Tissue specific anellovector delivery

Abstract

Anelloviridae family vectors (e.g., anellovectors) can be used to deliver various therapeutic effectors to desired tissues in a subject, such as liver tissue, kidney tissue, spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, or bone marrow tissue. In some embodiments, the anellovectors do not substantially target heart tissue. In some embodiments, anellovectors can be used to deliver a chimeric antigen receptor (CAR) to a tissue comprising T cells, for example, in the spleen.

Description

[0001] TISSUE SPECIFIC ANELLOVECTOR DELIVERY CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of U.S. Provisional Application No.63 / 590,180, filed October 13, 2023. The contents of the aforementioned application are hereby incorporated by reference in their entirety. SEQUENCE LISTING The instant application contains a Sequence Listing which has been submitted electronically in XML file format and is hereby incorporated by reference in its entirety. Said XML copy, created on October 8, 2024, is named V2057-7035WO_SL.xml and is 341,538 bytes in size. BACKGROUND There is an ongoing need to develop suitable vectors to deliver therapeutic genetic material to patients. SUMMARY The present disclosure provides, among other things, methods of using Anelloviridae family vectors (e.g., anellovectors) to deliver various therapeutic effectors to desired tissues in a subject. As described herein (e.g., in Example 2), anellovectors administered intravenously can target several important tissues in the body, including spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, liver tissue, kidney tissue, or bone marrow tissue. In another aspect, the anellovectors do not substantially target heart tissue, which is an advantageous safety feature. Targeting of the above- mentioned tissues allows anellovectors to deliver certain therapeutics to the desired tissue. For example, anellovectors can be used to deliver a chimeric antigen receptor (CAR) to a tissue comprising T cells, for example, in the spleen. The present disclosure also provides methods of administering to a subject a first plurality of anellovectors to deliver therapeutic effectors to desired tissues, including without limitation spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, liver tissue, kidney tissue, or bone marrow tissue, and administering to the same subject a second plurality of anellovectors to deliver the same or different therapeutic effectors. In one aspect, the delivery of the second plurality of anellovectors results in increased copies (e.g., at least a 10-fold increase) of the genetic element encoding the therapeutic effector relative to the copies of the genetic element delivered by the first plurality of anellovectors. The present disclosure also provides an Anelloviridae family vector (e.g., anellovector), e.g., a synthetic Anelloviridae family vector (e.g., anellovector), that can be used as a delivery vehicle, e.g., for delivering genetic material, for delivering an effector, e.g., a payload, or for delivering a therapeutic agent or a therapeutic effector to a eukaryotic cell (e.g., a human cell or a human tissue). Additional features of any of the aforesaid Anelloviridae family vectors (e.g., anellovectors), compositions or methods include one or more of the following enumerated embodiments. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following enumerated embodiments. Enumerated Embodiments 1. A method of delivering a genetic element to a spleen tissue, ovary tissue, or lymph node tissue of a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element. 2. The method of embodiment 1, which results in production of the exogenous effector in the spleen tissue, ovary tissue, or lymph node tissue. 3. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in liver tissue of the subject. 4. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the spleen tissue than in kidney tissue of the subject. 5. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in heart tissue of the subject. 6. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in lung tissue of the subject. 7. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in brain tissue of the subject. 8. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in muscle tissue of the subject. 9. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the ovary tissue than in liver tissue of the subject. 10. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the ovary tissue than in kidney tissue of the subject. 11. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the ovary tissue than in heart tissue of the subject. 12. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the ovary tissue than in lung tissue of the subject. 13. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the ovary tissue than in brain tissue of the subject. 14. The method of embodiment 1 or 2, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the ovary tissue than in muscle tissue of the subject. 15. The method of any of the preceding embodiments, wherein the proteinaceous exterior of the Anelloviridae family vector comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 58, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. 16. The method of any of the preceding embodiments, wherein the administration is intravenous administration, e.g., intravenous limb vein administration, e.g., intravenous arm vein administration. 17. The method of any of the preceding embodiments, which results in genetic element in CD45+ cells of the spleen tissue at a level of at least 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 50,000, or 100,000 copies of the genetic element / µg total DNA. 18. The method of embodiment 17, wherein the proteinaceous exterior of the Anelloviridae family vector comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. 19. The method of embodiment 18 or 19, wherein the administration is intravenous administration, e.g., intravenous limb vein administration, e.g., intravenous arm vein administration. 20. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is detected at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a heart tissue and / or thymus tissue relative to the level detected in the heart tissue and / or thymus tissue. 21. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a heart tissue and / or thymus tissue relative to the level in the heart tissue and / or thymus tissue. 22. The method of embodiment 21, wherein the tissue of the subject other than the heart tissue and / or thymus tissue is liver tissue, spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, kidney tissue, or bone marrow tissue. 23. The method of embodiment 22, wherein the proteinaceous exterior of the Anelloviridae family vector comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. 24. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is detected at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a liver tissue relative to the level detected in the liver tissue. 25. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a liver tissue relative to the level in the liver tissue. 26. The method of embodiment 25, wherein the tissue of the subject other than the liver tissue is spleen tissue, and the genetic element is at levels of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than the liver tissue. 27. The method of embodiment 25, wherein the tissue of the subject other than the liver tissue is kidney tissue, and the genetic element is at levels of and the genetic element is at levels of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the kidney tissue than the liver tissue. 28. The method of embodiment 25, wherein the tissue of the subject other than the liver tissue is ovary tissue, and the genetic element is at levels of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the ovary tissue than the liver tissue. 29. The method of embodiment 25 or 26, wherein the proteinaceous exterior of the Anelloviridae family vector comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 58, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. 30. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is detectable in a tissue other than a heart tissue and / or thymus tissue of the subject, and wherein the genetic element or exogenous effector is undetectable in the heart tissue and / or thymus tissue of the subject. 31. The method of embodiment 5, wherein the tissue of the subject is liver tissue, spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, kidney tissue, or bone marrow tissue. 32. The method of embodiment 30 or 31, wherein the exogenous effector is expressed in the tissue of the subject. 33. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is detectable in a tissue of the subject, and wherein 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies of the genetic element / µg total DNA are detected in the heart tissue and / or thymus tissue of the subject. 34. The method of embodiment 33, wherein the tissue of the subject is liver tissue, spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, kidney tissue, or bone marrow tissue. 35. A method of delivering a genetic element to a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is detectable in a tissue of the subject, and wherein less than 50, 40, 30, 20, or 10 copies of the genetic element / µg total DNA are detected in the liver tissue of the subject. 36. The method of embodiment 35, wherein the tissue of the subject is spleen tissue, kidney tissue, or ovary tissue. 37. The method of embodiment 35 or 36, wherein the proteinaceous exterior of the Anelloviridae family vector comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 58, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. 38. A method of delivering a genetic element to a tissue of a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and wherein the tissue is a non-ocular tissue. 39. The method of embodiment 38, wherein the non-ocular tissue is chosen from liver tissue, spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue. 40. A method of delivering a genetic element to cells or a tissue of a subject, the method comprising administering to the subject an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. 41. The method of embodiment 40, wherein the tissue is chosen from liver tissue, spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue, or the cells are chosen from liver, spleen, ovary, lymph node, lung, liver, bone marrow, kidney, or skeletal muscle cells. 42. The method of embodiment 40 wherein the cells comprise PBMCs (e.g., activated PBMCs). 43. The method of embodiment 40 or 42, wherein the cells comprise CD3+ PBMCs (e.g., activated CD3+ PBMCs). 44. The method of embodiment 43, wherein the genetic element is in the CD3+ cells at a level of at least 107, 108,109, 2 x 109, 4 x 109, or 5 x 109copies of the genetic element / µg total DNA. 45. The method of any of embodiments 43 or 44, wherein the genetic element is at levels at least 1.5, 2, or 2.5-fold higher in CD3+ PBMCs than in CD3- PBMCs of the subject. 46. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the spleen tissue than in liver tissue of the subject. 47. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the spleen tissue than in bone marrow tissue of the subject. 48. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the spleen tissue than in muscle tissue of the subject. 49. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in lung tissue of the subject. 50. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in heart tissue of the subject. 51. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the spleen tissue than in ovary tissue of the subject. 52. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in brain tissue of the subject. 53. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in whole eye tissue of the subject. 54. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the spleen tissue than in kidney tissue of the subject. 55. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the bone marrow tissue than in muscle tissue of the subject. 56. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the bone marrow tissue than in lung tissue of the subject. 57. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the bone marrow tissue than in heart tissue of the subject. 58. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the bone marrow tissue than in ovary tissue of the subject. 59. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the bone marrow tissue than in brain tissue of the subject. 60. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the bone marrow tissue than in whole eye tissue of the subject. 61. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the bone marrow tissue than in kidney tissue of the subject. 62. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the liver tissue than in muscle tissue of the subject. 63. The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000-fold higher in the liver tissue than in lung tissue of the subject. 64.The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the liver tissue than in heart tissue of the subject. 65.The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100-fold higher in the liver tissue than in ovary tissue of the subject. 66.The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the liver tissue than in brain tissue of the subject. 67.The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the liver tissue than in whole eye tissue of the subject. 68.The method of any of embodiments 38-45, wherein the genetic element is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in the liver tissue than in kidney tissue of the subject. 69. The method of any of the embodiments 20-68, wherein the administration is intravenous administration, e.g., intravenous limb vein administration, e.g., intravenous arm vein administration. 70. The method of any of the preceding embodiments, wherein the genetic element or exogenous effector is detected at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a heart tissue and / or thymus tissue relative to the level detected in the heart tissue and / or thymus tissue. 71. The method of any of the preceding embodiments, wherein the genetic element or exogenous effector is detectable in a tissue other than heart tissue and / or thymus tissue of the subject, and wherein the genetic element or exogenous effector is undetectable in the heart tissue or thymus tissue of the subject. 72. The method of any of the preceding embodiments, wherein the genetic element or exogenous effector is detectable in a tissue of the subject, and wherein 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies of the genetic element / µg total DNA are detected in the heart tissue and / or thymus tissue of the subject. 73. The method of any of the preceding embodiments, wherein the tissue is a non-ocular tissue. 74. The method of embodiment 73, wherein the non-ocular tissue is chosen from liver tissue, spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue. 75. The method of any of the preceding embodiments, wherein the subject is a human subject. 76. The method of any of the preceding embodiments, wherein the exogenous effector is a peptide or polypeptide, e.g., an intracellular peptide or intracellular polypeptide, a secreted polypeptide, or a protein replacement therapeutic. 77. The method of embodiment 76, wherein the exogenous effector is a cytokine, an enzyme, an antibody (e.g., one or a plurality of polypeptides encoding at least a heavy chain or a light chain), a transcription factor, a receptor (e.g., a membrane receptor), a membrane transporter, a carrier protein, a structural protein, a nuclease, or a functional fragment thereof. 78. The method of embodiment 76, wherein the exogenous effector is a hormone, a ligand, a secreted protein, or a functional fragment thereof. 79. The method of any of embodiments 76-78, wherein the exogenous effector has a molecular weight of at least 25, 30, 35, 40, 45, or 50 kilodaltons. 80. The method of any of embodiments 76-78, wherein the exogenous effector has a molecular weight of less than 5, 10, 15, or 20 kilodaltons. 81. The method of any of embodiments 76-78, wherein the exogenous effector is a polypeptide having a length of at least 200, 250, 300, 350, 400, 450, or 500 amino acids. 82. The method of any of embodiments 76-78, wherein the exogenous effector is a polypeptide having a length of less than 50, 100, 150, 160, 170, or 180 amino acids. 83. The method of any of the preceding embodiments, wherein the exogenous effector is a nucleic acid molecule. 84. The method of any of the preceding embodiments, wherein the exogenous effector is not a human growth hormone (hGH). 85. The method of any of the preceding embodiments, wherein the exogenous effector is not a fluorescent protein (e.g., luciferase). 86. The method of any of the preceding embodiments, wherein the administration is intravenous administration, e.g., intravenous limb vein administration, e.g., intravenous arm vein administration. 87. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the spleen tissue at a level of at least 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 50,000, or 100,000 copies of the genetic element / µg total DNA. 88. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the spleen tissue at a level of 1,000-2,000, 2,000-3,000, 3,000-4,000, 4,000-5,000, 5,000-6,000, 6,000-7,000, 7,000-8,000, 8,000-9,000, 9,000-10,000, 10,000-50,000, or 50,000-100,000 copies of the genetic element / µg total DNA. 89. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the lymph node tissue at a level of at least 100, 200, 300, 400, 500, 1000, or 1500 copies of the genetic element / µg total DNA. 90. