Method for regulating rice growth by using nu1-h and application thereof
By introducing the NU1-H gene into rice, nitrogen use efficiency and seed protein content were regulated, solving the problem of low nitrogen use efficiency in rice, improving rice yield and quality, and providing new gene resources.
Patent Information
- Authority / Receiving Office
- CN · China
- Patent Type
- Patents(China)
- Current Assignee / Owner
- CHINA NAT RICE RES INST
- Filing Date
- 2024-12-27
- Publication Date
- 2026-06-02
AI Technical Summary
In existing technologies, the nitrogen utilization rate of rice is low, which affects yield and quality. There is a lack of effective genetic and germplasm resources to improve the nitrogen utilization efficiency.
The NU1-H gene was introduced to regulate rice growth, including nitrogen use efficiency, seed protein content, and yield. By constructing near-isogenic lines of the NU1-H type under Nipponbare and Koshihikari backgrounds, the nitrogen use efficiency, effective tiller number, yield per plant, and seed protein content of rice were improved.
The NU1-H haplotype significantly increased nitrogen content, protein content, effective tillering, and yield per plant in rice, enhanced nitrogen use efficiency, and provided new genetic resources and a foundation for research.
Smart Images

Figure CN119752935B_ABST
Abstract
Description
Technical Field
[0001] This invention relates to the field of genetic engineering technology, and in particular to a method for regulating rice growth using NU1-H and its application. Background Technology
[0002] Rice is one of my country's major food crops, and its yield and quality are closely related to people's lives. Although rice accounts for only one-quarter of the total sown area of all food crops, its yield accounts for one-third of the total grain output. Behind this high yield is the extensive use of nitrogen fertilizer in rice production. According to the National Bureau of Statistics, my country's nitrogen fertilizer application reached 16,033.416 thousand tons in 2023. Therefore, improving nitrogen utilization efficiency in rice and increasing grain yield is a popular research topic.
[0003] Numerous nitrogen-utilizing genes have been reported to date, such as NRT1.1B, OsGATA8, OsTCP19, DEP1, and OsAlaAT1. DEP1 controls erect, dense panicles, thereby increasing yield and achieving high nitrogen utilization. OsAlaAT1 regulates nitrogen utilization by modulating the carbon-nitrogen metabolic balance in rice, improving yield and quality. Among these nitrogen-utilizing genes, some superior haplotypes have been reported. OsGATA8-H, compared to other haplotypes, increases effective tillering in rice, achieving high nitrogen utilization; while OsTCP19-H, compared to other haplotypes, is more suitable for cultivation in low-fertility areas and is mainly found in wild rice, thus also improving nitrogen utilization. However, much remains unknown regarding genes involved in efficient nitrogen utilization in rice and their applications. Further exploration, discovery, and research of genes that can influence yield and quality are of great significance, and can further provide excellent gene and germplasm resources for efficient nitrogen utilization in rice production. Summary of the Invention
[0004] The purpose of this invention is to provide a method for regulating rice growth using NU1-H and its application, in order to solve the problems existing in the prior art. This invention provides the application of NU1-H in regulating rice growth, including regulating rice nitrogen use efficiency, regulating rice seed protein, and regulating rice yield.
[0005] To address the above problems, the present invention provides the following solution:
[0006] Technical Solution 1: A method for regulating rice growth, comprising the step of introducing NU1-H into the rice, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.
[0007] Furthermore, the regulation of rice growth includes regulating rice nitrogen use efficiency, regulating rice seed protein content, and regulating rice yield traits.
[0008] Furthermore, the rice yield traits include the number of effective tillers and the yield per plant.
[0009] Furthermore, the rice varieties include Nipponbare and Koshihikari.
[0010] This invention describes the construction of a NU1-H type near-isogenic line under Nipponbare and Koshihikari growing conditions. This NU1-H type near-isogenic line exhibits increased fresh weight, plant height, nitrogen content, protein content, number of effective tillers in the field, yield per plant, and nitrogen use efficiency under hydroponic conditions.
[0011] Technical Solution 2: Application of NU1-H or a vector including NU1-H in increasing the effective tiller number of rice, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.
[0012] Technical Solution 3: Application of NU1-H or a vector including NU1-H in increasing the yield per rice plant, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.
