduced, wherein the nucleic acid molecule comprises an alternative mammalian promoter (e.g. short EF1a or full length EF1a) operably linked to a first nucleotide sequence encoding the CAR and secondnucleotide sequence encoding the FOXP3 polypeptide, where the first nucleotide sequence is locatedupstream of the second nucleotide sequence. The invention also provides the use of an expression construct, nucleic acid molecule or vector as provided herein to increase expansion of a cell in which it is expressed, particularly to increaseexpansion of a Treg in which it is expressed. The invention further provides a method for increasing theexpansion of a cell, the method comprising the step of introducing an expression construct, nucleic acidmolecule or vector as provided herein to the cell, particularly wherein the cell is a Treg. The increase inexpansion may be relative to an expression construct, nucleic acid molecule or vector that is identical except that it uses an alternative promoter in place of the PGK promoter. The alternative promoter may,for example, be a SFFV promoter (e.g. SEQ ID NO: 215). The fold expansion may, for example,increase by at least about 20% or at least about 30% or at least about 40% or at least about 50% or atleast about 60% or at least about 70% or at least about 80% or at least about 90% or at least about100% relative to fold expansion obtained using the expression construct, nucleic acid molecule or vectorthat is identical except that it uses an alternative promoter in place of the PGK promoter (e.g. SFFVpromoter). The fold expansion may, for example, increase by up to about 200% relative to foldexpansion obtained using the expression construct, nucleic acid molecule or vector that is identical except that it uses an alternative promoter in place of the PGK promoter (e.g. SFFV promoter). The invention also provides the use of a CAR-Treg to reduce the rate or prevent death of pancreatic beta cells, for example in a subject having or at risk of developing type 1 diabetes, particularly recent- onset type 1 diabetes. This may, for example, be determined by measuring number of pancreatic beta cells, blood insulin levels and / or blood C-peptide levels in a subject. Any maintenance or improvement in number of pancreatic beta cells, blood insulin levels and / or blood C-peptide levels may be considered to be reducing the rate or preventing death of pancreatic beta cells. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. The invention thus also provides the use of a CAR-Treg to maintain or increase fasting blood insulin levels and / or fasting blood C-peptide levels in a subject, for example in a subject having or at risk of developing type 1 diabetes, particularly recent-onset type 1 diabetes. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. The invention further provides the use of a CAR-Treg to reduce or prevent hyperglycaemia, for example in a subject having or at risk of developing type 1 diabetes, particularly recent-onset type 1 diabetes. This may, for example, be determined by measuring fasting blood glucose and / or HbA1c levels in a subject. Any maintenance or improvement in blood glucose levels and / or HbA1c levels in a subject may be considered to be reducing or preventing hyperglycaemia in a subject. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. The invention thus also provides the use of a CAR-Treg to maintain or decrease fasting blood glucose and / or HbA1c levels in a subject, for example in a subject having or at risk of developing type 1 diabetes, particularly recent-onset type 1 diabetes. This may, for example, be observed when the subject is receiving a reduced dose or no dose of exogenous insulin. Numbered Paragraphs The following numbered paragraphs defined particular embodiments of the present invention: 1. An expression construct comprising a PGK promoter operably linked to:(i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the first nucleotide sequence is located upstream of the second nucleotide sequence. 2. The expression construct of paragraph 1, wherein the expression construct does not compriseany other coding nucleotide sequence. 3. The expression construct of any preceding paragraph, wherein the first and second nucleotidesequences are separated by the presence of a self-cleavage sequence and / or an internal ribosome entry site (IRES). 4. The expression construct of paragraph 3, wherein the self-cleavage sequence is a 2Asequence, optionally selected from P2A, T2A, E2A and F2A. 5. The expression construct of any preceding paragraph, wherein the PGK promoter comprisesor consists of the sequence of SEQ ID NO: 195 or a functional variant or functional fragment thereof. 6. The expression construct of any preceding paragraph, wherein the PGK promoter is a truncatedhuman PGK promoter or a functional variant having at least 70% identity thereto, optionally wherein the truncated human PGK promoter has the sequence of SEQ ID NO: 196, SEQ IDNO: 197, SEQ ID NO: 198 or SEQ ID NO: 199.The expression construct of any preceding paragraph, wherein the CAR is a human CAR.The expression construct of any preceding paragraph, wherein the CAR comprises anexodomain comprising an antigen recognition domain.The expression construct of paragraph 8, wherein the antigen recognition domain specificallybinds to ENTPD3.The expression construct of any preceding paragraph, wherein the CAR comprises:a. an exodomain comprising an antigen recognition domain;b. a transmembrane domain; andc. an endodomain comprising an intracellular signalling domain.The expression construct of paragraph 10, wherein the CAR further comprises a hinge domainand / or one or more co-stimulatory domains.The expression construct of paragraph 11, wherein the CAR comprises a CD8α or CH2CH3hinge domain, a CD28, CD8α or CH2CH3 transmembrane domain, a CD28 co-stimulatory domain, and a CD3zeta signalling domain, wherein when the hinge domain is CD8α, the transmembrane domain is CD8α, and when the hinge domain is CH2CH3, the transmembrane domain is CD28 or CH2CH3.The expression construct of any of paragraphs 8 to 12, wherein the antigen recognition domainis an antibody, an antibody fragment, or derived from an antibody, optionally wherein the antigen recognition domain is a single chain antibody (scFv).The expression construct of any of paragraphs 8 to 13, wherein the antigen recognition domaincomprises: i. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 7, 8 and 9 respectivelyand VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 10, 11 and 12 respectively; ii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 19, 20 and 21respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 22, 23 and 24 respectively; iii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 73, 74 and 75respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 76, 77 and 78 respectively; iv. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 25, 26 and 27respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 28, 29 and 30 respectively;v. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 37, 38 and 39respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 40, 41 and 42 respectively; vi. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 1, 2 and 3 respectivelyand VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 4, 5 and 6 respectively; vii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 13, 14 and 15respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 16, 17and 18 respectively; viii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 31, 32 and 33respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 34, 35 and 36 respectively; ix. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 43, 44 and 45respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 46, 47 and 48 respectively; x. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 49, 50 and 51respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 52, 53 and 54 respectively; xi. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 55, 56 and 57respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 58, 59 and 60 respectively; xii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 61, 62 and 63respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 64, 65 and 66 respectively; xiii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 67, 68 and 69respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 70, 71 and 72 respectively; or xiv. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 79, 80 and 81respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 82, 83 and 84 respectively;wherein one or more of said CDR sequences of (i) to (xiv) may optionally comprise 1 to 3amino acid modifications relative to an aforementioned CDR sequence, particularly wherein one or more of said CDR sequences may optionally be modified by substitution, addition or deletion of 1 to 3 amino acids.The expression construct of any of paragraphs 8 to 14, wherein the antigen recognition domaincomprises: i. a VH domain comprising the sequence set forth in SEQ ID NO: 87, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising thesequence as set forth in SEQ ID NO: 88, or a sequence having at least 70%identity thereto; ii. a VH domain comprising the sequence set forth in SEQ ID NO: 91, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 92, or a sequence having at least 70% identity thereto; iii. a VH domain comprising the sequence set forth in SEQ ID NO: 109, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 110, or a sequence having at least 70% identity thereto; iv. a VH domain comprising the sequence set forth in SEQ ID NO: 93, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 94, or a sequence having at least 70% identity thereto; v. a VH domain comprising the sequence set forth in SEQ ID NO: 97, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 98, or a sequence having at least 70% identity thereto; vi. a VH domain comprising the sequence set forth in SEQ ID NO: 85, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 86, or a sequence having at least 70% identity thereto;vii. a VH domain comprising the sequence set forth in SEQ ID NO: 89, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 90, or a sequence having at least 70% identity thereto;viii. a VH domain comprising the sequence set forth in SEQ ID NO: 95, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 96, or a sequence having at least 70% identity thereto; ix. a VH domain comprising the sequence set forth in SEQ ID NO: 99, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 100, or a sequence having at least 70% identity thereto; x. a VH domain comprising the sequence set forth in SEQ ID NO: 101, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 102, or a sequence having at least 70% identity thereto; xi. a VH domain comprising the sequence set forth in SEQ ID NO: 103, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 104, or a sequence having at least 70% identity thereto; xii. a VH domain comprising the sequence set forth in SEQ ID NO: 105, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 106, or a sequence having at least 70% identity thereto; xiii. a VH domain comprising the sequence set forth in SEQ ID NO: 107, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 108, or a sequence having at least 70% identity thereto; or xiv. a VH domain comprising the sequence set forth in SEQ ID NO: 111, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 112, or a sequence having at least 70% identity thereto.The expression construct of any of paragraphs 8 to 15, wherein the antigen recognition domaincomprises or consists of: i. the sequence set forth in SEQ ID NO: 114 or a sequence having at least 70%sequence identity thereto; ii. the sequence set forth in SEQ ID NO: 116 or a sequence having at least 70%sequence identity thereto; iii. the sequence set forth in SEQ ID NO: 125 or a sequence having at least 70%sequence identity thereto; iv. the sequence set forth in SEQ ID NO: 117 or a sequence having at least 70%sequence identity thereto; v. the sequence set forth in SEQ ID NO: 119 or a sequence having at least 70%sequence identity thereto; vi. the sequence set