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the lymph node tissue at a level of 100-200, 200-300, 300-400, 400-500, 500-1000, or 1000- 1500 copies of the genetic element / µg total DNA. 91. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the bone marrow tissue at a level of at least 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000 copies of the genetic element / µg total DNA. 92. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the bone marrow tissue at a level of 100-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, or 900-1,000 copies of the genetic element / µg total DNA. 93. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the lung tissue at a level of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 50, or 100 copies of the genetic element / µg total DNA. 94. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the lung tissue at a level of 1-5, 5-10, 10-50, or 50-100 copies of the genetic element / µg total DNA. 95. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the skeletal muscle tissue at a level of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 500, or 1000 copies of the genetic element / µg total DNA. 96. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the skeletal muscle tissue at a level of 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-500, or 500-1000 copies of the genetic element / µg total DNA. 97. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the ovary tissue at a level of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 copies of the genetic element / µg total DNA. 98. The method of any of the preceding embodiments, which results in Anelloviridae family vector in the ovary tissue at a level of 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 copies of the genetic element / µg total DNA. 99. The method of any of the preceding embodiments, wherein the level of the genetic element in a cell or tissue is determined by qPCR for a sequence in the genetic element, optionally wherein the sequence in the genetic element is the sequence encoding the exogenous effector. 100. The method of any of the preceding embodiments, which results in production of the exogenous effector in a tissue of the subject. 101. The method of embodiment 100, wherein the tissue of the subject is selected from liver tissue, spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue. 102. The method of any of the preceding embodiments, further comprising one or more additional administrations of Anelloviridae family vectors. 103. The method of embodiment 102, wherein the one or more additional administrations of Anelloviridae family vectors results in an increased number of copies of the genetic element relative to the copies of the genetic element delivered by the initial administration of Anelloviridae family vectors. 104. The method of embodiment 103, wherein the one or more additional administrations of Anelloviridae family vectors results in at least a 10-fold increase in copies of the genetic element relative to the copies of the genetic element delivered by the initial administration of Anelloviridae family vectors. 105. The method of any of the preceding embodiments, wherein the subject has previously been administered an Anelloviridae family vector. 106. The method of embodiment 105, wherein the administration of the Anelloviridae family vector results in an increased number of copies of the genetic element relative to the copies of the genetic element delivered by the previous administration of Anelloviridae family vectors. 107. The method of embodiment 106, wherein the administration of the Anelloviridae family vector results in at least a 10-fold increase in copies of the genetic element relative to the copies of the genetic element delivered by the previous administration of Anelloviridae family vectors. 108. The method of any one of embodiments 102-107, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the spleen tissue at a level of at least 10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000, 90,000, or 100,000 copies of the genetic element / µg total DNA. 109. The method of any one of embodiments 102-108, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the spleen tissue at a level of 10,000-20,000, 20,000-30,000, 30,000-40,000, 40,000-50,000, 50,000-60,000, 60,000- 70,000, 70,000-80,000, 80,000-90,000, or 90,000-100,000 copies of the genetic element / µg total DNA. 110. The method of any one of embodiments 102-109, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the lymph node tissue at a level of at least 1,000, 2,000, 3,000, 4,000, or 5,000 copies of the genetic element / µg total DNA. 111. The method of any one of embodiments 102-110, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the lymph node tissue at a level of 500-1,000, 1,000-2,000, 2,000-3,000, 3,000-4,000, or 4,000-5,000 copies of the genetic element / µg total DNA. 112. The method of any one of embodiments 102-111, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the lung tissue at a level of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 copies of the genetic element / µg total DNA. 113. The method of any one of embodiments 102-112, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the lung tissue at a level of 10-50 or 50-100 copies of the genetic element / µg total DNA. 114. The method of any one of embodiments 102-113, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of at least 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or 10,000 copies of the genetic element / µg total DNA. 115. The method of any one of embodiments 102-114, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of 1000-2000, 2000-3000, 3000-4000, 4000-5000, 5000-6000, 6000-7000, 7000- 8000, 8000-9000, or 9000-10,000 copies of the genetic element / µg total DNA. 116. The method of any one of embodiments 102-115, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of at least 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000 copies of the genetic element / µg total DNA. 117. The method of any one of embodiments 102-116, wherein the one or more additional administrations of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of 100-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, or 900-1,000 copies of the genetic element / µg total DNA. 118. A method of delivering a genetic element to a mammalian cell, the method comprising contacting the cell with an Anelloviridae family vector, wherein the Anelloviridae family vector comprises: a genetic element encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR), and a proteinaceous exterior enclosing the genetic element. 119. The method of embodiment 118, wherein the cell is a T cell. 120. The method of embodiment 118 or 119, wherein the mammalian cell is situated in a subject, e.g., in the spleen tissue of the subject. 121. The method of any of embodiments 118-120, wherein the Anelloviridae family vector is administered intravenously to the subject. 122. A mammalian cell (e.g., a T cell) comprising a genetic element encoding a CAR. 123. A mammalian cell (e.g., a T cell) comprising a single stranded DNA molecule encoding a CAR. 124. A genetic element comprising: one or both of: (i) an Anellovirus 5’ UTR conserved domain, and / or (ii) an Anellovirus GC-rich region; a promoter; and a sequence encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR). 125. A nucleic acid molecule (e.g., a genetic element or a genetic element construct) comprising: one or both of: (i) an Anellovirus 5’ UTR conserved domain, and / or (ii) an Anellovirus GC-rich region; a promoter; and a sequence encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR). 126. An Anelloviridae family vector comprising: the genetic element of embodiment 124 or 125, and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule. 127. An Anelloviridae family vector comprising: a genetic element encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR), and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule. 128. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of any of embodiments 118-127, wherein the CAR comprises an antigen binding domain, a transmembrane domain, and a signaling domain. 129. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of embodiment 128, wherein the antigen binding domain comprises an scFv. 130. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of embodiment 128 or 71, wherein the antigen binding domain binds an antigen chosen from CD19 and BCMA. 131. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of any of embodiments 128-130, wherein the transmembrane domain comprises a transmembrane region of CD8 or CD28. 132. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of any of embodiments 128-131, wherein the signaling domain comprises a signaling domain of CD3- zeta. 133. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of any of embodiments 128-132, wherein the CAR further comprises a costimulatory signaling domain. 134. The method, cell, genetic element, nucleic acid molecule, or Anelloviridae family vector of embodiment 133, wherein the costimulatory domain is selected from 4-1BB or CD28. 135. A method of delivering a genetic element to a spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue of a subject who has been previously administered a first plurality of Anelloviridae family vectors, the method comprising administering to the subject a second plurality of Anelloviridae family vectors, wherein the first and second plurality of Anelloviridae family vectors each comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element. 136. A method of delivering a genetic element to a spleen tissue, ovary tissue, or lymph node tissue of a subject who has been previously administered a first plurality of Anelloviridae family vectors, the method comprising administering to the subject a second plurality of Anelloviridae family vectors, wherein the first and second plurality of Anelloviridae family vectors comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element. 137. The method of embodiment 135 or 136, wherein the subject is a human subject. 138. The method of any of embodiments 135-137, wherein the second plurality of Anelloviridae family vectors is administered to the subject intravenously. 139. The method of any of embodiments 135-138, wherein the genetic element is delivered to the liver tissue. 140. The method of any of embodiments 135-139, wherein the delivery of a second plurality of Anelloviridae family vectors results in an increased copies of the genetic element relative to the copies of the genetic element delivered by the first plurality of Anelloviridae family vectors. 141. The method of embodiment 140, wherein the delivery of a second plurality of Anelloviridae family vectors results in at least a 10-fold increase in copies of the genetic element relative to the copies of the genetic element delivered by the first plurality of Anelloviridae family vectors. 142. The method of embodiment 141, wherein the administration of the Anelloviridae family vector results in an increased copies of the genetic element relative to the copies of the genetic element delivered by the previous administration of Anelloviridae family vectors. 143. The method of embodiment 142, wherein the administration of the Anelloviridae family vector results in at least a 10-fold increase in copies of the genetic element relative to the copies of the genetic element delivered by the previous administration of Anelloviridae family vectors. 144. The method of any one of embodiments 135-143, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the spleen tissue at a level of at least 10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000, 90,000, or 100,000 copies of the genetic element / µg total DNA. 145. The method of any one of embodiments 135-144, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the spleen tissue at a level of 10,000-20,000, 20,000-30,000, 30,000-40,000, 40,000-50,000, 50,000-60,000, 60,000-70,000, 70,000-80,000, 80,000-90,000, or 90,000-100,000 copies of the genetic element / µg total DNA. 146. The method of any one of embodiments 135-145, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the lymph node tissue at a level of at least 1,000, 2,000, 3,000, 4,000, or 5,000 copies of the genetic element / µg total DNA. 147. The method of any one of embodiments 135-146, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the lymph node tissue at a level of 1,000-2,000, 2,000-3,000, 3,000-4,000, or 4,000-5,000 copies of the genetic element / µg total DNA. 148. The method of any one of embodiments 135-147, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the lung tissue at a level of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 copies of the genetic element / µg total DNA. 149. The method of any one of embodiments 135-148, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the lung tissue at a level of 10-50 or 50-100 copies of the genetic element / µg total DNA. 150. The method of any one of embodiments 135-149, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of at least 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or 10,000 copies of the genetic element / µg total DNA. 151. The method of any one of embodiments 135-150, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of 1000-2000, 2000-3000, 3000-4000, 4000-5000, 5000-6000, 6000-7000, 7000-8000, 8000-9000, or 9000-10,000 copies of the genetic element / µg total DNA. 152. The method of any one of embodiments 135-151, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of at least 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000 copies of the genetic element / µg total DNA. 153. The method of any one of embodiments 135-152, wherein the delivery of a second plurality of Anelloviridae family vectors results in Anelloviridae family vector in the skeletal muscle tissue at a level of 100-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, or 900- 1,000 copies of the genetic element / µg total DNA. 154. The method of any one of embodiments 135-153, wherein the subject received the first plurality of Anelloviridae family vectors in a blood transfusion. 155. The method of any one of embodiments 135-154, wherein the subject is evaluated between the administration of the first and second pluralities of Anelloviridae family vectors, e.g., for the presence of an immune response, e.g., antibodies, against one or more Anelloviridae family vectors of the first plurality. 156. The method of any one of embodiments 135-155, wherein the subject is administered an immune suppressant with the first and / or second plurality of Anelloviridae family vectors (e.g., administered simultaneously, or administered before or after such that the immune suppressant is active in the subject when the Anelloviridae family vectors are present in the subject). 157. The method of any one of embodiments 135-156, wherein the subject is evaluated between the administration of the first and second pluralities of Anelloviridae family vectors, e.g., for the presence (e.g., persistence) of Anelloviridae family vectors from the first plurality. 158. The method of any one of embodiments 135-157, wherein the first and the second plurality comprise about the same dosage of Anelloviridae family vectors, e.g., wherein the first plurality and the second plurality of Anelloviridae family vectors comprise about the same quantity and / or concentration of Anelloviridae family vectors. 159. The method of any one of embodiments 135-158, wherein the second plurality of Anelloviridae family vectors comprises about the same number of Anelloviridae family vectors as the first plurality of Anelloviridae family vectors, e.g., the second plurality comprises 90-110%, e.g., 95- 105% of the number of Anelloviridae family vectors in the first plurality. 160. The method of any one of embodiments 135-159, wherein the second plurality of Anelloviridae family vectors comprises about the same number of Anelloviridae family vectors as the first plurality of Anelloviridae family vectors when normalized to body mass of the subject at the time of administration, e.g., the second plurality comprises 90-110%, e.g., 95-105% of the number of Anelloviridae family vectors in the first plurality when normalized to body mass of the subject at the time of administration. 161. The method of any one of embodiments 135-160, wherein the first plurality comprises a greater dosage of Anelloviridae family vectors than the second plurality, e.g., wherein the first plurality comprises a greater quantity and / or concentration of Anelloviridae family vectors relative to the second plurality. 162. The method of any one of embodiments 135-161, wherein the first plurality comprises a lower dosage of Anelloviridae family vectors than the second plurality, e.g., wherein the first plurality comprises a lower quantity and / or concentration of Anelloviridae family vectors relative to the second plurality. 163. The method of any one of embodiments 135-162, wherein the second plurality of Anelloviridae family vectors is administered to the subject at least 1, 2, 3, or 4 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months, or 1, 2, 3, 4, 5, 10, or 20 years after the administration of the first plurality of Anelloviridae family vectors to the subject. 164. The method of any one of embodiments 135-163, wherein the second plurality of Anelloviridae family vectors is administered to the subject between 1-2 weeks, 2-3 weeks, 3-4 weeks, 1-2 months, 3-4 months, 4-5 months, 5-6 months, 6-7 months, 7-8 months, 8-9 months, 9-10 months, 10-11 months, 11-12 months, 1-2 years, 2-3 years, 3-4 years, 4-5 years, 5-10 years, or 10-20 years after the administration of the first plurality of Anelloviridae family vectors to the subject. 