[0013] Technical Solution 4: Application of NU1-H or a carrier including NU1-H in improving nitrogen utilization in rice, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.
[0014] Technical Solution 5: Application of NU1-H or a vector including NU1-H in increasing the protein content of rice seeds, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.
[0015] Furthermore, the amino acid sequence of the protein encoded by NU1-H is shown in SEQ ID NO.2.
[0016] The present invention discloses the following technical effects:
[0017] This invention identified the superior haplotype NU1-H of the NU1 gene and constructed near-isogenic NU1-H lines under Nipponbare and Koshihikari backgrounds. Compared with the control, Nipponbare... NU1-H In hydroponic environments, plant fresh weight, plant height, and nitrogen content increase; in field environments, plant nitrogen content, protein content, number of effective tillers, and yield per plant all increase. (Koshihikari) NU1-H In hydroponic environments, plant height did not change significantly, but dry and fresh weight increased, and plant nitrogen content increased. In field environments, plant nitrogen content increased, protein content increased, the number of effective tillers in the field increased, and yield per plant increased.
[0018] In summary, the superior haplotype NU1-H can increase nitrogen content, protein content, effective tillering, and yield per plant in rice, and improve nitrogen use efficiency. Therefore, the superior haplotype NU1-H plays a key role in regulating rice growth, including nitrogen use efficiency, yield, and protein content. This invention provides new genetic resources and a research foundation for rice nitrogen metabolism research. Attached Figure Description
[0019] To more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the drawings used in the embodiments will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For those skilled in the art, other drawings can be obtained based on these drawings without creative effort.
[0020] Figure 1 For NU1 haplotype analysis, A: Haplotype analysis of NU1 based on the 3,000 Rice Resources Public Database; B: Distribution of the two haplotypes in different rice populations; C: Distribution of the two haplotypes in different rice populations.
[0021] Figure 2 This is a comparison of plant architecture of hydroponic seedlings of Nipponbare and Koshihikari and their NU1-H type near-isogenic lines under different nitrogen concentration treatments. A: Nipponbare and Koshihikari seedlings under low nitrogen conditions. NU1-H Comparison; B: Nipponbare and Nipponbare under high nitrogen conditions NU1-H Comparison; C: Koshihikari and Koshihikari under low nitrogen conditions NU1-H Comparison; D: Koshihikari and Koshihikari under high nitrogen conditions NU1-H Comparison; NIP: Nipponbare; Scale: 10cm;
[0022] Figure 3 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H A graph showing the correlation between growth traits of hydroponic seedlings under different nitrogen concentration treatments. A: Nipponbare and Nipponbare seedlings under different nitrogen concentrations. NU1-H Seedling height comparison; B: Nipponbare and Nipponbare under different nitrogen concentrations NU1-H Comparison of seedling fresh weight; C: Nipponbare and Nipponbare under different nitrogen concentrationsNU1-H Comparison of seedling dry weight; D: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Seedling height comparison; E: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Fresh weight comparison of seedlings; F: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Comparison of seedling dry weight; **: P<0.01; *: P<0.05; ns: no significant difference; NIP: Nipponbare;
[0023] Figure 4 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Nitrogen content of hydroponic seedlings under different nitrogen concentration treatments, where A: Nipponbare and Nipponbare seedlings under different nitrogen concentration conditions. NU1-H Comparison of nitrogen content in plants; B: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Comparison of nitrogen content in plants; NIP: Nipponbare; **: P<0.01;
[0024] Figure 5 Nipponbare and Nipponbare under different nitrogen fertilizer conditions NU1-H and Koshihikari and Koshihikari NU1-H A comparison of plant types, where A: Nipponbare and Nipponbare under low nitrogen conditions. NU1-H Plant type comparison; B: Nipponbare and Nipponbare under high nitrogen conditions NU1-H Plant type comparison; C: Koshihikari and Koshihikari under low nitrogen conditions NU1-H Plant type comparison; D: Koshihikari and Koshihikari under high nitrogen conditions NU1-H Plant type comparison, NIP: Nipponbare; scale bar: 10cm;