forth in SEQ ID NO: 113 or a sequence having at least 70%sequence identity thereto; vii. the sequence set forth in SEQ ID NO: 115 or a sequence having at least 70%sequence identity thereto; viii. the sequence set forth in SEQ ID NO: 118 or a sequence having at least 70%sequence identity thereto; ix. the sequence set forth in SEQ ID NO: 120 or a sequence having at least 70%sequence identity thereto; x. the sequence set forth in SEQ ID NO: 121 or a sequence having at least 70%sequence identity thereto; xi. the sequence set forth in SEQ ID NO: 122 or a sequence having at least 70%sequence identity thereto;xii. the sequence set forth in SEQ ID NO: 123 or a sequence having at least 70%sequence identity thereto; xiii. the sequence set forth in SEQ ID NO: 124 or a sequence having at least 70%sequence identity thereto; or xiv. the sequence set forth in SEQ ID NO: 126 or a sequence having at least 70%sequence identity thereto.The expression construct of any preceding paragraph, wherein the CAR comprises or consistsof the sequence of any one of SEQ ID NOs: 127 to 152 or a functional variant thereof having at least 70% sequence identity thereto, particularly wherein the CAR comprises or consists of the sequence of SEQ ID NO: 128 or 130 or a functional variant having at least 70% sequence identity thereto.The expression construct of any preceding paragraph, wherein the FOXP3 polypeptide has thesequence of SEQ ID NO: 200, SEQ ID NO: 201, SEQ ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205 or a variant having at least 70% identity thereto, or the second nucleotide sequence encoding the FOXP3 polypeptide has the sequence of SEQ ID NO: 206, SEQ ID NO: 207 or a sequence having at least 80% identity thereto.The expression construct of any preceding paragraph, wherein the expression constructcomprises the sequence of SEQ ID NO: 214 or a sequence having at least 70% identity thereto.A nucleic acid molecule comprising an expression construct of any preceding paragraph.The nucleic acid molecule of paragraph 20, wherein the nucleic acid molecule does notcomprise any other coding nucleotide sequence.A vector comprising the expression construct or nucleic acid molecule of any precedingparagraph.The vector of paragraph 22, wherein the vector is a plasmid or a viral vector, optionally alentiviral vector or gamma-retroviral vector.A cell comprising the expression construct of any of paragraphs 1 to 19 or the nucleic acidmolecule of paragraph 20 or 21 or the vector of paragraph 22 or 23.The cell of paragraph 24, wherein the cell is a production host cell.The cell of paragraph 24, wherein the cell is an immune cell or a progenitor or precursor thereof,for example a T cell or precursor thereof, or a stem cell.The cell of paragraph 24 or 26, wherein the cell is a regulatory T cell (Treg) or a precursorthereof, or an iPSC cell.28. A cell population comprising a cell of any of paragraphs 24, 26 or 27 or a plurality of cells ofany of paragraphs 24, 26 or 27, optionally a plurality of T cells of paragraph 26 or a plurality ofTregs of paragraph 27.29. A pharmaceutical composition comprising a vector of paragraph 22 or 23, a cell of any ofparagraphs 24, 26 or 27, or a cell population of paragraph 28.30. The cell of any of paragraphs 24, 26 or 27, the cell population of paragraph 28 or thepharmaceutical composition of paragraph 29, for use in therapy.31. The cell, cell population or pharmaceutical composition for use of paragraph 30, wherein thetherapy is adoptive cell transfer therapy. 32. The cell of any of paragraphs 24, 26 or 27, the cell population of paragraph 28 or thepharmaceutical composition of paragraph 29, for use in inducing tolerance to a transplant,treating and / or preventing graft-versus-host disease (GvHD), treating or preventing an infectious, allergic, autoimmune or inflammatory disease, or for use in inducing immunosuppression, or for use in promoting tissue repair and / or tissue regeneration,particularly wherein the cell is a Treg. 33. The cell, cell population or pharmaceutical composition for use of paragraph 32, wherein theautoimmune or inflammatory disease is type 1 diabetes. 34. A method of making a cell of any of paragraphs 24 to 27, which comprises the step ofintroducing into the cell the expression construct of any of paragraphs 1 to 19 or the nucleic acid molecule of paragraph 20 or 21 or the vector of paragraph 22 or 23. This disclosure is not limited by the exemplary methods and materials disclosed herein, and any methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments of this disclosure. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, any nucleic acid sequences are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively. Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within this disclosure. The upper and lower limits of these smaller ranges may independently beincluded or excluded in the range, and each range where either, neither or both limits are included inthe smaller ranges is also encompassed within this disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in this disclosure. It must be noted that as used herein and in the appended claims, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. The terms "comprising", "comprises" and "comprised of' as used herein are synonymous with "including", "includes" or "containing", "contains", and are inclusive or open-ended and do not exclude additional, non-recited members, elements or method steps. The terms "comprising", "comprises" and "comprised of' also include the term "consisting of'. The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that such publications constitute prior art to the claims appended hereto. The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention. SEQUENCE LISTINGSEQ ID NO: 1 is the amino acid sequence of VH CDR1 of A8GFTFDDYASEQ ID NO: 2 is the amino acid sequence of VH CDR2 of A8ISWNSGSISEQ ID NO: 3 is the amino acid sequence of VH CDR3 of A8AKGANYDILTGYRKDNWFDPSEQ ID NO: 4 is the amino acid sequence of VL CDR1 of A8SSNIGSNYSEQ ID NO: 5 is the amino acid sequence of VL CDR2 of A8SSNSEQ ID NO: 6 