165. The method of any one of embodiments 135-164, which further comprises assessing, after administration of the first plurality of Anelloviridae family vectors and before administration of the second plurality of Anelloviridae family vectors, one or more of: a) the level or activity of the effector in the subject (e.g., by detecting a protein effector, e.g., by ELISA; by detecting a nucleic acid effector, e.g., by RT-PCR, or by detecting a downstream effect of the effector, e.g., level of an endogenous gene affected by the effector); b) the level or activity of the Anelloviridae family vector of the first plurality in the subject (e.g., by detecting the leve of the ORF1 of the Anelloviridae family vector); c) the presence, severity, progression, or a sign or symptom of a disease in the subject that the Anelloviridae family vector was administered to treat. 166. The method of any one of embodiments 135-165, which further comprises administering to the subject a third, fourth, fifth, and / or further plurality of Anelloviridae family vectors. 167. The method of any one of embodiments 135-166, which comprises administering a repeated dose of Anelloviridae family vectors over the course of at least 1, 2, 3, 4, or 5 years. 168. The method of embodiment 167, wherein the repeated dose is administered about every least 1, 2, 3, or 4 weeks, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. 169. The method of any one of embodiments 135-168, wherein the first plurality and the second plurality are administered via the same route of administration, e.g., intravenous administration. 170. The method of any one of embodiments 135-169, wherein the first plurality and the second plurality are administered via different routes of administration. 171. The method of any one of embodiments 135-170, wherein the second plurality of Anelloviridae family vectors comprises a proteinaceous exterior with at least one surface epitope in common with the Anelloviridae family vectors of the first plurality. 172. The method of any one of embodiments 135-171, wherein the second plurality of Anelloviridae family vectors comprises the same proteinaceous exterior as the Anelloviridae family vectors of the first plurality. 173. The method of any one of embodiments 135-172, wherein the second plurality of Anelloviridae family vectors comprises a proteinaceous exterior comprising an ORF1 molecule with at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to an ORF1 molecule comprised in the proteinaceous exterior of the Anelloviridae family vectors of the first plurality. 174. The method of any one of embodiments 135-173 wherein the genetic element of the second plurality of Anelloviridae family vectors is the same as the genetic element of the first plurality of Anelloviridae family vectors, or wherein the genetic element of the first plurality of Anelloviridae family vectors has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% nucleic acid sequence identity to the genetic element of the second plurality of Anelloviridae family vectors. 175. The method of any one of embodiments 135-174, wherein: the first plurality of Anelloviridae family vectors is administered to treat a first disease or condition in the subject, and the second plurality of Anelloviridae family vectors is administered to treat a second disease or condition in the subject. 176. The method of any one of embodiments 135-175, wherein: the first plurality of Anelloviridae family vectors is administered to treat a first disease or condition in the subject, and the second plurality of Anelloviridae family vectors is administered to treat the first disease or condition in the subject. 177. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the isolated nucleic acid molecule comprises at least one difference (e.g., a mutation, chemical modification, or epigenetic alteration) relative to a wild-type Anellovirus genome sequence (e.g., as described herein) 178. The method, cell, genetic element, nucleic acid, or Anelloviridae family vectorof embodiment 177, wherein the at least one difference comprises a deletion (e.g., lacks one or more of: an Anellovirus 5’ UTR conserved domain, an ORF1 gene, ORF2 gene, an Anellovirus GC-rich region, an ORF3 gene, or a functional fragment thereof). 179. The method, cell, genetic element, nucleic acid, or Anelloviridae family vectorof any of the preceding embodiments, wherein the isolated nucleic acid molecule is substantially unable to be enclosed in an Anellovirus capsid (e.g., a proteinaceous exterior of an Anelloviridae family vector (e.g., anellovector) as described herein). 180. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element further comprises a promoter. 181. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element further comprises a poly A sequence. 182. A pharmaceutical composition comprising the anellovector, the first plurality, or the second plurality of the method of any of the preceding embodiments. 183. The pharmaceutical composition of embodiment 182, wherein the pharmaceutical composition has one or more of the following characteristics: a) the pharmaceutical composition meets a pharmaceutical or good manufacturing practices (GMP) standard; b) the pharmaceutical composition was made according to good manufacturing practices (GMP); c) the pharmaceutical composition has a pathogen level below a predetermined reference value, e.g., is substantially free of pathogens; d) the pharmaceutical composition has a contaminant level below a predetermined reference value, e.g., is substantially free of contaminants; e) the pharmaceutical composition has a predetermined level of non-infectious particles or a predetermined ratio of particles:infectious units (e.g., <300:1, < 200:1, <100:1, or <50:1), or f) the pharmaceutical composition has low immunogenicity or is substantially non- immunogenic, e.g., as described herein. 184. The pharmaceutical composition of any one of embodiments 182-183, wherein the pharmaceutical composition has a contaminant level below a predetermined reference value, e.g., is substantially free of contaminants. 185. The pharmaceutical composition of embodiment 184, wherein the contaminant is selected from the group consisting of: mycoplasma, endotoxin, host cell nucleic acids (e.g., host cell DNA and / or host cell RNA), animal-derived process impurities (e.g., serum albumin or trypsin), replication-competent agents (RCA), e.g., replication-competent virus or unwanted Anelloviridae family vector (e.g., anellovector) (e.g., an Anelloviridae family vector other than the desired Anelloviridae family vector, e.g., a synthetic Anelloviridae family vector as described herein), free viral capsid protein, adventitious agents, and aggregates. 186. The pharmaceutical composition of embodiment 184, wherein the contaminant is host cell DNA and the threshold amount is about 10 ng of host cell DNA per dose of the pharmaceutical composition. 187. The pharmaceutical composition of any one of embodiments 182-186, wherein the pharmaceutical composition comprises less than 10% (e.g., less than about 10%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1%) contaminant by weight. 188. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element is single-stranded. 189. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element is circular. 190. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises DNA. 191. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element is a negative strand DNA. 192. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element is double-stranded. 193. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element is linear. 194. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises RNA. 195. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises a nucleic acid sequence encoding an Anelloviridae capsid protein, e.g., an Anellovirus ORF1 molecule (e.g., an ORF1 protein as listed in Table A1-A3 or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto). 196. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element does not comprise a nucleic acid sequence encoding an Anelloviridae capsid protein, e.g., an Anellovirus ORF1 molecule (e.g., an ORF1 protein as listed in Table A1-A3 or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto). 197. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises a nucleic acid sequence encoding an Anellovirus ORF2 molecule (e.g., an ORF2 protein as listed in Table A1-A3, or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto). 198. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element does not comprise a nucleic acid sequence encoding an Anellovirus ORF2 molecule (e.g., an ORF2 protein as listed in Table A1-A3 or an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto). 199. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises at least 20, 25, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 consecutive nucleotides having a GC content of at least 70%, 75%, 80%, 85%, 90%, 95%, or 99%. 200. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the proteinaceous exterior (e.g., ORF1 molecule of the proteinaceous exterior) comprises the amino acid sequence YNPX2DXGX2N (SEQ ID NO: 829), wherein Xnis a contiguous sequence of any n amino acids. 201. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of embodiment 200, wherein the amino acid sequence YNPX2DXGX2N (SEQ ID NO: 829) is comprised in an N22 domain. 202. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the proteinaceous exterior comprises an ORF1 molecule comprising one or more (e.g., 1, 2, 3, 4, or all 5) of the following Anellovirus ORF1 subdomains: an arginine-rich region, a jelly-roll region, a hypervariable region, an N22 domain, a C-terminal domain (CTD) (e.g., as described herein), e.g., of an Anellovirus ORF1 protein as listed in Table A1-A3 (or a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto). 203. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the proteinaceous exterior comprises an ORF1 molecule comprising an arginine-rich region (e.g., having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to an arginine-rich region sequence of an ORF1 protein listed in Table A1-A3). 204. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the proteinaceous exterior comprises an amino acid sequence of at least 15, 20, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, or 50 consecutive nucleotides comprising at least 40% (e.g., at least 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 55%, 60%, 65%, 66%, 67%, 68%, 69%, 70%, 75%, 80%, 85%, 90%, or 95%) arginine residues. 205. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of embodiment 203 or 204, wherein the arginine-rich region is located at the N-terminal or C-terminal end of the ORF1 molecule. 206. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises an Anellovirus 5’ UTR conserved domain sequence. 207. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element comprises an Anellovirus GC-rich region sequence. 208. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the effector encodes a therapeutic agent, e.g., a therapeutic peptide or polypeptide or a therapeutic nucleic acid. 209. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the effector is an exogenous effector. 210. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the effector is an endogenous effector (e.g., wherein the anellovector overexpresses the endogenous effector in a target cell). 211. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the effector modulates expression or activity of a gene or protein, e.g., increases or decreases expression or activity of the gene or protein. 212. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is capable of replicating autonomously. 213. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is replication-deficient (e.g., incapable of replicating autonomously). 214. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element integrates into the genome of a eukaryotic cell at a frequency of less than about 0.001%, 0.005%, 0.01%, 0.05%, 0.1%, 0.5%, 1%, 1.5%, or 2% of the genetic element that enters the cell. 215. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector, wherein the Anelloviridae family vector is substantially non-pathogenic, e.g., does not induce a detectable deleterious symptom in a subject (e.g., elevated cell death or toxicity, e.g., relative to a subject not exposed to the anellovector). 216. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is substantially non-immunogenic, e.g., does not induce a detectable and / or unwanted immune response. 217. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein a population of at least 1000 of the Anelloviridae family vectors is capable of delivering at least about 100 copies (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 copies) of the genetic element into one or more eukaryotic cells (e.g., mammalian cells, e.g., human cells). 218. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein a population of the Anelloviridae family vectors (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell) is capable of delivering the genetic element into at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, or more of a population of eukaryotic cells (e.g., mammalian cells, e.g., human cells). 219. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein a population of the Anelloviridae family vectors (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell) is capable of delivering at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, 100, 200, 500, 1000, 2000, 5000, 8,000, 1 x 104, 1 x 105, 1 x 106, 1 x 107or greater copies of the genetic element per cell to a population of eukaryotic cells (e.g., mammalian cells, e.g., human cells). 220. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein a population of the Anelloviridae family vectors (e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 genome equivalents of the genetic element per cell) is capable of delivering 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 1-10, 5-10, 10-20, 20- 50, 50-100, 100-1000, 1000-104, 1 x 104-1 x 105, 1 x 104-1 x 106, 1 x 104-1 x 107, 1 x 105-1 x 106, 1 x 105- 1 x 107, or 1 x 106-1 x 107copies of the genetic element per cell to a population of eukaryotic cells (e.g., mammalian cells, e.g., human cells). 221. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the target cells into which the genetic element is delivered each receive at least 10, 50, 100, 500, 1000, 10,000, 50,000, 100,000, or more copies of the genetic element. 222. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is resistant to degradation by a detergent (e.g., a mild detergent, e.g., a biliary salt, e.g., sodium deoxycholate) relative to a viral particle comprising an external lipid bilayer, e.g., a retrovirus. 223. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the genetic element encapsulated by the proteinaceous exterior is resistant to degradation by a nuclease enzyme (e.g., a DNase). 224. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is capable of infecting mammalian cells, e.g., human cells, e.g., in vitro, in vivo, or ex vivo. 225. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the proteinaceous exterior is provided in cis relative to the genetic element. 226. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the proteinaceous exterior is provided in trans relative to the genetic element. 227. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is substantially free of wild-type Anellovirus genomes. 228. The method, cell, genetic element, nucleic acid, or Anelloviridae family vector of any of the preceding embodiments, wherein the Anelloviridae family vector is an anellovector. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. BRIEF DESCRIPTION OF THE DRAWINGS FIG.1 is a graph of the DNase-protected eGFP viral genomes per post-ultracentrifugation iodixanol linear gradient fraction of the Ring19 (R19)-eGFP vector material. Vector presence and titer per fraction were gauged via qPCR probing for the vector payload sequence (eGFP). Fractions collected and pooled are shown. FIG.2 is a graph showing the DNase-protected eGFP viral genomes per liter of the post- ultracentrifugation iodixanol linear gradient Ring19-eGFP production culture. Yield was gauged via qPCR probing for the vector payload sequence (eGFP) across the fractions collected. FIG.3 is a graph of the pre-concentration (pooled iodixanol fractions) and post-concentration (final material) vector concentration per mL, as estimated by qPCR probing for DNase-protected copies of vector payload (eGFP). FIGS 4A-4K are graphs showing the quantitation of eGFP gDNA copies per total DNA (µg) in (A) lymph nodes, (B) spleen, (C) bone marrow, (D) whole blood, (E) heart, (F) lung, (G) kidney, (H) skeletal muscle, (I) ovary, (J) brain, and (K) whole eye, by qPCR from mice intravenously administered with PBS, Ring19-eGFP, or AAV2-eGFP. N = 4-5 / group. FIG.5A is a graph showing the quantitation of eGFP gDNA copies per total DNA (µg) in dissociated liver cells from mice intravenously administered with PBS, Ring19-eGFP, or AAV2-eGFP. N=1 with two technical replicates. FIG.5B is a graph showing the quantitation of eGFP gDNA copies per total DNA (µg) in liver, spleen, bone marrow, whole blood, muscle, lung, heart, ovary, brain, whole eye, and kidney from mice intravenously administered with Ring19-eGFP or AAV2-eGFP. FIG.6 is a graph of the DNase-protected Ring19-WT viral genomes per post-ultracentrifugation iodixanol linear gradient fraction of the Ring19-WT material. Viral presence and titer per fraction were gauged via qPCR probing for the virus ORF1 protein sequence. Fractions collected and pooled are shown. FIG.7 is a graph showing the DNase-protected Ring19-WT viral genomes per liter of the post- ultracentrifugation iodixanol linear gradient Ring19-WT production culture. Viral yield per liter was gauged via qPCR probing for the virus ORF1 protein sequence. FIG.8 is a graph of the pre-concentration (pooled iodixanol fractions) and post-concentration (final material) of Ring19-WT viral concentration per mL, as gaugedby qPCR probing for the viral ORF1 sequence. FIG.9 is an SDS-PAGE and Coomassie-stained gel of the post-concentration (final material) Ring19-WT material. FIG.10 is a graph of the DNase-protected R19-eGFP viral genomes per post-ultracentrifugation iodixanol linear gradient fraction of the Ring19-eGFP vector material. Vector presence and titer per fraction were gauged via qPCR probing for the vector payload sequence (eGFP). Fractions collected and pooled are shown. FIG.11 is a graph showing the DNase-protected R19-eGFP viral genomes per liter of the post- ultracentrifugation iodixanol linear gradient Ring19-eGFP production culture. Yield was gauged via qPCR probing for the vector payload sequence (eGFP) across the fractions collected. FIG.12 is a graph of the pre-concentration (pooled iodixanol fractions) and post-concentration (final material) Ring19-eGFP vector concentration per mL, as gaugedby qPCR probing for the vector payload (eGFP). FIG.13 is an SDS-PAGE and Coomassie-stained gel of the post-concentration (final material) Ring19-eGFP vector material. FIGS 14A-14C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in lymph nodes, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT- R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 15A-15C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in bone marrow, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT- R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 16A-16C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in liver, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 17A-17C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in spleen, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 18A-18C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in kidney, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 19A-19C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in thymus, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 20A-20C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in muscle, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS 21A-21C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in lung, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIGS.22A-22C are graphs showing the quantitation of (A) eGFP gDNA copies per total DNA (µg), (B) WT R19 gDNA copies per total DNA (µg), and (C) mCherry gDNA copies per total DNA (µg) in heart, by qPCR in mice intravenously administered with PBS, R19-eGFP, pre-dosed with WT-R19 followed by R19-eGFP, AAV2-eGFP, or pre-dosed with AAV-mCherry followed by AAV2-eGFP. FIG.23 is a graph showing the quantitation of gDNA copies per total DNA (µg) in liver, spleen, kidney, heart, lung, brain, ovary, muscle, and whole blood from mice intravenously administered with wild type Ring2 or AAV2-mCherry. FIG.24 is a graph showing the quantitation of eGFP genome copies per total DNA (ug) detected in enriched CD45+ leukocytes in spleen from mice intravenously administered with Ring19-eGFP or AAV2-eGFP. FIG.25 is a graph showing the quantitation of eGFP genome copies per total DNA (ug) detected in CD3+ cells and CD3- cells isolated from human PBMCs (peripheral blood mononuclear cells) transduced with Ring19-eGFP. The following detailed description of the embodiments of the invention will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, there are shown in the drawings embodiments that are presently exemplified. It should be understood, however, that the invention is not limited to the precise arrangement and instrumentalities of the embodiments shown in the drawings. DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS Definitions The present invention will be described with respect to particular embodiments and with reference to certain figures, but the invention is not limited thereto but only by the claims. Terms as set forth hereinafter are generally to be understood in their common sense unless indicated otherwise. Where the term “comprising” is used in the present description and claims, it does not exclude other elements. For the purposes of the present invention, the term “consisting of” is considered to be a preferred embodiment of the term “comprising of”. If hereinafter a group is defined to comprise at least a certain number of embodiments, this is to be understood to preferably also disclose a group which consists only of these embodiments. Where an indefinite or definite article is used when referring to a singular noun, e.g. “a”, “an” or “the”, this includes a plural of that noun unless something else is specifically stated. The wording “compound, composition, product, etc. for treating, modulating, etc.” is to be understood to refer a compound, composition, product, etc. per se which is suitable for the indicated purposes of treating, modulating, etc. The wording “compound, composition, product, etc. for treating, modulating, etc.” additionally discloses that, as an embodiment, such compound, composition, product, etc. is for use in treating, modulating, etc. The wording “compound, composition, product, etc. for use in …”, “use of a compound, composition, product, etc. in the manufacture of a medicament, pharmaceutical composition, veterinary composition, diagnostic composition, etc. for …”, or “compound, composition, product, etc. for use as a medicament…” indicates that such compounds, compositions, products, etc. are to be used in therapeutic methods which may be practiced on the human or animal body. They are considered as an equivalent disclosure of embodiments and claims pertaining to methods of treatment, etc. If an embodiment or a claim thus refers to “a compound for use in treating a human or animal being suspected to suffer from a disease”, this is considered to be also a disclosure of a “use of a compound in the manufacture of a medicament for treating a human or animal being suspected to suffer from a disease” or a “method of treatment by administering a compound to a human or animal being suspected to suffer from a disease”. The wording “compound, composition, product, etc. for treating, modulating, etc.” is to be understood to refer a compound, composition, product, etc. per se which is suitable for the indicated purposes of treating, modulating, etc. If hereinafter examples of a term, value, number, etc. are provided in parentheses, this is to be understood as an indication that the examples mentioned in the parentheses can constitute an embodiment. For example, if it is stated that “in embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anellovirus ORF1-encoding nucleotide sequence of Table 1 (e.g., nucleotides 571 – 2613 of the nucleic acid sequence of Table 1)”, then some embodiments relate to nucleic acid molecules comprising a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to nucleotides 571 – 2613 of the nucleic acid sequence of Table 1. As used herein, the term “Anelloviridae family vector” refers to a vehicle derived from or similar to a virus of the Anelloviridae family (e.g., an Alphatorquevirus, Betatorquevirus, Gammatorquevirus, or chicken anemia virus), wherein the vehicle comprises a genetic element encapsulated in a proteinaceous exterior (e.g., the genetic element is substantially protected from digestion with DNase I by a proteinaceous exterior). In some embodiments, an Anelloviridae family vector comprises a genetic element derived from or highly similar to (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to) that of an Alphatorquevirus, Betatorquevirus, or Gammatorquevirus. In some embodiments, an Anelloviridae family vector comprises a proteinaceous exterior comprising a protein derived from or similar to (e.g., at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to) a capsid protein of an Alphatorquevirus, Betatorquevirus, or Gammatorquevirus (e.g., an Alphatorquevirus ORF1, Betatorquevirus ORF1, or Gammatorquevirus ORF1). In some embodiments, encapsulated within a proteinaceous exterior encompasses 100% coverage by a proteinaceous exterior, as well as less than 100% coverage, e.g., 95%, 90%, 85%, 80%, 70%, 60%, 50% or less. For example, gaps or discontinuities (e.g., that render the proteinaceous exterior permeable to water, ions, peptides, or small molecules) may be present in the proteinaceous exterior, so long as the genetic element is retained in the proteinaceous exterior or protected from digestion with DNase I, e.g., prior to entry into a host cell. In some embodiments, the Anelloviridae family vector is purified, e.g., it is separated from its original source and / or substantially free (>50%, >60%, >70%, >80%, >90%) of other components. In some embodiments, the Anelloviridae family vector is capable of introducing the genetic element into a target cell (e.g., via infection). In some embodiments, the Anelloviridae family vector is an infective synthetic viral particle. As used herein, the term “anellovector” refers to a vehicle comprising a genetic element, e.g., e.g., circular DNA, encapsulated in a proteinaceous exterior. A “synthetic anellovector,” as used herein, generally refers to an anellovector that is not naturally occurring, e.g., has a sequence that is different relative to a wild-type virus (e.g., a wild-type Anellovirus as described herein). In some embodiments, the synthetic anellovector is engineered or recombinant, e.g., comprises a genetic element that comprises a difference or modification relative to a wild-type viral genome (e.g., a wild-type Anellovirus genome as described herein). In some embodiments, encapsulated within a proteinaceous exterior encompasses 100% coverage by a proteinaceous exterior, as well as less than 100% coverage, e.g., 95%, 90%, 85%, 80%, 70%, 60%, 50% or less. For example, gaps or discontinuities (e.g., that render the proteinaceous exterior permeable to water, ions, peptides, or small molecules) may be present in the proteinaceous exterior, so long as the genetic element is retained in the proteinaceous exterior, e.g., prior to entry into a host cell. In some embodiments, the anellovector is purified, e.g., it is separated from its original source and / or substantially free (>50%, >60%, >70%, >80%, >90%) of other components. An anellovector may, in some embodiments, comprise a nucleic acid vector that comprises sufficient nucleic acid sequence derived from or highly similar to (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to) an Anellovirus genome sequence or a contiguous portion thereof to allow packaging into a proteinaceous exterior (e.g., a capsid), and further comprises a heterologous sequence. In some embodiments, the nucleic acid vector is a viral vector or a naked nucleic acid. In some embodiments, the nucleic acid vector comprises at least about 50, 60, 70, 71, 72, 73, 74, 75, 80, 90, 100, 150, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2500, 3000, or 3500 consecutive nucleotides of a native Anellovirus sequence or a sequence highly similar (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical) thereto. In some embodiments, the anellovector further comprises one or more of an Anellovirus ORF1, ORF2, or ORF3. In some embodiments, the heterologous sequence comprises a multiple cloning site, comprises a heterologous promoter, comprises a coding region for a therapeutic protein, or encodes a therapeutic nucleic acid. In some embodiments, the capsid is a wild-type Anellovirus capsid. In embodiments, an anellovector comprises a genetic element described herein, e.g., comprises a genetic element comprising a promoter, a sequence encoding a therapeutic effector, and a capsid binding sequence. As used herein, the term “Anellovirus non-coding region (NCR)” refers to a sequence of an untranslated region present in an Anellovirus genome sequence that extends from just upstream of the ORF2 start codon to the untranslated region of the Anellovirus genome sequence just downstream of the ORF3 stop codon in a circular genome. The Anellovirus NCR may comprise the “Anellovirus 5’ NCR sequence” and “Anellovirus 3’ NCR sequence.” In some embodiments, the Anellovirus NCR sequence is contiguous. In some embodiments, the Anellovirus NCR sequence is non-contiguous. In some embodiments, the portions of a non-contiguous Anellovirus NCR sequence are separated by a heterologous insertion (e.g., comprising a recombinase hybrid site, e.g., as described herein). In some embodiments, the Anellovirus NCR sequence comprises a sequence found in a wild-type Anellovirus, and in other embodiments, the Anellovirus NCR comprises one or more mutations relative to the closest Anellovirus sequence. In some embodiments, the Anellovirus NCR is comprised by a nucleic acid molecule that does not comprise Anellovirus ORF2 or ORF3 coding sequences. In some instances, the Anellovirus NCR comprises a negative strand sequence corresponding to a portion of positive strand Anelloviridae family virus or Anelloviridae family vector sequence described herein. As used herein, the term “Anellovirus 5’ NCR” refers to a sequence of an untranslated region present inan Anellovirus genome sequence that extends from just upstream of the ORF2 start codon through the 5’ UTR conserved domain to the Anellovirus 3’ NCR sequence, and sequences with homology thereto. In some embodiments, an Anellovirus 5’ NCR sequence comprises origin of replication activity. In some embodiments, the Anellovirus 5’ NCR sequence is contiguous. In some embodiments, the Anellovirus 5’ NCR sequence is non-contiguous. In some embodiments, the portions of a non-contiguous Anellovirus 5’ NCR sequence are separated by a heterologous insertion (e.g., comprising a recombinase hybrid site, e.g., as described herein). In some embodiments, the Anellovirus 5’ NCR sequence comprises a sequence found in a wild-type Anellovirus, and in other embodiments, the Anellovirus 5’ NCR comprises one or more mutations relative to the closest Anellovirus sequence. In some instances, the Anellovirus 5’ NCR comprises a negative strand sequence corresponding to a portion of positive strand Anelloviridae family virus or Anelloviridae family vector sequence described herein.In a circular genetic element, the Anellovirus 5’ NCR and Anellovirus 3’ NCR may be directly adjacent to each other (e.g., to form an Anellovirus NCR). Exemplary dividing points between the Anellovirus 5’ NCR and the Anellovirus 3’ NCR are shown, e.g., as described herein. As used herein, the term “Anellovirus 3’ NCR” refers to a sequence of an untranslated region present in an Anellovirus genome sequence that extends from just downstream of the ORF3 stop codon through the GC-rich region to the Anellovirus 5’ NCR sequence, and sequences with homology thereto. In some embodiments, the Anellovirus 3’ NCR sequence is contiguous. In some embodiments, the Anellovirus 3’ NCR sequence is non-contiguous. In some embodiments, the portions of a non-contiguous Anellovirus 3’ NCR sequence are separated by a heterologous insertion (e.g., comprising a recombinase hybrid site, e.g., as described herein). In some embodiments, the Anellovirus 3’ NCR sequence comprises a sequence found in a wild-type Anellovirus, and in other embodiments, the Anellovirus 3’ NCR comprises one or more mutations relative to the closest Anellovirus sequence. In some instances, the Anellovirus 3’ NCR comprises a negative strand sequence corresponding to a portion of positive strand Anelloviridae family virus or Anelloviridae family vector sequence described herein. As used herein, the term “Anellovirus GC-rich region” refers to a wild-type or engineered sequence that has an activity and a structural feature of a GC-rich region present in a wild-type Anellovirus, or a functional fragment thereof. In some embodiments, the functional fragment has a length of at least 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotides. Typically, the negative strand comprising the Anellovirus GC-rich region is packaged into a particle (e.g., an Anelloviridae family vector) as described herein. In some embodiments, the Anellovirus GC-rich region is a wild-type Anellovirus GC-rich region. In some embodiments, the Anellovirus GC-rich region is an engineered Anellovirus GC-rich region having a nucleic acid sequence with at least one difference relative to the closest wild-type Anellovirus GC-rich region sequence. In some embodiments, the Anellovirus GC-rich region comprises the reverse complement of a sequence annotated as a GC-rich region in Table N1-N3. As used herein, the term “Anellovirus 5’ UTR conserved domain” refers to a wild-type or engineered sequence that has an activity and a structural feature of an Anellovirus 5’ UTR conserved domain present in a wild-type Anellovirus, or a functional fragment thereof. In some embodiments, the functional fragment has a length of at least 15, 20, 30, 40, 50, 60, or 70 nucleotides. Typically, the negative strand comprising the Anellovirus 5’ UTR conserved domain is packaged into a particle (e.g., an Anelloviridae family vector) as described herein. In some embodiments, the Anellovirus 5’ UTR conserved domain is a wild-type Anellovirus 5’ UTR conserved domain. In some embodiments, the Anellovirus 5’ UTR conserved domain is an engineered Anellovirus 5’ UTR conserved domain having a nucleic acid sequence with at least one difference relative to the closest wild-type