[0025] Figure 6 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Comparison of plant height and effective tiller number under different nitrogen fertilizer conditions, where A: Nipponbare and Nipponbare under low nitrogen and high nitrogen conditions. NU1-HPlant height comparison; B: Nipponbare and Nipponbare under low nitrogen and high nitrogen conditions NU1-H Comparison of effective tillering; C: Koshihikari and Koshihikari under low and high nitrogen conditions NU1-H Plant height comparison; D: Koshihikari and Koshihikari under low nitrogen and high nitrogen conditions NU1-H Comparison of effective tiller numbers; **: P < 0.01; *: P < 0.05; ns: no significant difference; NIP: Nipponbare;
[0026] Figure 7 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Comparison of single-plant yield under different nitrogen fertilizer conditions, where A: Nipponbare and Nipponbare under low nitrogen and high nitrogen conditions. NU1-H Comparison of yield per plant; B: Koshihikari and Koshihikari under low and high nitrogen conditions NU1-H Comparison of yield per plant; **: P<0.01; *: P<0.05; NIP: Nipponbare;
[0027] Figure 8 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Under normal nitrogen fertilizer conditions, the grain protein content, including A: Nipponbare and Nipponbare NU1-H Comparison of seed protein content; B: Koshihikari and Koshihikari NU1-H Comparison of seed protein content; P<0.05; NIP: Nipponbare. Detailed Implementation
[0028] Various exemplary embodiments of the present invention will now be described in detail. This detailed description should not be considered as a limitation of the present invention, but rather as a more detailed description of certain aspects, features, and embodiments of the present invention.
[0029] It should be understood that the terminology used in this invention is merely for describing particular embodiments and is not intended to limit the invention. Furthermore, with respect to numerical ranges in this invention, it should be understood that each intermediate value between the upper and lower limits of the range is also specifically disclosed. Any stated value or intermediate value within a stated range, as well as each smaller range between any other stated value or intermediate value within said range, is also included in this invention. The upper and lower limits of these smaller ranges may be independently included or excluded from the range.
[0030] Unless otherwise stated, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. While only preferred methods and materials have been described herein, any methods and materials similar or equivalent to those described herein may be used in the implementation or testing of this invention. All references to this specification are incorporated by way of citation to disclose and describe methods and / or materials associated with those references. In the event of any conflict with any incorporated reference, the content of this specification shall prevail.
[0031] Various modifications and variations can be made to the specific embodiments described in this specification without departing from the scope or spirit of the invention, as will be apparent to those skilled in the art. Other embodiments derived from this specification will also be readily apparent to those skilled in the art. This specification and embodiments are merely exemplary.
[0032] The terms “include,” “including,” “have,” “contain,” etc., used in this article are all open-ended terms, meaning that they include but are not limited to.
[0033] Example 1: Haplotype analysis of rice nitrogen utilization gene NU1
[0034] This invention analyzes the haplotype of NU1 using a public database of 3,000 rice resources (Rice SNP-Seek Database, https: / / snpseekv3.irri-e-extension.com / v2 / ). The specific steps are as follows:
[0035] Open the "Search-Genotype" function on the website https: / / snpseekv3.irri-e-extension.com / v2 / , enter the NU1 gene ID "LOC_Os10g25130" in the "Genelocus" field, select "Non-synonymous only" in the "IncludeSNPs" option, leave other settings as default, and click the "Search" button to obtain the haplotype distribution of NU1 in 3,000 rice samples (e.g., Figure 1(As shown in Figure A). There is a SNP site (A / G) at 12969703 bp in exon 2 of the NU1 coding region. This SNP site results in two forms of the 17th amino acid: Asn / Ser. Based on this SNP site, the NU1 gene can be divided into two haplotypes: NU1-L (Asn) and NU1-H (Ser) (as shown in Figure A). Figure 1 (As shown in Figure A). Classification of subpopulation information provided by the RiceSNP-SeekDatabase website revealed that haplotype NU1-L is mainly found in indica and japonica rice, while NU1-H is mainly found in Aus rice populations and the Southeast Asian fragrant rice Aromatic population (e.g., ...). Figure 1 (As shown in B). In modern indica and japonica rice, the proportion of NU1-L can reach over 98%; in older Aus rice and Southeast Asian fragrant rice, the proportion of NU1-H reaches over 80% (e.g., Figure 1 (As shown in C).