is the amino acid sequence of VL CDR3 of A8AAWDDSLSGWV SEQ ID NO: 7 is the amino acid sequence of VH CDR1 of B2 GFTFSSYASEQ ID NO: 8 is the amino acid sequence of VH CDR2 of B2ISGSGGNTSEQ ID NO: 9 is the amino acid sequence of VH CDR3 of B2AKGGSTSSGYRFDYSEQ ID NO: 10 is the amino acid sequence of VL CDR1 of B2SGHSNYASEQ ID NO: 11 is the amino acid sequence of VL CDR2 of B2VNRDGSYSEQ ID NO: 12 is the amino acid sequence of VL CDR3 of B2QTWGTGVQVSEQ ID NO: 13 is the amino acid sequence of VH CDR1 of B7GYTFTSYASEQ ID NO: 14 is the amino acid sequence of VH CDR2 of B7INAGNGNTSEQ ID NO: 15 is the amino acid sequence of VH CDR3 of B7ARDSGYDLFDYSEQ ID NO: 16 is the amino acid sequence of VL CDR1 of B7SGSVSTTYYSEQ ID NO: 17 is the amino acid sequence of VL CDR2 of B7KTNSEQ ID NO: 18 is the amino acid sequence of VL CDR3 of B7LLYMGSGVWVSEQ ID NO: 19 is the amino acid sequence of VH CDR1 of C1GYSFTSYWSEQ ID NO: 20 is the amino acid sequence of VH CDR2 of C1IYPGDSGTSEQ ID NO: 21 is the amino acid sequence of VH CDR3 of C1ARQQGAGAFDISEQ ID NO: 22 is the amino acid sequence of VL CDR1 of C1SRDVGGYNYSEQ ID NO: 23 is the amino acid sequence of VL CDR2 of C1EVTSEQ ID NO: 24 is the amino acid sequence of VL CDR3 of C1SSYTSSSTVVSEQ ID NO: 25 is the amino acid sequence of VH CDR1 of C6GFTFGDYASEQ ID NO: 26 is the amino acid sequence of VH CDR2 of C6IRSKAYGGTTSEQ ID NO: 27 is the amino acid sequence of VH CDR3 of C6TRVPVVAGWYNWFDPSEQ ID NO: 28 is the amino acid sequence of VL CDR1 of C6SSNIGSNYSEQ ID NO: 29 is the amino acid sequence of VL CDR2 of C6RNNSEQ ID NO: 30 is the amino acid sequence of VL CDR3 of C6SSYAGSNNVVSEQ ID NO: 31 is the amino acid sequence of VH CDR1 of C8GFTFDDYASEQ ID NO: 32 is the amino acid sequence of VH CDR2 of C8ISWNSGSISEQ ID NO: 33 is the amino acid sequence of VH CDR3 of C8AKGANYDILTGYRKDNWFDPSEQ ID NO: 34 is the amino acid sequence of VL CDR1 of C8QTISNWSEQ ID NO: 35 is the amino acid sequence of VL CDR2 of C8KASSEQ ID NO: 36 is the amino acid sequence of VL CDR3 of C8QQYHSYSRTSEQ ID NO: 37 is the amino acid sequence of VH CDR1 of D3GFTFDDYASEQ ID NO: 38 is the amino acid sequence of VH CDR2 of D3ISWNSGSISEQ ID NO: 39 is the amino acid sequence of VH CDR3 of D3AKGANYDILTGYEYSEQ ID NO: 40 is the amino acid sequence of VL CDR1 of D3TGAVTSDHHSEQ ID NO: 41 is the amino acid sequence of VL CDR2 of D3DTSSEQ ID NO: 42 is the amino acid sequence of VL CDR3 of D3FLYYSGTAISEQ ID NO: 43 is the amino acid sequence of VH CDR1 of E11GFTFSSYASEQ ID NO: 44 is the amino acid sequence of VH CDR2 of E11ISGSGGSTSEQ ID NO: 45 is the amino acid sequence of VH CDR3 of E11AKDDYDFWSGSLGNYSEQ ID NO: 46 is the amino acid sequence of VL CDR1 of E11SSNIGSNYSEQ ID NO: 47 is the amino acid sequence of VL CDR2 of E11 ENNSEQ ID NO: 48 is the amino acid sequence of VL CDR3 of E11AAWDDTLNAWVSEQ ID NO: 49 is the amino acid sequence of VH CDR1 of E4GFTFDDYASEQ ID NO: 50 is the amino acid sequence of VH CDR2 of E4ISWNSGSISEQ ID NO: 51 is the amino acid sequence of VH CDR3 of E4AKGANYDILTGYRKDNWFDPSEQ ID NO: 52 is the amino acid sequence of VL CDR1 of E4QSVGSSSEQ ID NO: 53 is the amino acid sequence of VL CDR2 of E4DASSEQ ID NO: 54 is the amino acid sequence of VL CDR3 of E4QQRSNWPPYTSEQ ID NO: 55 is the amino acid sequence of VH CDR1 of F10GFTFSSYG SEQ ID NO: 56 is the amino acid sequence of VH CDR2 of F10 ISYDGSNKSEQ ID NO: 57 is the amino acid sequence of VH CDR3 of F10AKDHHPYGSSDSFDYSEQ ID NO: 58 is the amino acid sequence of VL CDR1 of F10TGAVTRGHYSEQ ID NO: 59 is the amino acid sequence of VL CDR2 of F10DTVSEQ ID NO: 60 is the amino acid sequence of VL CDR3 of F10LLSFIDTRYPARYVSEQ ID NO: 61 is the amino acid sequence of VH CDR1 of A10GYTFTSYG SEQ ID NO: 62 is the amino acid sequence of VH CDR2 of A10 ISAYNGNTSEQ ID NO: 63 is the amino acid sequence of VH CDR3 of A10ARDDPWGSYRPRPFDYSEQ ID NO: 64 is the amino acid sequence of VL CDR1 of A10SSNIGSNTSEQ ID NO: 65 is the amino acid sequence of VL CDR2 of A10SNNSEQ ID NO: 66 is the amino acid sequence of VL CDR3 of A10AAWDDSLNGWVSEQ ID NO: 67 is the amino acid sequence of VH CDR1 of B4GGTFSSYA SEQ ID NO: 68 is the amino acid sequence of VH CDR2 of B4 IIPIFGTASEQ ID NO: 69 is the amino acid sequence of VH CDR3 of B4ARGASGYDWSLDYSEQ ID NO: 70 is the amino acid sequence of VL CDR1 of B4QSLVYSDGNTYSEQ ID NO: 71 is the amino acid sequence of VL CDR2 of B4KVSSEQ ID NO: 72 is the amino acid sequence of VL CDR3 of B4MQGSRWPPTSEQ ID NO: 73 is the amino acid sequence of VH CDR1 of F8GYSFISHW SEQ ID NO: 74 is the amino acid sequence of VH CDR2 of F8 IYPGDSGTSEQ ID NO: 75 is the amino acid sequence of VH CDR3 of F8ARLADGGLQFDHSEQ ID NO: 76 is the amino acid sequence of VL CDR1 of F8SSDVGGYNYSEQ ID NO: 77 is the amino acid sequence of VL CDR2 of F8GVSSEQ ID NO: 78 is the amino acid sequence of VL CDR3 of F8NSYTSSSTYVSEQ ID NO: 79 is the amino acid sequence of VH CDR1 of E1GFTFSSYW SEQ ID NO: 80 is the amino acid sequence of VH CDR2 of E1 IKQDGSEKSEQ ID NO: 81 is the amino acid sequence of VH CDR3 of E1ARVPNYYDSSGTVSEQ ID NO: 82 is the amino acid sequence of VL CDR1 of E1SGSIASNYSEQ ID NO: 83 is the amino acid sequence of VL CDR2 of E1EDNSEQ ID NO: 84 is the amino acid sequence of VL CDR3 of E1QSYDSTLLVSEQ ID NO: 85 is the amino acid sequence of the VH domain of A8 (the CDRs are underlined)QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSSEQ ID NO: 86 is the amino acid sequence of the VL domain of A8 (the CDRs are underlined)LPVLTQPPSASGTPGQKVTISCSGSSSNIGSNYVFWYEQLPGAAPKLLMYSSNQRPSGVPDRFSGSK SGTSASLAISGLRSEDEADYYCAAWDDSLSGWVFGGGTKLTVLSEQ ID NO: 87 is the amino acid sequence of the VH domain of B2 (the CDRs are underlined)QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGNTNYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGGSTSSGYRFDYWGQGTLVTVSSSEQ ID NO: 88 is the amino acid sequence of the VL domain of B2 (the CDRs are underlined)QLVLTQSPSASASLGASVKLTCTLSSGHSNYAIAWHQQQPEKGPRFLMNVNRDGSYTKGDGIPDRF SGSSSGAERYLTISSLQSDDEADYYCQTWGTGVQVFGGGTKLTVLSEQ ID NO: 89 is the amino acid sequence of the VH domain of B7 (the CDRs are underlined)QVQLQQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKL QGRVTITRDTSASTAYMELSSLRSEDTAVYYCARDSGYDLFDYWGQGTLVTVSSSEQ ID NO: 90 is the amino acid sequence of the VL domain of B7 (the CDRs are underlined)QAVVTQEPSFSVSPGGTVTLTCGLTSGSVSTTYYPSWYQQTPGQTPRTLIYKTNLRSPGVPDRFSGS ILGNKAALTITGAQADDDSDYYCLLYMGSGVWVFGGGTRLTVLSEQ ID NO: 91 is the amino acid sequence of the VH domain of C1 (the CDRs are underlined)QVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSGTRYSPSFQG QVTISADKSISTAYLQWSSLKASNTAMYYCARQQGAGAFDIWGQGTMVTVSSSEQ ID NO: 92 is the amino acid sequence of the VL domain of C1 (the CDRs are underlined)QSALTQPPSASGSPGQSVTISCTGTSRDVGGYNYVSWYQQHPGKAPKLILYEVTKRPSGVPDRFSG SKSGNTASLTISGLQAEDEADYYCSSYTSSSTVVFGGGTKLTVLSEQ ID NO: 93 is the amino acid sequence of the VH domain of C6 (the CDRs are underlined)EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAAS VKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRVPVVAGWYNWFDPWGQGTLVTVSSSEQ ID NO: 94 is the amino acid sequence of the VL domain of C6 (the CDRs are underlined)QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSK SGNTASLTVSGLQAGDEADYYCSSYAGSNNVVFGGGTKLAVLSEQ ID NO: 95 is the amino acid sequence of the VH domain of C8 (the CDRs are underlined)QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSSEQ ID NO: 96 is the amino acid sequence of the VL domain of C8 (the CDRs are underlined) DIVMTQTPSTLSASVGDRVTITCRASQTISNWLAWYQQKPGKAPKLLIYKASTLESGVPSRFSGTGSG TEFTLTISSLQPDDFATYFCQQYHSYSRTFGQGTKVDVSEQ ID NO: 97 is the amino acid sequence of the VH domain of D3 (the CDRs are underlined)QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYEYWGQGTLVTVSSSEQ ID NO: 98 is the amino acid sequence of the VL domain of D3 (the CDRs are underlined)QAVVTQEPSLTVSPGETVTLTCGSSTGAVTSDHHPYWFQQKPGQVPRTLMHDTSTRYSWTPARFS GSIVGGKAALTLSGAQPEDEAEYHCFLYYSGTAIFGGGTKLTVLSEQ ID NO: 99 is the amino acid sequence of the VH domain of E11 (the CDRs are underlined)EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDDYDFWSGSLGNYWGQGTLVTVSSSEQ ID NO: 100 is the amino acid sequence of the VL domain of E11 (the CDRs are underlined)QSVLTQPPSASGTPGQRVTISCSGRSSNIGSNYVYWYQQPPGTAPKLLIYENNHRPSGVPDRFSASK SGTSASLAISGLRSEDEADYYCAAWDDTLNAWVFGGGTKLTVLSEQ ID NO: 101 is the amino acid sequence of the VH domain of E4 (the CDRs are underlined)QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSSEQ ID NO: 102 is the amino acid sequence of the VL domain of E4 (the CDRs are underlined)DIVMTQSPATLSLSPGERATLSCRASQSVGSSLAWFQQKPGQAPRLLIYDASNRATGIPARFSGSGS GTDFTLTISSLEPEDFAVYYCQQRSNWPPYTFGQGTKLEIKSEQ ID NO: 103 is the amino acid sequence of the VH domain of F10 (the CDRs are underlined)QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLERVAVISYDGSNKYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDHHPYGSSDSFDYWGQGTLVTVSSSEQ ID NO: 104 is the amino acid sequence of the VL domain of F10 (the CDRs are underlined)QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTRGHYPYWLQQKPGQAPRTLIYDTVKKHSWTPARFSG SLVGGKAALTLSGAQPEDEADYYCLLSFIDTRYPARYVFGTGTKVTVLSEQ ID NO: 105 is the amino acid sequence of the VH domain of A10 (the CDRs are underlined)QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQ GRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDDPWGSYRPRPFDYWGQGTLVTVSSSEQ ID NO: 106 is the amino acid sequence of the VL domain of A10 (the CDRs are underlined)QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTTPKLLIYSNNQRPSGVPDRFSGSK SGTSASLAISGLQSEDEADYYCAAWDDSLNGWVFGGGTKLTVLSEQ ID NO: 107 is the amino acid sequence of the VH domain of B4 (the CDRs are underlined)EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARGASGYDWSLDYWGQGTLVTVSSSEQ ID NO: 108 is the amino acid sequence of the VL domain of B4 (the CDRs are underlined)KIVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNRHSGVPDRF SGSGSGTDFTLKISRVEAEDVGVYFCMQGSRWPPTFGPGTKVEIKSEQ ID NO: 109 is the amino acid sequence of the VH domain of F8 (the CDRs are underlined)QIQLVQSGTEVKKPGESLKISCKGSGYSFISHWIGWVRQMPGKGLEWMGIIYPGDSGTRYSPSFQGQ ATISADKSISTAYLQWSSLKASDTAMYYCARLADGGLQFDHWGQGTLVTVSSSEQ ID NO: 110 is the amino acid sequence of the VL domain of F8 (the CDRs are underlined)QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYGVSNRPSGVSNRFSG SKSGNTASLTISGLQAEDEADYYCNSYTSSSTYVFGTGTKVTVLSEQ ID NO: 111 is the amino acid sequence of the VH domain of E1 (the CDRs are underlined)EVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSV KGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVPNYYDSSGTVWGQGTLVTVSS SEQ ID NO: 112 is the amino acid sequence of the VL domain of E1 (the CDRs are underlined) NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSI DSSSNSASLTISGLEPEDEADYYCQSYDSTLLVFGGGTKLTVLSEQ ID NO: 113 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of A8 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSGGGG SGGGGSGGGGSLPVLTQPPSASGTPGQKVTISCSGSSSNIGSNYVFWYEQLPGAAPKLLMYSSNQR PSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSGWVFGGGTKLTVLSEQ ID NO: 114 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of B2 QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGNTNYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGGSTSSGYRFDYWGQGTLVTVSSGGGGSGGGG SGGGGSQLVLTQSPSASASLGASVKLTCTLSSGHSNYAIAWHQQQPEKGPRFLMNVNRDGSYTKG DGIPDRFSGSSSGAERYLTISSLQSDDEADYYCQTWGTGVQVFGGGTKLTVLSEQ ID NO: 115 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of B7 QVQLQQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKL QGRVTITRDTSASTAYMELSSLRSEDTAVYYCARDSGYDLFDYWGQGTLVTVSSGGGGSGGGGSG GGGSQAVVTQEPSFSVSPGGTVTLTCGLTSGSVSTTYYPSWYQQTPGQTPRTLIYKTNLRSPGVPD RFSGSILGNKAALTITGAQADDDSDYYCLLYMGSGVWVFGGGTRLTVLSEQ ID NO: 116 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of C1 QVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSGTRYSPSFQG QVTISADKSISTAYLQWSSLKASNTAMYYCARQQGAGAFDIWGQGTMVTVSSGGGGSGGGGSGGG GSQSALTQPPSASGSPGQSVTISCTGTSRDVGGYNYVSWYQQHPGKAPKLILYEVTKRPSGVPDRF SGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTVVFGGGTKLTVLSEQ ID NO: 117 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of C6 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAAS VKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRVPVVAGWYNWFDPWGQGTLVTVSSGGGGSG GGGSGGGGSQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPS GVPDRFSGSKSGNTASLTVSGLQAGDEADYYCSSYAGSNNVVFGGGTKLAVLSEQ ID NO: 118 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of C8 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSGGGG SGGGGSGGGGSDIVMTQTPSTLSASVGDRVTITCRASQTISNWLAWYQQKPGKAPKLLIYKASTLES GVPSRFSGTGSGTEFTLTISSLQPDDFATYFCQQYHSYSRTFGQGTKVDVSEQ ID NO: 119 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of D3 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYEYWGQGTLVTVSSGGGGSGGGGS GGGGSQAVVTQEPSLTVSPGETVTLTCGSSTGAVTSDHHPYWFQQKPGQVPRTLMHDTSTRYSWT PARFSGSIVGGKAALTLSGAQPEDEAEYHCFLYYSGTAIFGGGTKLTVLSEQ ID NO: 120 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of E11 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDDYDFWSGSLGNYWGQGTLVTVSSGGGGSGGG GSGGGGSQSVLTQPPSASGTPGQRVTISCSGRSSNIGSNYVYWYQQPPGTAPKLLIYENNHRPSGV PDRFSASKSGTSASLAISGLRSEDEADYYCAAWDDTLNAWVFGGGTKLTVLSEQ ID NO: 121 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of E4 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSGGGG SGGGGSGGGGSDIVMTQSPATLSLSPGERATLSCRASQSVGSSLAWFQQKPGQAPRLLIYDASNRA TGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPYTFGQGTKLEIKSEQ ID NO: 122 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of F10 QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLERVAVISYDGSNKYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDHHPYGSSDSFDYWGQGTLVTVSSGGGGSGGG GSGGGGSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTRGHYPYWLQQKPGQAPRTLIYDTVKKHS WTPARFSGSLVGGKAALTLSGAQPEDEADYYCLLSFIDTRYPARYVFGTGTKVTVLSEQ ID NO: 123 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of A10 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQ GRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDDPWGSYRPRPFDYWGQGTLVTVSSGGGGSG GGGSGGGGSQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTTPKLLIYSNNQRPS GVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGWVFGGGTKLTVLSEQ ID NO: 124 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of B4 EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQG RVTITADESTSTAYMELSSLRSEDTAVYYCARGASGYDWSLDYWGQGTLVTVSSGGGGSGGGGSG GGGSKIVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNRHSGV PDRFSGSGSGTDFTLKISRVEAEDVGVYFCMQGSRWPPTFGPGTKVEIKSEQ ID NO: 125 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of F8 QIQLVQSGTEVKKPGESLKISCKGSGYSFISHWIGWVRQMPGKGLEWMGIIYPGDSGTRYSPSFQGQ ATISADKSISTAYLQWSSLKASDTAMYYCARLADGGLQFDHWGQGTLVTVSSGGGGSGGGGSGGG GSQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYGVSNRPSGVSNRF SGSKSGNTASLTISGLQAEDEADYYCNSYTSSSTYVFGTGTKVTVLSEQ ID NO: 126 is the amino acid sequence of an antigen recognition domain including the VH and VLsequences of E1 EVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSV KGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVPNYYDSSGTVWGQGTLVTVSSGGGGSGGGG SGGGGSNFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVP DRFSGSIDSSSNSASLTISGLEPEDEADYYCQSYDSTLLVFGGGTKLTVLSEQ ID NO: 127 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom A8 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSGGGG SGGGGSGGGGSLPVLTQPPSASGTPGQKVTISCSGSSSNIGSNYVFWYEQLPGAAPKLLMYSSNQR PSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDDSLSGWVFGGGTKLTVLTRFVPVFLPAKP TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC NHRPPALEWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADA PAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIG MKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 128 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom B2 QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGNTNYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGGSTSSGYRFDYWGQGTLVTVSSGGGGSGGGG SGGGGSQLVLTQSPSASASLGASVKLTCTLSSGHSNYAIAWHQQQPEKGPRFLMNVNRDGSYTKG DGIPDRFSGSSSGAERYLTISSLQSDDEADYYCQTWGTGVQVFGGGTKLTVLTRFVPVFLPAKPTTT PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHR PPALEWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAY QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMK GERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 129 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom B7 QVQLQQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKL QGRVTITRDTSASTAYMELSSLRSEDTAVYYCARDSGYDLFDYWGQGTLVTVSSGGGGSGGGGSG GGGSQAVVTQEPSFSVSPGGTVTLTCGLTSGSVSTTYYPSWYQQTPGQTPRTLIYKTNLRSPGVPD RFSGSILGNKAALTITGAQADDDSDYYCLLYMGSGVWVFGGGTRLTVLTRFVPVFLPAKPTTTPAPRP PTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRPPALE WVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAYQQGQN QLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRG KGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 130 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom C1 QVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSGTRYSPSFQG QVTISADKSISTAYLQWSSLKASNTAMYYCARQQGAGAFDIWGQGTMVTVSSGGGGSGGGGSGGG GSQSALTQPPSASGSPGQSVTISCTGTSRDVGGYNYVSWYQQHPGKAPKLILYEVTKRPSGVPDRF SGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTVVFGGGTKLTVLTRFVPVFLPAKPTTTPAPRPPT PAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRPPALEWV RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAYQQGQNQL YNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 131 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom C6 EVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAAS VKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRVPVVAGWYNWFDPWGQGTLVTVSSGGGGSG GGGSGGGGSQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPS GVPDRFSGSKSGNTASLTVSGLQAGDEADYYCSSYAGSNNVVFGGGTKLAVLTRFVPVFLPAKPTTT PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHR PPALEWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAY QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMK GERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 132 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom C8 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSGGGG SGGGGSGGGGSDIVMTQTPSTLSASVGDRVTITCRASQTISNWLAWYQQKPGKAPKLLIYKASTLES GVPSRFSGTGSGTEFTLTISSLQPDDFATYFCQQYHSYSRTFGQGTKVDVTRFVPVFLPAKPTTTPA PRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRPP ALEWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGER RRGKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 133 