Anellovirus 5’ UTR conserved domain sequence. In some embodiments, the Anellovirus 5’ UTR conserved domain comprises the reverse complement of a sequence annotated as a 5’ UTR conserved domain in Table N1- N3. As used herein, the term “antibody molecule” refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence. The term “antibody molecule” encompasses full-length antibodies and antibody fragments (e.g., scFvs). In some embodiments, an antibody molecule is a multispecific antibody molecule, e.g., the antibody molecule comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope. In embodiments, the multispecific antibody molecule is a bispecific antibody molecule. A bispecific antibody molecule is generally characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope. As used herein, the term “CAR” (or “chimeric antigen receptor”) is a recombinant polypeptide construct comprising an antigen binding domain (which is extracellular), a transmembrane domain, and a signaling domain (which is intracellular). In some embodiments, the domains in the CAR polypeptide construct are in the same polypeptide chain, e.g., comprise a chimeric fusion protein. In some embodiments, the domains in the CAR polypeptide construct are not contiguous with each other, e.g., are in different polypeptide chains. The term “in vitro assembly,” as used herein with respect to an Anelloviridae family vector or an anelloVLP, refers to the formation of a proteinaceous exterior comprising an ORF1 molecule, wherein the formation does not take place inside of a cell (e.g., takes place in a cell-free system such as a cell-free suspension, a lysate, or a supernatant). In some instances, in vitro assembly of an Anelloviridae family vector comprises encapsulation, outside of a cell, of a genetic element (e.g., as described herein) within the proteinaceous exterior. In some instances, in vitro assembly of an anelloVLP comprises association, outside of a cell, of an effector (e.g., an exogenous effector, e.g., as described herein) with the proteinaceous exterior (e.g., encapsulated within the proteinaceous exterior). In vitro assembly of a proteinaceous exterior may occur, in some instances, under conditions suitable for multimerization of a plurality of ORF1 molecules (e.g., nondenaturing conditions), e.g., to form a multimer of more than 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 ORF1 molecules. In some instances, in vitro assembly results in the formation of a proteinaceous exterior comprising at least about 20, 30, 40, 50, or 60 ORF1 molecules, or about 20-30, 30-40, 40-50, 50-60, or 60-70 ORF1 molecules). In some instances, the proteinaceous exterior is formed from ORF1 molecules that were produced in a cell and then purified therefrom. In some instances, the in vitro assembly takes place in a solution free of cells or constituents thereof. In other instances, the in vitro assembly takes place in a solution comprising cell debris (e.g., from lysed cells). In some instances, the in vitro assembly takes place in a solution substantially free of cellular nucleic acid molecules (e.g., genomic DNA, mitochondrial DNA, mRNA, and / or noncoding RNA from a cell). As used herein, a nucleic acid “encoding” refers to a nucleic acid sequence encoding an amino acid sequence or a functional polynucleotide (e.g., a non-coding RNA, e.g., an siRNA or miRNA). An “exogenous” agent (e.g., an effector, a nucleic acid (e.g., RNA), a gene, payload, protein) as used herein refers to an agent that is either not comprised by, or not encoded by, a corresponding wild- type virus, e.g., an Anellovirus as described herein. In some embodiments, the exogenous agent does not naturally exist, such as a protein or nucleic acid that has a sequence that is altered (e.g., by insertion, deletion, or substitution) relative to a naturally occurring protein or nucleic acid. In some embodiments, the exogenous agent does not naturally exist in the host cell. In some embodiments, the exogenous agent exists naturally in the host cell but is exogenous to the virus. In some embodiments, the exogenous agent exists naturally in the host cell, but is not present at a desired level or at a desired time. A “heterologous” agent or element (e.g., an effector, a nucleic acid sequence, an amino acid sequence), as used herein with respect to another agent or element (e.g., an effector, a nucleic acid sequence, an amino acid sequence), refers to agents or elements that are not naturally found together, e.g., in a wild-type virus, e.g., an Anellovirus. In some embodiments, a heterologous nucleic acid sequence may be present in the same nucleic acid as a naturally occurring nucleic acid sequence (e.g., a sequence that is naturally occurring in the Anellovirus). In some embodiments, a heterologous agent or element is exogenous relative to an Anellovirus from which other (e.g., the remainder of) elements of the anellovector are based. As used herein, the term “genetic element” refers to a nucleic acid sequence, generally in an anellovector. It is understood that the genetic element can be produced as naked DNA and optionally further assembled into a proteinaceous exterior. It is also understood that an anellovector can insert its genetic element into a cell, resulting in the genetic element being present in the cell and the proteinaceous exterior not necessarily entering the cell. As used herein, the term “non-ocular tissue” refers to a tissue of an animal (e.g., a mammal, e.g., a human) subject located outside of the eye of the subject. In some instances, a non-ocular tissue is physically distinct or distant from the eye of the subject. In some instances, a non-ocular tissue is disconnected from the eye of the subject. In some instances, a non-ocular tissue contributes to or carries out a bodily function unrelated to vision. In some instances, a non-ocular tissue contributes to or carries out a bodily function unrelated to photoreception. The non-ocular tissue may include, for example, spleen, ovary, lymph node, lung, liver, bone marrow, or skeletal muscle. As used herein, the term “ORF1 molecule” refers to a polypeptide having an activity and / or a structural feature of an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein, e.g., as listed in Table A1-A3), or a functional fragment thereof. An ORF1 molecule may, in some instances, comprise one or more of (e.g., 1, 2, 3 or 4 of): a first region comprising at least 60% basic residues (e.g., at least 60% arginine residues), a second region comprising at least about six beta strands (e.g., at least 4, 5, 6, 7, 8, 9, 10, 11, or 12 beta strands), a third region comprising a structure or an activity of an Anellovirus N22 domain (e.g., as described herein, e.g., an N22 domain from an Anellovirus ORF1 protein as described herein), and / or a fourth region comprising a structure or an activity of an Anellovirus C-terminal domain (CTD) (e.g., as described herein, e.g., a CTD from an Anellovirus ORF1 protein as described herein). In some instances, the ORF1 molecule comprises, in N-terminal to C-terminal order, the first, second, third, and fourth regions. In some instances, an anellovector comprises an ORF1 molecule comprising, in N-terminal to C-terminal order, the first, second, third, and fourth regions. An ORF1 molecule may, in some instances, comprise a polypeptide encoded by an Anellovirus ORF1 nucleic acid (e.g., as listed in any of Tables N1-N3). An ORF1 molecule may, in some instances, further comprise a heterologous sequence, e.g., a hypervariable region (HVR), e.g., an HVR from an Anellovirus ORF1 protein, e.g., as described herein. An “Anellovirus ORF1 protein,” as used herein, refers to an ORF1 protein encoded by an Anellovirus genome (e.g., a wild-type Anellovirus genome, e.g., as described herein), e.g., an ORF1 protein having the amino acid sequence as listed in Table A1-A3, or as encoded by the ORF1 gene as listed in any of Tables N1-N3. The term “ORF1 domain,” as used herein with respect to an ORF1 molecule, refers to the portion of the ORF1 molecule having the structure or function of an Anellovirus ORF1 protein. The ORF1 domain is generally capable of forming a multimer with other copies of the ORF1 domain (e.g., in other ORF1 molecules), or with other ORF1 molecules, e.g., to form a proteinaceous exterior (e.g., of an anellovector or anelloVLP as described herein). In some instances, the ORF1 molecule may comprise one or more additional domains other than the ORF1 domain (for example, a domain comprising or attached to a surface effector). In some instances, the amino acid sequence of an ORF1 domain comprises an insertion (e.g., an insertion encoding a surface moiety or a domain capable of binding to a surface moiety), e.g., between the N-terminal end and C-terminal end of the ORF1 domain. In certain instances, the insertion does not substantially disrupt the structure and / or function of the ORF1 domain, e.g., such that the ORF1 domain remains capable of forming a multimer with other ORF1 domains or ORF1 molecules. The position within the ORF1 domain sequence into which the insertion is made is referred to herein as the “insertion point.” An insertion can be made into an ORF1 domain by any genetic or polypeptide engineering method known in the art. In some embodiments, an ORF1 molecule consists of an ORF1 domain. In other embodiments, an ORF1 molecule comprises an ORF1 domain and a heterologous domain (e.g., a surface moiety as described herein). In some embodiments, an ORF1 domain is connected to a surface moiety by a polypeptide linker region. As used herein, the term “ORF2 molecule” refers to a polypeptide having an activity and / or a structural feature of an Anellovirus ORF2 protein (e.g., an Anellovirus ORF2 protein as described herein, e.g., as listed in Table A1-A3), or a functional fragment thereof. An “Anellovirus ORF2 protein,” as used herein, refers to an ORF2 protein encoded by an Anellovirus genome (e.g., a wild-type Anellovirus genome, e.g., as described herein), e.g., an ORF2 protein having the amino acid sequence as listed in Table A1-A3, or as encoded by the ORF2 gene as listed in any of Tables N1-N3. As used herein, the term “particle” refers to a vehicle having a diameter of less than 100 nm (e.g., about 20-25, 25-30, 30-35, or 35-40 nm) comprising a proteinaceous exterior. In some instances, the particle comprises a plurality of ORF1 molecules. The proteinaceous exterior of the particle generally forms an encapsulation capable of limiting or preventing movement of certain molecules between the inside and outside of the proteinaceous exterior. In some embodiments, gaps or discontinuities (e.g., that render the proteinaceous exterior permeable to water, ions, peptides, or small molecules) may be present in the proteinaceous exterior. In certain embodiments, the gaps or discontinuities are of a sufficiently small size (e.g., diameter) that the proteinaceous exterior limits or prevents one or more large macromolecules (e.g., peptides, polypeptides, polynucleotides, lipids, or polysaccharides) from passing through the proteinaceous exterior. As used herein, the term “proteinaceous exterior” refers to an exterior component that is predominantly (e.g., >50%, >60%, > 70%, >80%, > 90%) protein. As used herein, the term “regulatory nucleic acid” refers to a nucleic acid sequence that modifies expression, e.g., transcription and / or translation, of a DNA sequence that encodes an expression product. In embodiments, the expression product comprises RNA or protein. As used herein, the term “regulatory sequence” refers to a nucleic acid sequence that modifies transcription of a target gene product. In some embodiments, the regulatory sequence is a promoter or an enhancer. As used herein, the term “replication protein” refers to a protein, e.g., a viral protein, that is utilized during infection, viral genome replication / expression, viral protein synthesis, and / or assembly of the viral components. As used herein, a “substantially non-pathogenic” organism, particle, or component, refers to an organism, particle (e.g., a virus or an anellovector, e.g., as described herein), or component thereof that does not cause or induce a detectable disease or pathogenic condition, e.g., in a host organism, e.g., a mammal, e.g., a human. In some embodiments, administration of an anellovector to a subject can result in minor reactions or side effects that are acceptable as part of standard of care. As used herein, the term “non-pathogenic” refers to an organism or component thereof that does not cause or induce a detectable disease or pathogenic condition, e.g., in a host organism, e.g., a mammal, e.g., a human. As used herein, a “substantially non-integrating” genetic element refers to a genetic element, e.g., a genetic element in a virus or anellovector, e.g., as described herein, wherein less than about 0.01%, 0.05%, 0.1%, 0.5%, or 1% of the genetic element that enter into a host cell (e.g., a eukaryotic cell) or organism (e.g., a mammal, e.g., a human) integrate into the genome. In some embodiments the genetic element does not detectably integrate into the genome of, e.g., a host cell. In some embodiments, integration of the genetic element into the genome can be detected using techniques as described herein, e.g., nucleic acid sequencing, PCR detection and / or nucleic acid hybridization. As used herein, a “substantially non-immunogenic” organism, particle, or component, refers to an organism, particle (e.g., a virus or anellovector, e.g., as described herein), or component thereof, that does not cause or induce an undesired or untargeted immune response, e.g., in a host tissue or organism (e.g., a mammal, e.g., a human). In some embodiments, the substantially non-immunogenic organism, particle, or component does not produce a detectable immune response. In some embodiments, the substantially non-immunogenic anellovector does not produce a detectable immune response against a protein comprising an amino acid sequence or encoded by a nucleic acid sequence shown in any of Tables N1- N3. In some embodiments, an immune response (e.g., an undesired or untargeted immune response) is detected by assaying antibody presence or level (e.g., presence or level of an anti-anellovector antibody, e.g., presence or level of an antibody against an anellovector as described herein) in a subject, e.g., according to the anti-TTV antibody detection method described in Tsuda et al. (1999; J. Virol. Methods 77: 199-206; incorporated herein by reference) and / or the method for determining anti-TTV IgG levels described in Kakkola et al. (2008; Virology 382: 182-189; incorporated herein by reference). Antibodies against an Anellovirus or an anellovector based thereon can also be detected by methods in the art for detecting anti-viral antibodies, e.g., methods of detecting anti-AAV antibodies, e.g., as described in Calcedo et al. (2013; Front. Immunol.4(341): 1-7; incorporated herein by reference). A “subsequence” as used herein refers to a nucleic acid sequence or an amino acid sequence that is comprised in a larger nucleic acid sequence or amino acid sequence, respectively. In some instances, a subsequence may comprise a domain or functional fragment of the larger sequence. In some instances, the subsequence may comprise a fragment of the larger sequence capable of forming secondary and / or tertiary structures when isolated from the larger sequence similar to the secondary and / or tertiary structures formed by the subsequence when present with the remainder of the larger sequence. In some instances, a subsequence can be replaced by another sequence (e.g., a subsequence comprising an exogenous sequence or a sequence heterologous to the remainder of the larger sequence, e.g., a corresponding subsequence from a different Anellovirus). As used herein, the term “surface moiety” refers to a moiety for which at least a portion is exposed on the exterior surface of a particle (e.g., exposed to the solution surrounding the particle). The surface moiety is generally attached, directly or indirectly, to a component of the proteinaceous exterior of the particle (e.g., an ORF1 molecule). In some instances, the surface moiety is covalently attached to the component of the proteinaceous exterior of the particle (e.g., the ORF1 molecule). In some instances, the surface moiety is noncovalently attached to the component of the proteinaceous exterior of the particle (e.g., the ORF1 molecule). In some instances, the surface moiety is bound to a binding moiety that is in turn attached (e.g., covalently or noncovalently) to the component of the proteinaceous exterior of the particle (e.g., the ORF1 molecule). In some instances, the surface moiety is comprised in an ORF1 molecule (e.g., is a heterologous domain of an ORF1 molecule). In some instances, a surface moiety is exogenous relative to an Anellovirus (e.g., the Anellovirus from which the ORF1 molecule was derived and / or an Anellovirus for which the ORF1 protein has at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule). In some instances, a surface moiety is exogenous relative a target cell (e.g., a mammalian cell, e.g., a human cell) to be infected by the particle. As used herein, “treatment”, "treating" and cognates thereof refer to the medical management of a subject with the intent to improve, ameliorate, stabilize, prevent or cure a disease, pathological condition, or disorder. This term includes active treatment (treatment directed to improve the disease, pathological condition, or disorder), causal treatment (treatment directed to the cause of the associated disease, pathological condition, or disorder), palliative treatment (treatment designed for the