[0036] Nucleotide sequence of NU1-H:
[0037]
[0038] The amino acid sequence of the protein encoded by NU1-H:
[0039] MAAPSVAVDNLNPKVLSCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATTILASIPGRATGAYSHSQGIKGL RDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSASIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEENQRD IVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKD GILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYALRLLEEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD*(SEQ IDNO.2).
[0040] Example 2: Identification of nitrogen utilization capacity in rice plants with superior nitrogen utilization haplotype NU1-H
[0041] Nipponbare near-isogenic line NU1-H was constructed under the Nipponbare and Koshihikari backgrounds. NU1-H and Koshihikari NU1-H Hydroponic experiments with different nitrogen concentration gradients were conducted to detect the growth characteristics of plants under different nitrogen concentration conditions.
[0042] 1. The hydroponic experiment method is as follows:
[0043] (1) Wash the seeds with 75% anhydrous ethanol for 1 min, then soak the seeds in 50% sodium hypochlorite for 30 min, then wash them thoroughly with distilled water, and then soak them in distilled water at 37℃ for 24 h.
[0044] (2) After soaking, wrap the seeds with a damp towel and place them at 37°C in the dark for 48 hours to germinate.
[0045] (3) The standard nitrogen nutrient solution formula refers to the recommended standard of the International Rice Research Institute (IRRI). This invention also sets two nitrogen concentrations, namely low nitrogen (0.5 times the recommended standard nitrogen content) and high nitrogen (4 times the recommended standard nitrogen content). The contents of other elements refer to the recommended standard. The formula is shown in Table 1.
[0046] (4) After germination, select seeds with similar sprout and root lengths and sow them in a hydroponic box. Cultivate them in a 25℃ light incubator (12h light, 12h darkness).
[0047] (5) The hydroponic method is as follows: 3 days of hydroponics, 4 days of standard nitrogen nutrient solution culture, and 7 days of nutrient solution culture with different nitrogen concentrations, for a total of 14 days. The nutrient solution is changed every 3 days.
[0048] Precautions for hydroponics:
[0049] 1) The water temperature should not be too high or too low, but around 25℃;
[0050] 2) The roots should be kept away from light to prevent algae growth and root respiration losses;
[0051] 3) When culturing in large bodies of water, the pH of the culture medium should be between 5 and 6, and should not be lower than 4.
[0052] 4) Large-volume culture requires water circulation to avoid the precipitation of trace elements such as iron under low oxygen conditions;
[0053] 5) For large-volume culture, the culture medium can be changed every 3-4 weeks, while for small-volume culture, it should be changed every 3-5 days. If the seedlings turn yellow, nitrogen should be added in time.
[0054] 6) After 14 days of hydroponics, 10 representative plants with basically uniform growth were randomly selected to examine the agronomic traits and nitrogen content of the seedlings.
[0055] Table 1. Hydroponic Nutrient Solution Formula (Recommended Standard Nitrogen Content)
[0056]
[0057]
[0058] Note: All of the above are stock solutions. They need to be diluted 1000 times when preparing the working solution. The amount of macro-elements used during the seedling stage is 1 / 4 of the normal amount. For micro-element stock solutions, add 500mL of concentrated sulfuric acid and 10-15g of EDTA per 10L. The pH needs to be adjusted to around 5.5 when preparing the working solution.
[0059] 2. Results of the hydroponic experiment
[0060] 2.1 Comparison of plant architecture of Nipponbare, Koshihikari, and NU1-H near-isogenic lines under different nitrogen treatments. Figure 2 As shown. Figure 2 This image shows a comparison of plant morphology of hydroponic seedlings of Nipponbare and Koshihikari and their NU1-H near-isogenic lines under different nitrogen concentration treatments. The japonica rice varieties Nipponbare and Koshihikari carry the NU1-H haplotype, as does the AUS rice variety Kasalath. Using Kasalath as the donor and Nipponbare and Koshihikari as the recipients, marker-assisted backcrossing was used to label the target haplotype (NU1-H) in rice. Individuals with the target haplotype were selected directly at the DNA level without phenotype dependence. Through marker-assisted selection, plants carrying the NU1-H haplotype were screened from a large number of rice plants, ultimately yielding Nipponbare lines carrying the NU1-H haplotype against backgrounds of Nipponbare and Koshihikari. NU1-H and Koshihikari NU1-H Hydroponic experiments with different nitrogen concentrations showed that Nipponbare [a specific hydroponic system] was more effective under both low and high nitrogen conditions. NU1-H The seedlings were all taller than those of Nipponbare and Koshihikari. NU1-H The seedling height is not much different from that of Koshihikari.