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom D3 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYEYWGQGTLVTVSSGGGGSGGGGS GGGGSQAVVTQEPSLTVSPGETVTLTCGSSTGAVTSDHHPYWFQQKPGQVPRTLMHDTSTRYSWT PARFSGSIVGGKAALTLSGAQPEDEAEYHCFLYYSGTAIFGGGTKLTVLTRFVPVFLPAKPTTTPAPR PPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRPPAL EWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAYQQGQ NQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRR GKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 134 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom E11 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDDYDFWSGSLGNYWGQGTLVTVSSGGGGSGGG GSGGGGSQSVLTQPPSASGTPGQRVTISCSGRSSNIGSNYVYWYQQPPGTAPKLLIYENNHRPSGV PDRFSASKSGTSASLAISGLRSEDEADYYCAAWDDTLNAWVFGGGTKLTVLTRFVPVFLPAKPTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRP PALEWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAYQ QGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGE RRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 135 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom E4 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVK GRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKGANYDILTGYRKDNWFDPWGQGTLVTVSSGGGG SGGGGSGGGGSDIVMTQSPATLSLSPGERATLSCRASQSVGSSLAWFQQKPGQAPRLLIYDASNRA TGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPYTFGQGTKLEIKTRFVPVFLPAKPTTT PAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHR PPALEWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSASCTRVKFSRSADAPAY QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMK GERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRSEQ ID NO: 136 is the amino acid sequence of a CAR having an antigen binding domain derivedfrom F10 QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLERVAVISYDGSNKYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDHHPYGSSDSFDYWGQGTLVTVSSGGGGSGGG GSGGGGSQAVVTQEPSLTVSPGGTVTLTCGSSTGAVTRGHYPYWLQQKPGQAPRTLIYDTVKKHS WTPARFSGSLVGGKAALTLSGAQPEDEADYYCLLSFIDTRYPARYVFGTGTKVTVLTRFVPVFLPAKP TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA...
Claims
CLAIMS1. An expression construct comprising a PGK promoter operably linked to:(i) a first nucleotide sequence encoding a chimeric antigen receptor (CAR); and(ii) a second nucleotide sequence encoding a FOXP3 polypeptide;wherein the first nucleotide sequence is located upstream of the second nucleotide sequence.
2. The expression construct of claim 1, wherein the expression construct does not comprise anyother coding nucleotide sequence.
3. The expression construct of claim 1 or 2, wherein the PGK promoter comprises or consists ofthe sequence of SEQ ID NO: 195 or a functional variant or functional fragment thereof, optionally wherein the PGK promoter is a truncated human PGK promoter or a functional variant having at least 70% identity thereto, optionally wherein the truncated human PGK promoter has the sequence of SEQ ID NO: 196, SEQ ID NO: 197, SEQ ID NO: 198 or SEQ ID NO: 199.
4. The expression construct of any preceding claim, wherein the CAR is a human CAR and / orwherein the CAR comprises an exodomain comprising an antigen recognition domain.
5. The expression construct of claim 4, wherein the antigen recognition domain specifically bindsto ENTPD3.
6. The expression construct of claim 4 or 5, wherein the antigen recognition domain is an antibody,an antibody fragment, or derived from an antibody, optionally wherein the antigen recognitiondomain is a single chain antibody (scFv).
7. The expression construct of any of claims 4 to 6, wherein the antigen recognition domaincomprises: i. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 7, 8 and 9 respectivelyand VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 10, 11 and 12 respectively; ii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 19, 20 and 21respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 22, 23 and 24 respectively; iii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 73, 74 and 75respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 76, 77 and 78 respectively; iv. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 25, 26 and 27respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 28, 29 and 30 respectively;v. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 37, 38 and 39respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 40, 41 and 42 respectively; vi. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 1, 2 and 3 respectivelyand VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 4, 5 and 6 respectively; vii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 13, 14 and 15respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 16, 17 and 18 respectively; viii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 31, 32 and 33respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 34, 35 and 36 respectively; ix. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 43, 44 and 45respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 46, 47 and 48 respectively; x. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 49, 50 and 51respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 52, 53 and 54 respectively; xi. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 55, 56 and 57respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 58, 59 and 60 respectively; xii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 61, 62 and 63respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 64, 65 and 66 respectively; xiii. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 67, 68 and 69respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 70, 71 and 72 respectively; or xiv. VH CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 79, 80 and 81respectively and VL CDR1, 2 and 3 sequences set forth in SEQ ID NOs: 82, 83 and 84 respectively; wherein one or more of said CDR sequences of (i) to (xiv) may optionally comprise 1 to 3 amino acid modifications relative to an aforementioned CDR sequence, particularly wherein one or more of said CDR sequences may optionally be modified by substitution, addition or deletion of 1 to 3 amino acids.