relief of symptoms), preventative treatment (treatment directed to preventing, minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder); and supportive treatment (treatment employed to supplement another therapy). This invention relates generally to Anelloviridae family vectors (e.g., anellovectors), e.g., synthetic Anelloviridae family vectors (e.g., anellovectors), and uses thereof. The present disclosure provides Anelloviridae family vectors (e.g., anellovectors), compositions comprising Anelloviridae family vectors (e.g., anellovectors), and methods of making or using Anelloviridae family vectors (e.g., anellovectors). Anelloviridae family vectors (e.g., anellovectors) are generally useful as delivery vehicles, e.g., for delivering a therapeutic agent to a eukaryotic cell. Generally, an Anelloviridae family vector (e.g., anellovector) will include a genetic element comprising a nucleic acid sequence (e.g., encoding an effector, e.g., an exogenous effector or an endogenous effector) encapsulated within a proteinaceous exterior. An Anelloviridae family vector (e.g., anellovector) may include one or more deletions of sequences (e.g., regions or domains as described herein) relative to an Anellovirus sequence (e.g., as described herein). Anelloviridae family vectors (e.g., anellovectors) can be used as a substantially non-immunogenic vehicle for delivering the genetic element, or an effector encoded therein (e.g., a polypeptide or nucleic acid effector, e.g., as described herein), into eukaryotic cells, e.g., to treat a disease or disorder in a subject comprising the cells. TABLE OF CONTENTS I. Anelloviridae Family Vectors (e.g., Anellovectors) A. Anelloviridae Family Viruses (e.g., Anelloviruses) i. Nucleic acid sequences ii. Amino acid sequences encoded by nucleic acid sequences iii. Proteins comprising amino acid sequences iv. Polypeptides comprising amino acid sequences B. Capsid Proteins (e.g., ORF1 molecules) i. Conserved ORF1 motif in N22 domain ii. Exemplary ORF1 sequences iii. Identification of ORF1 protein sequences C. ORF2 molecules i. Conserved ORF2 motif D. Genetic elements E. Protein binding sequence F.5’ UTR Conserved Domains G. GC-rich regions H. Effectors i. Chimeric Antigen Receptors (CARs) I. Surface Moieties II. Compositions and Methods for Making Anelloviridae Family Vectors A. Genetic Element Constructs i. Tandem constructs ii. Cis / trans constructs B. Recombinase-based production of genetic elements and Anellovectors i. Self-replicating rescue (SRR) constructs (e.g., SRR plasmids) ii. Exemplary site-specific recombinases and recombinase recognition sites C. Host Cells and methods of using host cells for producing an Anellovector i. Introduction of genetic elements into host cells ii. Exemplary cell types D. Culture Conditions E. Harvest F. In vitro assembly methods G. In vitro circularization H. Enrichment and Purification III. Pharmaceutical Compositions IV. Methods of use A. Tissue-specific delivery of Anelloviridae family vectors V. Redosing I. Anelloviridae family vectors (e.g., anellovectors) In some aspects, the invention described herein comprises compositions and methods of using and making an Anelloviridae family vector (e.g., anellovector), Anelloviridae family vector (e.g., anellovector) preparations, and therapeutic compositions. In some embodiments, the anellovector has a sequence, structure, and / or function that is based on an Anelloviridae virus (e.g., an Anellovirus as described herein). It is understood that applicable embodiments described herein with respect to anellovectors may also be applied to Anelloviridae family vectors (e.g., a vector based on or derived from a chicken anemia virus (CAV), e.g., as described herein). In some embodiments, the Anelloviridae family vector (e.g., anellovector) comprises a nucleic acid or polypeptide comprising a sequence as shown in Table A1-A3 (e.g., Table A1-A3); or Table N1-N3, or fragments or portions thereof, or a reverse complement thereof, or other substantially non-pathogenic virus, e.g., a symbiotic virus, commensal virus, native virus. In some embodiments, an Anelloviridae family virus-based vector comprises at least one element exogenous to that Anelloviridae family virus, e.g., an exogenous effector or a nucleic acid sequence encoding an exogenous effector disposed within a genetic element of the vector. In some embodiments, an Anelloviridae family virus-based vector comprises at least one element heterologous to another element from that Anelloviridae family virus, e.g., an effector-encoding nucleic acid sequence that is heterologous to another linked nucleic acid sequence, such as a promoter element. In some embodiments, an Anelloviridae family vector comprises a genetic element (e.g., circular DNA, e.g., single stranded DNA), which comprise at least one element that is heterologous relative to the remainder of the genetic element and / or the proteinaceous exterior (e.g., an exogenous element encoding an effector, e.g., as described herein). An Anelloviridae family vector may be a delivery vehicle (e.g., a substantially non-pathogenic delivery vehicle) for a payload into a host, e.g., a human. In some embodiments, the Anelloviridae family vector is capable of replicating in a eukaryotic cell, e.g., a mammalian cell, e.g., a human cell. In some embodiments, the Anelloviridae family vector is substantially non-pathogenic and / or substantially non-integrating in the mammalian (e.g., human) cell. In some embodiments, the Anelloviridae family vector is substantially non-immunogenic in a mammal, e.g., a human. In some embodiments, the Anelloviridae family vector is replication-deficient. In some embodiments, the Anelloviridae family vector is replication-competent. In one aspect, the invention includes an Anelloviridae family vector comprising: a) a genetic element comprising (i) a sequence encoding an exterior protein (e.g., a non- pathogenic exterior protein), (ii) an exterior protein binding sequence that binds the genetic element to the non-pathogenic exterior protein, and (iii) a sequence encoding an effector (e.g., an endogenous or exogenous effector); and b) a proteinaceous exterior that is associated with, e.g., envelops or encapsulates, the genetic element. In some embodiments, the Anelloviridae family vector (e.g. anellovector) includes sequences or expression products from (or having >70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, 100% homology to) a non-enveloped, circular, single-stranded DNA virus. Animal circular single-stranded DNA viruses generally refer to a subgroup of single strand DNA (ssDNA) viruses, which infect eukaryotic non-plant hosts, and have a circular genome. Thus, animal circular ssDNA viruses are distinguishable from ssDNA viruses that infect prokaryotes (i.e. Microviridae and Inoviridae) and from ssDNA viruses that infect plants (i.e. Geminiviridae and Nanoviridae). They are also distinguishable from linear ssDNA viruses that infect non-plant eukaryotes (i.e. Parvoviridiae). In some embodiments, the genetic element comprises a promoter element. In some embodiments, the promoter element is selected from an RNA polymerase II-dependent promoter, an RNA polymerase III-dependent promoter, a PGK promoter, a CMV promoter, an EF-1α promoter, an SV40 promoter, a CAGG promoter, or a UBC promoter, TTV viral promoters, Tissue specific, U6 (pollIII), minimal CMV promoter with upstream DNA binding sites for activator proteins (TetR-VP16, Gal4-VP16, dCas9-VP16, etc.). In some embodiments, the promoter element comprises a TATA box. In some embodiments, the promoter element is endogenous to a wild-type Anelloviridae family virus (e.g., Anellovirus), e.g., as described herein. In some embodiments, the genetic element comprises one or more of the following characteristics: single-stranded, circular, negative strand, and / or DNA. In some embodiments, the portions of the genetic element excluding the effector have a combined size of about 2.5-5 kb (e.g., about 2.8-4kb, about 2.8-3.2kb, about 3.6-3.9kb, or about 2.8-2.9kb), less than about 5kb (e.g., less than about 2.9kb, 3.2 kb, 3.6kb, 3.9kb, or 4kb), or at least 100 nucleotides (e.g., at least 1kb). In some embodiments, a replication deficient, replication defective, or replication incompetent genetic element does not encode all of the necessary machinery or components required for replication of the genetic element. In some embodiments, a replication defective genetic element does not encode a replication factor. In some embodiments, a replication defective genetic element does not encode one or more ORFs (e.g., ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, and / or ORF2t / 3 e.g., as described herein). In some embodiments, the machinery or components not encoded by the genetic element may be provided in trans (e.g., using a helper, e.g., a helper virus or helper plasmid, or encoded in a nucleic acid comprised by the host cell, e.g., integrated into the genome of the host cell), e.g., such that the genetic element can undergo replication in the presence of the machinery or components provided in trans. In some embodiments, a packaging deficient, packaging defective, or packaging incompetent genetic element cannot be packaged into a proteinaceous exterior (e.g., wherein the proteinaceous exterior comprises a capsid or a portion thereof, e.g., comprising a polypeptide encoded by an ORF1nucleic acid, e.g., as described herein). In some embodiments, a packaging deficient genetic element is packaged into a proteinaceous exterior at an efficiency less than 10% (e.g., less than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.01%, or 0.001%) compared to a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein). In some embodiments, the packaging defective genetic element cannot be packaged into a proteinaceous exterior even in the presence of factors (e.g., ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, or ORF2t / 3) that would permit packaging of the genetic element of a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein). In some embodiments, a packaging deficient genetic element is packaged into a proteinaceous exterior at an efficiency less than 10% (e.g., less than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.01%, or 0.001%) compared to a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein), even in the presence of factors (e.g., ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, or ORF2t / 3) that would permit packaging of the genetic element of a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein). In some embodiments, a packaging competent genetic element can be packaged into a proteinaceous exterior (e.g., wherein the proteinaceous exterior comprises a capsid or a portion thereof, e.g., comprising a polypeptide encoded by an ORF1nucleic acid, e.g., as described herein). In some embodiments, a packaging competent genetic element is packaged into a proteinaceous exterior at an efficiency of at least 20% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or higher) compared to a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein). In some embodiments, the packaging competent genetic element can be packaged into a proteinaceous exterior in the presence of factors (e.g., ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, or ORF2t / 3) that would permit packaging of the genetic element of a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein). In some embodiments, a packaging competent genetic element is packaged into a proteinaceous exterior at an efficiency of at least 20% (e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100%, or higher) compared to a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein) in the presence of factors (e.g., ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, or ORF2t / 3) that would permit packaging of the genetic element of a wild-type Anelloviridae family virus (e.g., Anellovirus) (e.g., as described herein). Anelloviridae Family Viruses (e.g., Anelloviruses) In some embodiments, an Anelloviridae family vector, e.g., as described herein, comprises sequences or expression products derived from an Anellovirus. In some embodiments, an Anelloviridae family vector includes one or more sequences or expression products that are exogenous relative to the Anellovirus. In some embodiments, an Anelloviridae family vector includes one or more sequences or expression products that are endogenous relative to the Anellovirus. In some embodiments, an Anelloviridae family vector includes one or more sequences or expression products that are heterologous relative to one or more other sequences or expression products in the Anelloviridae family vector. Anelloviridae family viruses (e.g., Anellovirus) generally have single-stranded circular DNA genomes with negative polarity. It is understood that applicable embodiments described herein with respect to anellovectors may also be applied to Anelloviridae family vectors (e.g., a vector based on or derived from a chicken anemia virus (CAV), e.g., as described herein). Examples of chicken anemia viruses, and compositions and uses thereof, are described in PCT Publication No. WO / 2022 / 094238, incorporated herein by reference in its entirety, including the sequences of Tables 1A and 1B therein. In some embodiments, the genetic element comprises a nucleotide sequence encoding an amino acid sequence or a functional fragment thereof or a sequence having at least about 60%, 70% 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of the amino acid sequences described herein, e.g., an Anellovirus amino acid sequence. In some embodiments, an Anelloviridae family vector as described herein comprises one or more nucleic acid molecules (e.g., a genetic element as described herein) comprising a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus sequence, e.g., as described herein, or a fragment thereof. In embodiments, the Anelloviridae family vector comprises a nucleic acid sequence selected from a sequence as shown in any of Tables N1- N3, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto, or a reverse complement thereof. In embodiments, the Anelloviridae family vector comprises a polypeptide comprising a sequence as shown in Table A1-A3, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. In some embodiments, an Anelloviridae family vector as described herein comprises one or more nucleic acid molecules (e.g., a genetic element as described herein) comprising a sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more of a TATA box, cap site, initiator element, transcriptional start site, 5’ UTR conserved domain, ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, ORF2t / 3, three open-reading frame region, poly(A) signal, GC-rich region, or any combination thereof, of any of the Anelloviridae family viruses (e.g., Anellovirus) described herein (e.g., an Anelloviridae family virus (e.g., Anellovirus) sequence as annotated, or as encoded by a sequence listed, in any of Tables N1-N3, or a reverse complement thereof. In some embodiments, the nucleic acid molecule comprises a sequence encoding a capsid protein, e.g., an ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, or ORF2t / 3sequence of any of the Anelloviruses described herein (e.g., an Anelloviridae family virus (e.g., Anellovirus ) sequence as annotated, or as encoded by a sequence listed, in any of Tables N1-N3). In some embodiments, the nucleic acid molecule comprises a sequence encoding a capsid protein comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anelloviridae family virus (e.g., Anellovirus ) ORF1 or ORF2 protein (e.g., an ORF1 or ORF2 amino acid sequence as shown in Table A1-A3, or an ORF1 or ORF2 amino acid sequence encoded by a nucleic acid sequence as shown in any of Tables N1-N3). In embodiments, the nucleic acid molecule comprises a sequence encoding a capsid protein comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anelloviridae family virus (e.g., Anellovirus ) ORF1 protein (e.g., an ORF1 amino acid sequence as shown in Table A1-A3, or an ORF1 amino acid sequence encoded by a nucleic acid sequence as shown in any of Tables N1-N3). Nucleic acid sequences In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF1 nucleotide sequence of any of Tables N1-N3. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF2 nucleotide sequence of any of Tables N1-N3. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF3 nucleotide sequence of any of Tables N1-N3. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) GC-rich region nucleotide sequence of any of Tables N1-N3, or a reverse complement thereof. In some embodiments, the nucleic acid molecule comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) 5’ UTR conserved domain nucleotide sequence of any of Tables N1-N3, or a reverse complement thereof. In the field of Anellovirus research, the sequences of particular Anellovirus strains are commonly provided as a positive strand sequence for convenience of indicating the protein-coding regions. Consequently, unless specified otherwise, this disclosure also adopts the convention of providing the positive strand sequence corresponding to a particular Anellovirus genome or elements thereof. However, as known in the art and as described herein, a genetic element of an anellovector is typically a negative strand, such that the negative strand is enclosed into the proteinaceous exterior. The positive strand sequences of Table N1-N3, for example, can readily be converted to the corresponding negative strand sequence, for example, using tools such as the Reverse Complement tool on Bioinformatics.org available on the world wide web at www.bioinformatics.org / sms / rev_comp.html. Consequently, a 5’ UTR conserved domain of a genetic element as described herein may comprise the reverse complement of a sequence annotated as a 5’ UTR conserved domain (e.g., in Table N1-N3). Similarly, a GC-rich region of a genetic element as described herein may comprise the reverse complement of a sequence annotated as a GC-rich region (e.g., in Table N1-N3). Likewise, an Anellovirus NCR of a genetic element may comprise the reverse complement of the relevant portion of a sequence of Table N1-N3. In some embodiments, the Anellovirus is an Alphatorquevirus. In some embodiments, the Anellovirus is a Betatorquevirus. In some embodiments, the Anellovirus is a Gammatorquevirus. In some embodiments, the Anellovirus is a Ring1, Ring2, Ring3.1, Ring4, Ring5.2, Ring6.0, Ring7, Ring9, Ring10, or Ring20 Anellovirus. The Ring1 Anellovirus genomic sequence is disclosed as SEQ ID NO: 16 of International Application PCT / US2021 / 037076, and the corresponding amino acid sequences are disclosed in Table A2 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region of SEQ ID NO: 16 of International Application PCT / US2021 / 037076. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 16 of International Application PCT / US2021 / 037076. The Ring2 Anellovirus genomic sequence is disclosed as SEQ ID NO: 54 of International Application PCT / US2022 / 015499, and the corresponding amino acid sequences are disclosed in Table B2 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region of SEQ ID NO: 54 of International Application PCT / US2022 / 015499. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 54 of International Application PCT / US2022 / 015499. The Ring3.1 Anellovirus genomic sequence is disclosed as SEQ ID NO: 878 of International Application PCT / US2022 / 015499, and the corresponding amino acid sequences are disclosed in Table B4 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 878 of International Application PCT / US2022 / 015499. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 878 of International Application PCT / US2022 / 015499. The Ring4 Anellovirus genomic sequence is disclosed as SEQ ID NO: 886 of International Application PCT / US2021 / 037076, and the corresponding amino acid sequences are disclosed in Table C2 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 886 of International Application PCT / US2021 / 037076. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 886 of International Application PCT / US2021 / 037076. The Ring5.2 Anellovirus genomic sequence is disclosed as SEQ ID NO: 894 of International Application PCT / US2022 / 015499, and the corresponding amino acid sequences are disclosed in Table D2 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 894 of International Application PCT / US2022 / 015499. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 894 of International Application PCT / US2022 / 015499. The Ring6.0 Anellovirus genomic sequence is disclosed as SEQ ID NO: 903 of International Application PCT / US2019 / 065995, and the corresponding amino acid sequences are disclosed in Table C4 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 903 of International Application PCT / US2019 / 065995. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 903 of International Application PCT / US2019 / 065995. The Ring7 Anellovirus genomic sequence is disclosed as SEQ ID NO: 911 of International Application PCT / US2019 / 065995, and the corresponding amino acid sequences are disclosed in Table C5 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 911 of International Application PCT / US2019 / 065995. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 911 of International Application PCT / US2019 / 065995. The Ring9 Anellovirus genomic sequence is disclosed as SEQ ID NO: 1001 of International Application PCT / US2022 / 015499, and the corresponding amino acid sequences are disclosed in Table F2 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 1001 of International Application PCT / US2022 / 015499. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 1001 of International Application PCT / US2022 / 015499. The Ring10 Anellovirus genomic sequence is disclosed as SEQ ID NO: 1008 of International Application PCT / US2022 / 015499, and the corresponding amino acid sequences are disclosed in Table F4 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 1008 of International Application PCT / US2022 / 015499. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 1008 of International Application PCT / US2022 / 015499. The Ring20 Anellovirus genomic sequence is disclosed as SEQ ID NO: 1014 of International Application PCT / US2022 / 015499, and the corresponding amino acid sequences are disclosed in Table F6 of the same International Application, and the sequences are herein incorporated by reference in their entireties. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich region nucleotide sequence of SEQ ID NO: 1014 of International Application PCT / US2022 / 015499. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of SEQ ID NO: 1014 of International Application PCT / US2022 / 015499. Amino acid sequences encoded by nucleic acid sequences In embodiments, the nucleic acid molecule comprises a nucleic acid sequence encoding an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF1 amino acid sequence of Table A1-A3. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence encoding an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF2 amino acid sequence of Table A1-A3. In embodiments, the nucleic acid molecule comprises a nucleic acid sequence encoding an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF3 amino acid sequence of Table A1-A3. In some embodiments, the nucleic acid is a genetic element construct or a construct for providing the polypeptide (e.g., an ORF1 molecule and / or an ORF2 molecule) in trans. Proteins comprising amino acid sequences In some embodiments, the Anelloviridae family vector described herein comprises an Anellovirus ORF or ORF molecule (e.g., an Anellovirus ORF1, ORF2, ORF2 / 2, ORF2 / 3, ORF1 / 1, or ORF1 / 2) includes a polypeptide comprising an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a corresponding Anellovirus ORF sequence, e.g., as described herein). In embodiments, the Anelloviridae family vector described herein comprises a protein having an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF1 amino acid sequence of Table A1-A3. In embodiments, the Anelloviridae family vector described herein comprises a protein having an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF2 amino acid sequence of Table A1-A3. In embodiments, the Anelloviridae family vector described herein comprises a protein having an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF3 amino acid sequence of Table A1-A3. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table A2 of International Application PCT / US2021 / 037076. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table B4 of International Application PCT / US2022 / 015499. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table C2 of International Application PCT / US2021 / 037076. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table D2 of International Application PCT / US2022 / 015499. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table C4 of International Application PCT / US2019 / 065995. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table C5 of International Application PCT / US2019 / 065995. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table F2 of International Application PCT / US2022 / 015499. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table F4 of International Application PCT / US2022 / 015499. In some embodiments, an ORF1 molecule has an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the ORF1 molecule of Table F6 of International Application PCT / US2022 / 015499. In some embodiments, an ORF1 molecule (e.g., comprised in the Anelloviridae family vector) comprises a polypeptide encoded by the Anelloviridae family virus (e.g., Anellovirus) ORF1 nucleic acid sequence of any of Tables N1-N3. In some embodiments, the ORF1 molecule (e.g., comprised in the Anelloviridae family vector) comprises an Anelloviridae family virus (e.g., Anellovirus) ORF1 protein of Table A1-A3 or a splice variant or post-translationally processed (e.g., proteolytically processed) variant thereof. In some embodiments, an ORF2 molecule (e.g., comprised in the Anelloviridae family vector) comprises a polypeptide encoded by the Anelloviridae family virus (e.g., Anellovirus) ORF2 nucleic acid sequence of any of Tables N1-N3. In some embodiments, the ORF2 molecule (e.g., comprised in the Anelloviridae family vector) comprises an Anelloviridae family virus (e.g., Anellovirus) ORF2 protein of Table A1-A3 or a splice variant or post-translationally processed (e.g., proteolytically processed) variant thereof. In some embodiments, an ORF3 molecule (e.g., comprised in the Anelloviridae family vector) comprises a polypeptide encoded by the Anelloviridae family virus (e.g., Anellovirus) ORF3 nucleic acid sequence of any of Tables N1-N3. In some embodiments, the ORF3 molecule (e.g., comprised in the Anelloviridae family vector) comprises an Anelloviridae family virus (e.g., Anellovirus) ORF3 protein of Table A1-A3 or a splice variant or post-translationally processed (e.g., proteolytically processed) variant thereof. Polypeptides comprising amino acid sequences In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anelloviridae family virus (e.g., Anellovirus) ORF1 amino acid sequence described herein. In embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF1 amino acid sequence of Table A1-A3. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an ORF1 molecule encoded by an Anelloviridae family virus (e.g., Anellovirus) ORF1 nucleic acid described herein. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an ORF1 molecule encoded by an Anelloviridae family virus (e.g., Anellovirus) ORF1 nucleic acid as listed in Table N1-N3. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anelloviridae family virus (e.g., Anellovirus) ORF2 amino acid sequence described herein. In embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF2 amino acid sequence of Table A1-A3. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an ORF2 molecule encoded by an Anelloviridae family virus (e.g., Anellovirus) ORF2 nucleic acid described herein. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an ORF2 molecule encoded by an Anelloviridae family virus (e.g., Anellovirus) ORF2 nucleic acid as listed in Table N1-N3. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anelloviridae family virus (e.g., Anellovirus) ORF3 amino acid sequence described herein. In embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the Anelloviridae family virus (e.g., Anellovirus) ORF3 amino acid sequence of Table A1-A3. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an ORF3 molecule encoded by an Anelloviridae family virus (e.g., Anellovirus ) ORF3 nucleic acid described herein. In some embodiments, the polypeptide described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an ORF3 molecule encoded by an Anelloviridae family virus (e.g., Anellovirus ) ORF3 nucleic acid as listed in Table N1-N3. In some embodiments, the polypeptide comprises an amino acid sequence (e.g., an ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, or ORF2t / 3 sequence) as shown in Table A1-A3, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. Ring19 is an Anellovirus that was isolated from RPE cells. In some embodiments, a method described herein comprises delivering an Anellovector (e.g., an Anellovector having sequence similarity to Ring19) to eye tissue (e.g., to the eye of a subject), for example, to retinal tissue and / or RPE cells. Table N1. Exemplary Anellovirus nucleic acid sequence (Betatorquevirus). NameRING 19Genus / Clade Betatorquevirus Source tissue Retinal pigment epithelium Accession N / A Full Sequence: 2876 bp 1 10 20 30 40 50 | | | | | | CGGGAGCCGAAGGTGAGTGCAACCACCGTAGTCTAGGGGCAATTCGGGCT AGTTCAGTATGGCGGAACGGGCAAGAAACTTAAATATTATTATTTTACAG ATGCAAATACAACCACCTATTAGAACCTTCAAACAAACAATTTCAGATTG GAAAAACTTAATTGTCCACGTTCACGACAACATTTGCAACTGCAATAAAC CATTAGAACACACTATTGATACCTGTATCACCAATCCAGATGAATTAAGA TTAAACAAATCTACTAAACAACAACTACAAAAATGCCTTGGTACCCCAGA AGAAGATACCCAAGAAGACGTTATCGATGGCTTCGCAGATGGAGAGCTAG ACGCCCTTTTCGCCCAAGATACAGAAGAAGATACTGGGTAAGAAACTATT CTCGAAAGAGAAAACTATTTAAAATAACAACCAAAGAATGGCAACCAAAA GTTATAAGAAAGACTCATGTAAAGGGCACCTATCCTTTGTTTCTTTGTAC AAAGCACAGAATTAACAATAATATGATACAATATTTAGACTCTATAGCTC CAGAACACTATTACGGAGGAGGAGGATTTTCAATAATGCAATTTTCCTTA CAAGCCTTATATGAAGAATTTATAAAAGCAAAAAACTGGTGGACTAATAC AAACTGCTTTTTACCACTTGTAAGATATATGGGTTGCTCATTCAAATTTT ATAAAACTGAATTTTATGATTATATTGTACTAATTGAAAGATGTTATCCA CTTGCTTGTACTGATGAAATGTACTTATCTACTCAACCTAGTATTATGAT GCTTACAAGAAAATGTATTTTTGTACCATGCAAACAAAACAGCAAAGGTA AAAAACCTTACAAAAAAGTTAGAGTAAGACCACCTTCACAAATGACTACA GGATGGCATTTCTCACAAGACTTAGCAAACATGCCACTTGTAGTACTAAA AACTTCAGTATGCAGCTTTGACAGATATTACACAGACAGTACAGCTAAAT CAACCACAATAGGCTTTAAAACACTTAACACACAAACATTTAGATATCAT GACTGGCAGGAACCACCTACAACAGGATACAAACCACAAAACCTACTATG GTTTTATGGAGCAGAAAACGGATCACCAGTAGACCCCAACAACACAATAG TATCAAACCTAATATACTTAGGAGGCACAGGACCTTATGAAAAAGGCACA CCAATAAAAACAAACATAAGCAATTACTTTTCAGAGCCTAAACTGTGGGG AAATATATTTCACGATGATTATACATCAGGAACATCACCCGTGTTTGTTA CAAACAAATCACCATCAGAAATTAAAACCGCATGGAACACTATAAAAGAC TTAACTGTTAAAGCTAGCGGTGTATTTACATTAAGAACAATTCCACTATG GCTACCTTGCAGATACAACCCATTTGCAGACAAAGCAACCAACAACAAAA TATGGCTAGTTTCTATACATTCAGACCACACAGAATGGAAACCAATAGAC AATCCATTACTACAACGAACAGACCTTCCTTTATGGTTACTTGTATGGGG TTGGCAAGATTGGCAGAAAAAAAACCAACAAACTTCACAACCTGATATTA ATTATTTAACAGTAATATCTTCACCATATATATCATGCTACCCAAAATTA GATTACTATGTGTTACTAGATGAAGGATTTTGGGAGGGTCACTCAACATA CATAGAGTCAATTACAGACTCAGACAAAAAACACTGGTACCCTAAAAATA GATTTCAAATAGAAACACTTAATCTAATAGCTAACACAGGTCCAGGAACT GTAAAACTAAGAGAAAACCAAGCAGCAGAAGGTCACATGGTATATCGCTT TAATTTTAAGCTTGGAGGATGTCCCGCACCGATGGAAAAAATATGTGACC CTAGCAAACAATCCAAATATCCTATTCCCAATAACCAGCAACAAACAACT TCGTTGCAGAGTCCAGAAAACCCAATTCAAACCTATCTCTACGACTTCGA CGAAAGGAGGGGCCTACTTACAGAAAGAGCTACAAAAAGAATCAAACAAG ATCACACATCTGAAAAAACTGTTTTGCCATTTACAGGAGCAGCAACAGAC CTCCCCATACTCCAAACAACATCACAGGAGGAAAGCTCCTCGGAAGAAGA AGAAGAGCAACAAGCGGAGAAGAAACTACTCCAGCTCCGAAGAAAGCAGC ACCGACTCCGGGAGCGAATCCTCCAGCTATTAGACATACAAAATACATAA TAAAACAAAGTACTGTAAAAATTGATATGTTTGGAGATACTCATGTACCT AACCGTAGAATGACCCCAGAAGAATTTGAACAAGAACTAATTGTCGCTGG TGTTTTTCGCAGACCTCCTTGTTACTATATAAAAGATAGACCTACTTATC CTTATGTACCAAAACCTACTGATGAAAAATGTATGGTAAACTTTGACTTA AACTTTCCTTAATAAACTACGCCTGCAAACTTTCACTCTCGGTGTCCATT TATATAAGATAAAACTTAAATAAACATCCACCACTCTCCCAAATACGCAG GCGCACAAGGGGGCTCCGCCCCCTTAAACCCCCAAGGGGGCTCCGCCCCC TTAAACCCCCAAGGGGGCTCCGCCCCCTTACACCCCCTAATAAATATTCA ACAGGAAAACCACCTAATTAGAATTGCCGACCACAAACCGTCACTTACTT CTCCTTTTTGCACTTACTTCCTCTTTTACTTATTATTATTCATTACATTA ATTAATAATCACTGTAATTCCGGGGAGGAGCTAACAATCTATATAACTAA CTACACTTCCGAATGGCTGAGTTTATGCCGCCAGACGGAGACGGGATCAC TTCAGTGACTCCAGGCTGAACTTGGG (SEQ ID NO: 1) Annotations: Putative Domain Base range ORF1 283 – 2250 ORF2 101 – 391 ORF3 2277 – 2462 GC-rich region 2515 – 2615 5’ UTR Conserved Domain, or a portion thereof 1 – 71 Table A1. Exemplary Anellovirus amino acid sequence (Betatorquevirus) Table N2. Exemplary Anellovirus nucleic acid sequence (Alphatorquevirus). Name Ring18 Genus / Clade Alphatorquevirus Source tissue Accession Number N / A Full Sequence: 3733 bp 1 CACGTGACTC CCGCAGGCCA ACCAGAGTCT ACGTCGTGCA CTTCCTGGGC ATGGTCTACA 61 TCATAATATA AGAAGGCGCA CTTCCGAATG GCTGAGTTTT CCACGCCCGT CCGCAGCGAG 121 AACGCCACGG AGGGAGATCC TCGCGTCCCG AGGGCGGGTG CCGGAGGTGA GTTTACACAC 181 CGCAGTCAAG GGGCAATTCG GGCTCGGGAC TGGCCGGGCC CCGGGCAAGG CTCTTAAAAA 241 ATGCGCTTTC GCAGGGTTGC TGAGAAAAGG AAAGTGCTTC TGCAAACTGT GCGAGCTGCA 301 GAGAAGACTA GGCGGCTTCT AGGTATGTGG CAGCCCCCCG CGCACAATGT CCCCGGCATC 361 GAGAGAAACT GGTACGAGAG CTGTTTTCGA TCCCATGCTG CTGTTTGCGG CTGTGGCGAC 421 TTTGTTGGCC ATCTTAGTTA TCTGGCAACT ACTCTGGGTC GTCCTCCGCG TCCTGGGCCC 481 CCAGGCGGAC CCCGCACACC GCAGATAAGA AACCTGCCAG CGCTCCCGGC GCCCCAGGGC 541 GAGCCCGGTG ACAGAGCGCC ATGGCGTGGG GCTTCTGGGG CCGACGCCGC CGGTGGAGAC 601 GGTGGAGACC ACGGCGCAGA CGGTGGAGAC CCCGCAGACG TAGGAGACGA CGCCCTGCTC 661 GCCGCTTTCG AGCTCGTCGA AGAGTAAGGA GGCGCGGGGG GCGGTGGCGC AGACGCTACA 721 GAAAATGGCG ACGGGGCAGA CGCAGACGAA CTCACAGAAA AAAGATAGTC ATAAAACAGT 781 GGCAACCAAA CTTTATAAGA CGCTGCTACA TCATAGGGTA CCTACCTTTA ATATTCTGTG 841 GCGAAAACAC AACCGCCCAG AACTATGCCA CTCACTCAGA CGACATGATA AGCAAAGGAC 901 CATACGGGGG GGGCATGACT ACCACAAAAT TTACTCTGAG AATACTGTAC GACGAGTTTA 961 CCAGGTTTAT GAACTTTTGG ACTGTTAGTA ACGAAGACCT AGACCTGTGT AGATACGTGG 1021 GCTGCAAACT CATATTTTTT AAACATCCCA CAGTGGACTT TATAGTACAG ATAAACACTC 1081 AGCCTCCTTT CTTAGACACG CACCTTACCG CGGCCAGCAT ACACCCGGGC ATCATGATGC 1141 TCAGCAAGAG ACGCATACTA ATACCCTCTC TAAAAACCCG GCCAAGCAGA AAACACAGGG 1201 TGGTTGTTAG GGTGGGCGCC CCAAGACTTT TTCAGGACAA GTGGTACCCC CAGTCAGACC 1261 TGTGTGACAC AGTTCTGCTT TCCATATTTG CAACCGCCTG TGACTTGCAA TATCCGTTCG 1321 GCTCACCACT AACTGACAAC CCTTGCGTCA ACTTCCAGAT TCTGGGGCCC CAGTACAAAA 1381 AACACCTTAG TATTAGCTCT ACTATGGATA CAACTAACAA ACAGCACTAT GACAGCAATT 1441 TGTTTAACCA AACTCAGCTA TACAACACCT TTCAAACTAT AGCTCAGCTT AAAGAGACAG 1501 GACAAACTGC AAACATATCT CCTAGTTGGA GTGCAGTGCA AAATAATATG GCCCTTAGTA 1561 ATACCGGTGA AAATGCAACC CAAAGCAAAG ACACTTGGTA CAAAGGAAAC ACATACAACA 1621 ACCACATTAC AACGTTAGCA CAAAAAACCA GAGAAAGATT TAAAGGTGCA ACAAAAGCAG 1681 CACTACAAAA CTACCCCACC ATAATGTCCA CAGACTTATA TGAATACCAC TCAGGCATAT 1741 ACTCCAGCAT ATTTCTATCA GCTGGCAGGA GCTACTTTGA AACCACCGGG GCCTACTCTG 1801 ACATTATATA CAACCCTTTC ACAGACAAAG GCACAGGCAA CATAATCTGG ATAGACTACC 1861 TCACAAAAGA AGACACCATT TTTGTAAAAA ACAAAAGCAA ATGCGAAATA ATGGACATGC 1921 CCCTGTGGGC GGCCTGCACA GGATATACAG AGTTCTGTGC AAAGTATACA GGAGACTCTG 1981 CCATTATTTA CAATGCCAGA GTACTAATAA GATGCCCGTA CACTGAACCC ATGCTAATAG 2041 ACCACTCAGA CCCGAACAAA GGCTTCGTAC CCTACTCATT TAACTTTGGC AACGGAAAAA 2101 TGCCCGGAGG CAGCTCCAAC GTACCCATAA GAATGAGAGC CAAATGGTAC GTGAACATAT 2161 TCCACCAAAA AGAGGTTCTA GAGACTATAG TACAGAGCGG ACCGTTCGGG TACAAGGGCG 2221 ACATAAAATC AGCTGTACTG GCCATGAAAT ACAGATTTCA CTGGAAATGG GGTGGAAACC 2281 CTATATCCAA ACAGGTCGTC AGGAATCCCT GCTCCAACTC CAGCTCCTCC GCGGCCCATA 2341 GAGGACCTCG CAGCGTACAA GCAGTTGACC CGAAATACAA TACCCCAGAG GTCACGTGGC 2401 ACTCGTGGGA CATCAGACGA GGACTCTTTG GCAAAGCAGG TATTAAAAGA ATGCAACAAG 2461 AATCAGATGC TCTTTACATT CCTCCAGGAC CATTCAAGAG ACCTCGCAGA GACACGAACG 2521 CCCAAGACCC AGAAGAGCAA AACGAAAGCT CAGGTTTCAG AGTCCAGCAG CGACTCCCGT 2581 GGGTCCACTC CAGCCAAGAG ACGCAAAGCT CCCAAGAAGA AACGGAGGCG CAGGGGTCGG 2641 TACAAGACCA ACTACTCCTC CAGCTCCGAG AGCAGCGAGT ACTCCGACTC CAGCTCCAGC 2701 AACTCGCAAC CCAAGTCCTC AAAGTCCAAG CAGGGCACGG CATACACCCC CTATTATCTT 2761 CCCAAGCGTA AACAAAGTCT TTATGTTTGA GCCCCACGGT CCTAAACCCA TACAGGGCTA 2821 CAACGATTGG CTAGAGGAGT ACACTGCTTG TAAATTCTGG GACAGACCCC CAAGAAAGCT 2881 ACACACAGAC TTACCCTTTT ACCCCTGGGC ACCAAAACCC CAAGACCAAG TCAGGGTAAG 2941 CTTTAAACTC AACTTTCAAT AAAAATTCTA GGCCGTGGGA GTTTCACTTG TCGGTGTCTG 3001 CTTCTTAAGG TCGCCAAGCA CTCCGAGCGC CAGCGAGGAG TGCGACCCCC CCTCCGGTAG 3061 CAACGCCTTC GGAGCCGCGC GCTACGCCTT CGGCTGCGCG CGGCACCTCA GACCCCCCCT 3121 CCACCCGAAA CGCTTGCGCG TTTCGGACCT TCGGCGTCGG GGGGGTCGGG AGCTTTATTA 3181 AACAGACTCC GAGTTGCCAT TGGACACTGG AGCTGTGAAT CAGTAACGAA AGTGAGTGGG 3241 GCCAGACTTC GCCATAGGGC CTTTATCTTC TCGCCATTGG ATAGTGTCCG GGGTCGCCGT 3301 AGGCTTCGGC CTCGTTTTTA GGCCTTCCGG ACTACAAAAA TGGCGAACTT GGTGACGTCA 3361 CGGCCGCCAT TTTAAGTAAG GCGGAAGCAG CTCCACTTTC TCACAAAATG GCGGCGGAGC 3421 ACTTCCGGCT TGCCCAAAAT AGCGGGCAAG CTCTTCCGGG TCAAAGGTCA GCAGCTACGT 3481 CACAAGTCAC CTGACTGAGG AGGAGCTAAA ACCCGGAAGT CCTCCTCGGT CACGTGGCTA 3541 GTCACGTGAC TACTACGTCA TCGGCGCCAT CTTGTGTGAC AAAATGGCGG ACAACTTCCG 3601 CTTTTTTGAA AAAAGGCGCG AAAAAACGGC GGCGGCGGCG CGCGCGCTGC GCGCGCGCGC 3661 CGAGGGGGCG CCAGCGCCCC CACTGTGCGG TCCCCCGCGG GGCTCCGGCC CCCCCCCGAA 3721 GTCCGTCACT AAC (SEQID NO: 213) Annotations: Putative Domain Base range TATA Box 67 - 71 Cap Site 88 - 95 Transcriptional Start Site 95 5’ UTR Conserved Domain 155 - 225 ORF2 325 - 687 TAIP 347 - 508 ORF2 / 2 325 - 683, 2295 - 2790 ORF2 / 3 325- 683, 2488 - 2962 ORF1 561 - 2771 ORF1 / 1 561 - 683, 2295 - 2771 ORF1 / 2 561 - 683, 2488 – 2790 Three open-reading frame region 2447 - 2771 Poly(A) Signal 2958 - 2963 GC-rich region 3627 - 3718 Table A2. Exemplary Anellovirus amino acid sequences for Ring 18 (Alphatorquevirus)