[0061] 2.2 Results of agronomic traits of NU1-H type near-isogenic lines constructed from Nipponbare and Koshihikari and their backgrounds under different nitrogen concentration treatments are as follows: Figure 3 As shown, under both low and high nitrogen conditions, the NU1-H type near-isogenic lines exhibited significantly higher fresh and dry weights than Nipponbare and Koshihikari rice varieties. This indicates that the NU1-H type near-isogenic lines altered the agronomic traits of rice plants and promoted growth. Figure 3 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Graph showing the correlation between growth traits of hydroponic seedlings under different nitrogen concentration treatments. (Nipponbare) NU1-H Seedling height and fresh weight were significantly higher in both low-nitrogen and high-nitrogen treatments than in Nipponbare. Under low-nitrogen treatment, Nipponbare seedlings... NU1-H The dry weight of the seedlings was significantly higher than that of Nipponbare ( Figure 3 A- Figure 3 C), Koshihikari NU1-H The fresh weight and dry weight of seedlings under both low-nitrogen and high-nitrogen treatments were significantly higher than those under Koshihikari ( Figure 3 E and Figure 3 The F in the figure indicates that the NU1-H haplotype can improve the absorption and utilization of nitrogen in rice seedlings under low and high nitrogen conditions.
[0062] 2.3 Five seedlings with similar growth under different nitrogen levels were selected as a group, and the nitrogen content of the whole seedlings in three groups was measured. The samples were blanched at 108℃ for 1 hour, dried at 80℃ to constant weight, weighed, and then pulverized using a pulverizer. The seed nitrogen content was determined using the method described in Example 3, and the results are as follows: Figure 4 As shown, under both low and high nitrogen conditions, the nitrogen content of the NU1-H near-isogenic line was higher than that of the wild type, indicating that the NU1-H near-isogenic line altered the absorption and transfer of nitrogen by rice seedlings, thereby improving nitrogen utilization efficiency. Figure 4 Nitrogen content in hydroponic seedlings under different nitrogen concentration treatments. Nipponbare under high nitrogen treatment conditions. NU1-H The nitrogen content in seedlings was significantly higher than that in Nipponbare. Figure 4 A) in Koshihikari NU1-H The nitrogen content in the seedlings was significantly higher than that in Koshihikari ( Figure 4 The result of B indicates that the NU1-H haplotype can improve nitrogen absorption in rice under high nitrogen conditions.
[0063] Example 3: Determination of nitrogen content in rice plants and protein content in seeds.
[0064] First, the nitrogen content of mature seeds, leaves, and stems of wild-type and NU1-H near-isogenic lines was determined using a SEALAutoAnalyzer 3 rheometer. Then, the protein content of the seeds was calculated based on the nitrogen content data using the following formula:
[0065] Protein content (%) = C0 × 0.1 × 5.95 ÷ (200 × (1 - water content)) × 100.
[0066] C0 represents the nitrogen content (mg / L) measured by a rheometer; the moisture content of rice noodles is generally around 8%, and this example is calculated based on 8%.
[0067] The method for determining the nitrogen content of seeds is as follows:
[0068] (1) Weigh 200 mg of the sample to be tested and place it in a digestive tube. Each sample is repeated 3 times.
[0069] (2) Add 5 mL of H2SO4 to the digestion tube, digest at 290℃ for 20 min, and remove the digestion tube after boiling and shake well.
[0070] (3) Continue digestion for 1 hour, shaking once every 20 minutes;
[0071] (4) Remove the digestion tube and let it cool to room temperature. Add 2 mL of H2O2 and shake well.
[0072] (5) Digest again for 10 minutes. After the digestion is complete, observe whether the sample solution becomes clear. If it becomes clear, remove the digestion tube and cool it to room temperature. If the sample still has color, cool it to room temperature and add 200 μL H2O2. Shake well and digest again for 10 minutes. Repeat this step until the sample solution becomes clear.