8. The expression construct of any of claims 4 to 7, wherein the antigen recognition domaincomprises: i. a VH domain comprising the sequence set forth in SEQ ID NO: 87, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising thesequence as set forth in SEQ ID NO: 88, or a sequence having at least 70% identity thereto; ii. a VH domain comprising the sequence set forth in SEQ ID NO: 91, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 92, or a sequence having at least 70% identity thereto; iii. a VH domain comprising the sequence set forth in SEQ ID NO: 109, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 110, or a sequence having at least 70% identity thereto; iv. a VH domain comprising the sequence set forth in SEQ ID NO: 93, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 94, or a sequence having at least 70% identity thereto; v. a VH domain comprising the sequence set forth in SEQ ID NO: 97, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 98, or a sequence having at least 70% identity thereto; vi. a VH domain comprising the sequence set forth in SEQ ID NO: 85, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 86, or a sequence having at least 70% identity thereto;vii. a VH domain comprising the sequence set forth in SEQ ID NO: 89, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 90, or a sequence having at least 70% identity thereto;viii. a VH domain comprising the sequence set forth in SEQ ID NO: 95, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 96, or a sequence having at least 70% identity thereto; ix. a VH domain comprising the sequence set forth in SEQ ID NO: 99, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 100, or a sequence having at least 70% identity thereto; x. a VH domain comprising the sequence set forth in SEQ ID NO: 101, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 102, or a sequence having at least 70% identity thereto; xi. a VH domain comprising the sequence set forth in SEQ ID NO: 103, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising thesequence as set forth in SEQ ID NO: 104, or a sequence having at least 70% identity thereto; xii. a VH domain comprising the sequence set forth in SEQ ID NO: 105, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 106, or a sequence having at least 70% identity thereto; xiii. a VH domain comprising the sequence set forth in SEQ ID NO: 107, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 108, or a sequence having at least 70% identity thereto; or xiv. a VH domain comprising the sequence set forth in SEQ ID NO: 111, or a sequencehaving at least 70% sequence identity thereto, and a VL domain comprising the sequence as set forth in SEQ ID NO: 112, or a sequence having at least 70% identity thereto.
9. The expression construct of any of claims 4 to 8, wherein the antigen recognition domaincomprises or consists of: i. the sequence set forth in SEQ ID NO: 114 or a sequence having at least 70%sequence identity thereto; ii. the sequence set forth in SEQ ID NO: 116 or a sequence having at least 70%sequence identity thereto; iii. the sequence set forth in SEQ ID NO: 125 or a sequence having at least 70%sequence identity thereto; iv. the sequence set forth in SEQ ID NO: 117 or a sequence having at least 70%sequence identity thereto; v. the sequence set forth in SEQ ID NO: 119 or a sequence having at least 70%sequence identity thereto; vi. the sequence set forth in SEQ ID NO: 113 or a sequence having at least 70%sequence identity thereto; vii. the sequence set forth in SEQ ID NO: 115 or a sequence having at least 70%sequence identity thereto; viii. the sequence set forth in SEQ ID NO: 118 or a sequence having at least 70%sequence identity thereto; ix. the sequence set forth in SEQ ID NO: 120 or a sequence having at least 70%sequence identity thereto; x. the sequence set forth in SEQ ID NO: 121 or a sequence having at least 70%sequence identity thereto; xi. the sequence set forth in SEQ ID NO: 122 or a sequence having at least 70%sequence identity thereto;xii. the sequence set forth in SEQ ID NO: 123 or a sequence having at least 70%sequence identity thereto; xiii. the sequence set forth in SEQ ID NO: 124 or a sequence having at least 70%sequence identity thereto; or xiv. the sequence set forth in SEQ ID NO: 126 or a sequence having at least 70%sequence identity thereto.
10. The expression construct of any preceding claim, wherein the CAR comprises or consists ofthe sequence of any one of SEQ ID NOs: 127 to 152 or a functional variant thereof having atleast 70% sequence identity thereto, particularly wherein the CAR comprises or consists of the sequence of SEQ ID NO: 128 or 130 or a functional variant having at least 70% sequenceidentity thereto.
11. The expression construct of any preceding claim, wherein the FOXP3 polypeptide has thesequence of SEQ ID NO: 200, SEQ ID NO: 201, SEQ ID NO: 202, SEQ ID NO: 203, SEQ ID NO: 204, SEQ ID NO: 205 or a variant having at least 70% identity thereto, or the second nucleotide sequence encoding the FOXP3 polypeptide has the sequence of SEQ ID NO: 206, SEQ ID NO: 207 or a sequence having at least 80% identity thereto.
12. The expression construct of any preceding claim, wherein the expression construct comprisesthe sequence of SEQ ID NO: 214 or a sequence having at least 70% identity thereto.
13. A nucleic acid molecule comprising an expression construct of any preceding claim, optionallywherein the nucleic acid molecule does not comprise any other coding nucleotide sequence.
14. A vector comprising the expression construct or nucleic acid molecule of any preceding claim,optionally wherein the vector is a plasmid or a viral vector, optionally a lentiviral vector orgamma-retroviral vector.
15. A cell comprising the expression construct of any of claims 1 to 12 or the nucleic acid moleculeof claim 13 or the vector of claim 14.
16. The cell of claim 15, wherein the cell is a production host cell or an immune cell or a progenitoror precursor thereof, for example a T cell or precursor thereof, or a stem cell, optionally wherein the cell is a regulatory T cell (Treg) or a precursor thereof, or an iPSC cell.
17. A pharmaceutical composition comprising a vector of claim 14, a cell of claim 15 or 16, or a cellpopulation, wherein the cell population comprises a cell of claim 15 or 16 or a plurality of cellsof claims 15 or 16, optionally a plurality of T cells or a plurality of Tregs of claim 16.
18. The cell of claim 15 or 16 or the pharmaceutical composition of claim 17, for use in therapy,optionally wherein the therapy is adoptive cell transfer therapy.
19. The cell of claim 15 or 16 or the pharmaceutical composition of claim 17, for use in inducingtolerance to a transplant, treating and / or preventing graft-versus-host disease (GvHD), treating or preventing an infectious, allergic, autoimmune or inflammatory disease, or for use in inducing immunosuppression, or for use in promoting tissue repair and / or tissue regeneration, particularly wherein the cell is a Treg, optionally wherein the autoimmune or inflammatory disease is type 1 diabetes.
20. A method of making a cell of claim 15 or 16, which comprises the step of introducing into thecell the expression construct of any of claims 1 to 12 or the nucleic acid molecule of claim 13or the vector of claim 14.
Citation Information
Patent Citations
Anti-viral vectors
WO1999041397A1
Codon optimisation for expression in retrovirus packaging cells
WO2001079518A3
Reversing the effects of the tumor microenvironment using chimeric cytokine receptors
WO2012138858A1
Polypeptide useful in adoptive cell therapy
WO2013153391A1
IMMUNOSUPPRESSIVE TGF-β SIGNAL CONVERTER
WO2014172584A1