[0073] (6) Add ddH2O to the digestion tube cooled to room temperature and bring the volume up to 100 mL;
[0074] (7) Before testing, shake the sample well, let it stand for 20 minutes, then use a sample cup to collect the supernatant of the sample and measure it using a SEALAutoAnalyzer 3 rheometer. Calculate the nitrogen content using the following formula:
[0075] Nitrogen content (mg / g) = C0 × 0.1 ÷ 0.2.
[0076] Where C0 is the N content (mg / L) measured by the rheometer; 0.1 is the volume of 100 mL of the sample to be tested, which is converted to 0.1 L; and 0.2 is the sample mass.
[0077] Protein content test results as follows Figure 8 As shown. Figure 8 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Protein content in mature seeds. A comparison revealed that Nipponbare... NU1-H and Koshihikari NU1-H The protein content in the grains was significantly higher than that in Nipponbare and Koshihikari, indicating that the NU1-H haplotype can improve the nitrogen utilization efficiency of rice.
[0078] Example 4: Investigation of agronomic traits of rice
[0079] 1. Investigation of hydroponic seedlings
[0080] Seedlings that grew relatively uniformly under different nitrogen levels after 14 days of hydroponics were measured for height and fresh weight. Five seedlings were grouped together, with three replicates. The remaining seedlings were wrapped in aluminum foil and placed in an oven at 108℃ for 1 hour to sterilize, then dried at 80℃ to constant weight, and the dry weight was measured. The results are as follows: Figure 3 As shown.
[0081] 2. Investigation of field agronomic traits under low and high nitrogen conditions
[0082] The nitrogen fertilizer application rate was 75 kg·ha⁻¹ for low-nitrogen fields and 180 kg·ha⁻¹ for high-nitrogen fields. The application rates of other fertilizers were identical. At maturity, 10 representative plants with similar growth were randomly selected, and the number of effective tillers and the height from the ground to the highest point of the main ear were recorded and photographed. Figure 5 The calculated average value is the final data for effective tillers and plant height (e.g., ...). Figure 6 (As shown). The results show that under low nitrogen and high nitrogen conditions, Nipponbare... NU1-H Koshihikari's plant height and effective tiller number were both higher than those of Nipponbare; under both low and high nitrogen conditions, Koshihikari... NU1-H The effective tiller number is higher than that of Koshihikari. This indicates that the NU1-H haplotype can improve nitrogen utilization in rice under both low and high nitrogen conditions.
[0083] At the same time, the yield per plant of each strain was calculated (e.g., Figure 7 As shown in the figure, the results show that under low nitrogen and high nitrogen conditions, Nipponbare NU1-H Koshihikari's yield per plant was higher than that of Nipponbare under both low and high nitrogen conditions. NU1-H The yield per plant was higher than that of Koshihikari; this indicates that the NU1-H haplotype can improve the yield per plant and nitrogen use efficiency of rice under both low and high nitrogen conditions.
[0084] The embodiments described above are merely preferred embodiments of the present invention and are not intended to limit the scope of the present invention. Various modifications and improvements made by those skilled in the art to the technical solutions of the present invention without departing from the spirit of the present invention should fall within the protection scope defined by the claims of the present invention.
Claims
1. A method for regulating rice growth, characterized in that, This includes the step of introducing NU1-H into the rice, the nucleotide sequence of which is shown in SEQ ID NO.1; The regulation of rice growth aims to improve nitrogen utilization efficiency, increase protein content in rice seeds, and enhance yield traits in rice. The rice yield traits mentioned are the number of effective tillers and the yield per plant.
2. The application of NU1-H or a carrier including NU1-H in increasing the effective tiller number of rice, characterized in that, The nucleotide sequence of NU1-H is shown in SEQ ID NO.
1.
3. The application of NU1-H or a carrier including NU1-H in increasing the yield per rice plant, characterized in that, The nucleotide sequence of NU1-H is shown in SEQ ID NO.
1.
4. The application of NU1-H or a carrier including NU1-H in improving nitrogen use efficiency in rice, characterized in that, The nucleotide sequence of NU1-H is shown in SEQ ID NO.
1.
5. The application of NU1-H or a carrier including NU1-H in increasing the protein content of rice seeds, characterized in that, The nucleotide sequence of NU1-H is shown in SEQ ID NO.1.
Citation Information
Patent Citations
Method for improving yield and quality of rice
CN118755734A