[0002] Table N3. Exemplary Anellovirus nucleic acid sequence (Betatorquevirus) Name Ring2 Genus / Clade Betatorquevirus Accession Number JX134045.1 Full Sequence: 2797 bp 1 10 20 30 40 50 | | | | | | TAATAAATATTCAACAGGAAAACCACCTAATTTAAATTGCCGACCACAAA CCGTCACTTAGTTCCCCTTTTTGCAACAACTTCTGCTTTTTTCCAACTGC CGGAAAACCACATAATTTGCATGGCTAACCACAAACTGATATGCTAATTA ACTTCCACAAAACAACTTCCCCTTTTAAAACCACACCTACAAATTAATTA TTAAACACAGTCACATCCTGGGAGGTACTACCACACTATAATACCAAGTG CACTTCCGAATGGCTGAGTTTATGCCGCTAGACGGAGAACGCATCAGTTA CTGACTGCGGACTGAACTTGGGCGGGTGCCGAAGGTGAGTGAAACCACCG AAGTCAAGGGGCAATTCGGGCTAGTTCAGTCTAGCGGAACGGGCAAGAAA CTTAAAATTATTTTATTTTTCAGATGAGCGACTGCTTTAAACCAACATGC TACAACAACAAAACAAAGCAAACTCACTGGATTAATAACCTGCATTTAAC CCACGACCTGATCTGCTTCTGCCCAACACCAACTAGACACTTATTACTAG CTTTAGCAGAACAACAAGAAACAATTGAAGTGTCTAAACAAGAAAAAGAA AAAATAACAAGATGCCTTATTACTACAGAAGAAGACGGTACAACTACAGA CGTCCTAGATGGTATGGACGAGGTTGGATTAGACGCCCTTTTCGCAGAAG ATTTCGAAGAAAAAGAAGGGTAAGACCTACTTATACTACTATTCCTCTAA AGCAATGGCAACCGCCATATAAAAGAACATGCTATATAAAAGGACAAGAC TGTTTAATATACTATAGCAACTTAAGACTGGGAATGAATAGTACAATGTA TGAAAAAAGTATTGTACCTGTACATTGGCCGGGAGGGGGTTCTTTTTCTG TAAGCATGTTAACTTTAGATGCCTTGTATGATATACATAAACTTTGTAGA AACTGGTGGACATCCACAAACCAAGACTTACCACTAGTAAGATATAAAGG ATGCAAAATAACATTTTATCAAAGCACATTTACAGACTACATAGTAAGAA TACATACAGAACTACCAGCTAACAGTAACAAACTAACATACCCAAACACA CATCCACTAATGATGATGATGTCTAAGTACAAACACATTATACCTAGTAG ACAAACAAGAAGAAAAAAGAAACCATACACAAAAATATTTGTAAAACCAC CTCCGCAATTTGAAAACAAATGGTACTTTGCTACAGACCTCTACAAAATT CCATTACTACAAATACACTGCACAGCATGCAACTTACAAAACCCATTTGT AAAACCAGACAAATTATCAAACAATGTTACATTATGGTCACTAAACACCA TAAGCATACAAAATAGAAACATGTCAGTGGATCAAGGACAATCATGGCCA TTTAAAATACTAGGAACACAAAGCTTTTATTTTTACTTTTACACCGGAGC AAACCTACCAGGTGACACAACACAAATACCAGTAGCAGACCTATTACCAC TAACAAACCCAAGAATAAACAGACCAGGACAATCACTAAATGAGGCAAAA ATTACAGACCATATTACTTTCACAGAATACAAAAACAAATTTACAAATTA TTGGGGTAACCCATTTAATAAACACATTCAAGAACACCTAGATATGATAC TATACTCACTAAAAAGTCCAGAAGCAATAAAAAACGAATGGACAACAGAA AACATGAAATGGAACCAATTAAACAATGCAGGAACAATGGCATTAACACC ATTTAACGAGCCAATATTCACACAAATACAATATAACCCAGATAGAGACA CAGGAGAAGACACTCAATTATACCTACTCTCTAACGCTACAGGAACAGGA TGGGACCCACCAGGAATTCCAGAATTAATACTAGAAGGATTTCCACTATG GTTAATATATTGGGGATTTGCAGACTTTCAAAAAAACCTAAAAAAAGTAA CAAACATAGACACAAATTACATGTTAGTAGCAAAAACAAAATTTACACAA AAACCTGGCACATTCTACTTAGTAATACTAAATGACACCTTTGTAGAAGG CAATAGCCCATATGAAAAACAACCTTTACCTGAAGACAACATTAAATGGT ACCCACAAGTACAATACCAATTAGAAGCACAAAACAAACTACTACAAACT GGGCCATTTACACCAAACATACAAGGACAACTATCAGACAATATATCAAT GTTTTATAAATTTTACTTTAAATGGGGAGGAAGCCCACCAAAAGCAATTA ATGTTGAAAATCCTGCCCACCAGATTCAATATCCCATACCCCGTAACGAG CATGAAACAACTTCGTTACAGAGTCCAGGGGAAGCCCCAGAATCCATCTT ATACTCCTTCGACTATAGACACGGGAACTACACAACAACAGCTTTGTCAC GAATTAGCCAAGACTGGGCACTTAAAGACACTGTTTCTAAAATTACAGAG CCAGATCGACAGCAACTGCTCAAACAAGCCCTCGAATGCCTGCAAATCTC GGAAGAAACGCAGGAGAAAAAAGAAAAAGAAGTACAGCAGCTCATCAGCA ACCTCAGACAGCAGCAGCAGCTGTACAGAGAGCGAATAATATCATTATTA AAGGACCAATAACTTTTAACTGTGTAAAAAAGGTGAAATTGTTTGATGAT AAACCAAAAAACCGTAGATTTACACCTGAGGAATTTGAAACTGAGTTACA AATAGCAAAATGGTTAAAGAGACCCCCAAGATCCTTTGTAAATGATCCTC CCTTTTACCCATGGTTACCACCTGAACCTGTTGTAAACTTTAAGCTTAAT TTTACTGAATAAAGGCCAGCATTAATTCACTTAAGGAGTCTGTTTATTTA AGTTAAACCTTAATAAACGGTCACCGCCTCCCTAATACGCAGGCGCAGAA AGGGGGCTCCGCCCCCTTTAACCCCCAGGGGGCTCCGCCCCCTGAAACCC CCAAGGGGGCTACGCCCCCTTACACCCCC (SEQ ID NO: 54) Annotations: Putative Domain Base range TATA Box 237– 243 Cap Site 260 – 267 Transcriptional Start Site 267 5’ UTR Conserved Domain 323 – 393 ORF2 424 – 723 ORF2 / 2 424 – 719; 2274 – 2589 ORF2 / 3 424 – 719; 2449 – 2812 ORF1 612 – 2612 ORF1 / 1 612 – 719; 2274 – 2612 ORF1 / 2 612 – 719; 2449 – 2589 Three open-reading frame region 2441 – 2586 Poly(A) Signal 2808 – 2813 GC-rich region 2868 – 2929 Table A3. Exemplary Anellovirus amino acid sequences (Betatorquevirus) Capsid Proteins (e.g., ORF1 molecules) In some embodiments, the anellovector comprises an ORF1 molecule and / or a nucleic acid encoding an ORF1 molecule. Generally, an ORF1 molecule comprises a polypeptide having the structural features and / or activity of an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein, e.g., as listed in Table A1-A3), or a functional fragment thereof. In some embodiments, the ORF1 molecule comprises a truncation relative to an Anellovirus ORF1 protein (e.g., an Anellovirus ORF1 protein as described herein, e.g., as listed in Table A1-A3). In some embodiments, the ORF1 molecule is truncated by at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, or 700 amino acids of the Anellovirus ORF1 protein. In some embodiments, an ORF1 molecule comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1 protein sequence as shown in Table A1-A3. In some embodiments, an ORF1 molecule comprises an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to an Betatorquevirus ORF1 protein, e.g., as described herein. An ORF1 molecule can generally bind to a nucleic acid molecule, such as DNA (e.g., a genetic element, e.g., as described herein). In some embodiments, an ORF1 molecule localizes to the nucleus of a cell. In certain embodiments, an ORF1 molecule localizes to the nucleolus of a cell. In some embodiments, an ORF1 molecule is encoded by an ORF1 nucleic acid. In some embodiments, the ORF1 nucleic acid comprises an antisense strand, which can be directly transcribed to produce mRNA encoding the ORF1 molecule. In some embodiments, the ORF1 nucleic acid comprises a sense strand. In some embodiments, an ORF1 molecule as described herein comprises an amino acid sequence (e.g., an ORF1 sequence, or an arginine-rich region, jelly-roll domain, HVR, N22, or C-terminal domain sequence) as listed in any of Tables A2, A4, A6, A8, A10, A12, C1-C5, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20- 37, or D1-D10 of PCT Publication No. WO2020 / 123816 (incorporated herein by reference in its entirety), or a sequence having at least 70% 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity thereto. Without wishing to be bound by theory, an ORF1 molecule may be capable of binding to other ORF1 molecules, e.g., to form a proteinaceous exterior (e.g., as described herein). Such an ORF1 molecule may be described as having the capacity to form a capsid. In some embodiments, the proteinaceous exterior may encapsulate a nucleic acid molecule (e.g., a genetic element as described herein). In some embodiments, a plurality of ORF1 molecules may form a multimer, e.g., to produce a proteinaceous exterior. In some embodiments, the multimer may be a homomultimer. In other embodiments, the multimer may be a heteromultimer (e.g., comprising a plurality of distinct ORF1 molecules). It is also contemplated that an ORF1 molecule may have replicase activity. An ORF1 molecule may, in some embodiments, comprise one or more of: a first region comprising an arginine rich region, e.g., a region having at least 60% basic residues (e.g., at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% basic residues; e.g., between 60%-90%, 60%-80%, 70%-90%, or 70-80% basic residues), and a second region comprising jelly-roll domain, e.g., at least six beta strands (e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12 beta strands). Arginine-rich region An arginine rich region (e.g., comprised an ORF1 molecule as described herein) has at least 70% (e.g., at least about 70, 80, 90, 95, 96, 97, 98, 99, or 100%) sequence identity to an arginine-rich region sequence described herein or a sequence of at least about 40 amino acids comprising at least 60%, 70%, or 80% basic residues (e.g., arginine, lysine, or a combination thereof). In some embodiments, an ORF1 molecule as described herein comprises a deletion or truncation of an arginine-rich region. In some embodiments, the entire arginine-rich region is deleted. In some embodiments, a portion of the arginine-rich region (e.g., a N-terminal portion of the structural arginine- rich region) is deleted. In embodiments, the ORF1 molecule does not comprise an Anellovirus ORF1 arginine-rich region, or an amino acid sequence having at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, an ORF1 molecule having a deletion or truncation of the arginine-rich region further comprises a deletion or truncation of at least a portion of a C-terminal domain (e.g., as described herein). Jelly Roll domain A jelly-roll domain or region (e.g., comprised an ORF1 molecule as described herein) comprises (e.g., consists of) a polypeptide (e.g., a domain or region comprised in a larger polypeptide) comprising one or more (e.g., 1, 2, or 3) of the following characteristics: (i) at least 30% (e.g., at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, or more) of the amino acids of the jelly-roll domain are part of one or more β-sheets; (ii) the secondary structure of the jelly-roll domain comprises at least four (e.g., at least 4, 5, 6, 7, 8, 9, 10, 11, or 12) β-strands; and / or (iii) the tertiary structure of the jelly-roll domain comprises at least two (e.g., at least 2, 3, or 4) β- sheets; and / or (iv) the jelly-roll domain comprises a ratio of β-sheets to α-helices of at least 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, or 10:1. In certain embodiments, a jelly-roll domain comprises two β-sheets. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the β-sheets comprises about eight (e.g., 4, 5, 6, 7, 8, 9, 10, 11, or 12) β-strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the β-sheets comprises eight β-strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the β-sheets comprises seven β-strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the β-sheets comprises six β-strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the β-sheets comprises five β-strands. In certain embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of the β-sheets comprises four β- strands. In some embodiments, the jelly-roll domain comprises a first β-sheet in antiparallel orientation to a second β-sheet. In certain embodiments, the first β-sheet comprises about four (e.g., 3, 4, 5, or 6) β- strands. In certain embodiments, the second β-sheet comprises about four (e.g., 3, 4, 5, or 6) β-strands. In embodiments, the first and second β-sheet comprise, in total, about eight (e.g., 6, 7, 8, 9, 10, 11, or 12) β-strands. In certain embodiments, a jelly-roll domain is a component of a capsid protein (e.g., an ORF1 molecule as described herein). In certain embodiments, a jelly-roll domain has self-assembly activity. In some embodiments, a polypeptide comprising a jelly-roll domain binds to another copy of the polypeptide comprising the jelly-roll domain. In some embodiments, a jelly-roll domain of a first polypeptide binds to a jelly-roll domain of a second copy of the polypeptide. Other Subdomains An ORF1 molecule may also include a third region comprising the structure or activity of an Anellovirus N22 domain (e.g., as described herein, e.g., an N22 domain from an Anellovirus ORF1 protein as described herein). An ORF1 molecule may also include a fourth region comprising the structure or activity of an Anellovirus C-terminal domain (CTD) (e.g., as described herein, e.g., a CTD from an Anellovirus ORF1 protein as described herein). In some embodiments, an ORF1 molecule as described herein comprises a deletion or truncation of a C-terminal domain (CTD). In some embodiments, the entire CTD is deleted. In some embodiments, a portion of the CTD (e.g., a C-terminal portion of the CTD) is deleted. In embodiments, the ORF1 molecule does not comprise an Anellovirus ORF1 CTD, or an amino acid sequence having at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto. In some embodiments, an ORF1 molecule having a deletion or truncation of the CTD further comprises a deletion or truncation of at least a portion of an arginine-rich region (e.g., as described herein). In some embodiments, the ORF1 molecule comprises, in N-terminal to C-terminal order, the first, second, third, and fourth regions. The ORF1 molecule may, in some embodiments, further comprise a hypervariable region (HVR), e.g., an HVR from an Anellovirus ORF1 protein, e.g., as described herein. In some embodiments, the HVR is positioned between the second region and the third region. In some embodiments, the HVR comprises at least about 55 (e.g., at least about 45, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, or 65) amino acids (e.g., about 45-160, 50-160, 55-160, 60-160, 45-150, 50-150, 55-150, 60-150, 45-140, 50-140, 55- 140, or 60-140 amino acids). In some embodiments, the first region can bind to a nucleic acid molecule (e.g., DNA). In some embodiments, the basic residues are selected from arginine, histidine, or lysine, or a combination thereof. In some embodiments, the first region comprises at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% arginine residues (e.g., between 60%-90%, 60%-80%, 70%-90%, or 70-80% arginine residues). In some embodiments, the first region comprises about 30-120 amino acids (e.g., about 40-120, 40-100, 40- 90, 40-80, 40-70, 50-100, 50-90, 50-80, 50-70, 60-100, 60-90, or 60-80 amino acids). In some embodiments, the first region comprises the structure or activity of a viral ORF1 arginine-rich region (e.g., an arginine-rich region from an Anellovirus ORF1 protein, e.g., as described herein). In some embodiments, the first region comprises a nuclear localization signal. In some embodiments, the second region comprises a jelly-roll domain, e.g., the structure or activity of a viral ORF1 jelly-roll domain (e.g., a jelly-roll domain from an Anellovirus ORF1 protein, e.g., as described herein). In some embodiments, the second region is capable of binding to the second region of another ORF1 molecule, e.g., to form a proteinaceous exterior (e.g., capsid) or a portion thereof. In some embodiments, the fourth region is exposed on the surface of a proteinaceous exterior (e.g., a proteinaceous exterior comprising a multimer of ORF1 molecules, e.g., as described herein). In some embodiments, the first region, second region, third region, fourth region, and / or HVR each comprise fewer than four (e.g., 0, 1, 2, or 3) beta sheets. In some embodiments, one or more of the first region, second region, third region, fourth region, and / or HVR may be replaced by a heterologous amino acid sequence (e.g., the corresponding region from a heterologous ORF1 molecule). In some embodiments, the heterologous amino acid sequence has a desired functionality, e.g., as described herein. In some embodiments, the ORF1 molecule comprises a plurality of conserved motifs (e.g., motifs comprising about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, or more amino acids). In some embodiments, the conserved motifs may show 60, 70, 80, 85, 90, 95, or 100% sequence identity to an ORF1 protein of one or more wild-type Anellovirus clades (e.g., Betatorquevirus). In some embodiments, the conserved motifs each have a length between 1-1000 (e.g., between 5-10, 5-15, 5-20, 10-15, 10-20, 15-20, 5-50, 5-100, 10-50, 10-100, 10-1000, 50-100, 50-1000, or 100-1000) amino acids. In certain embodiments, the conserved motifs consist of about 2-4% (e.g., about 1-8%, 1-6%, 1-5%, 1-4%, 2-8%, 2-6%, 2-5%, or 2-4%) of the sequence of the ORF1 molecule, and each show 100% sequence identity to the corresponding motifs in an ORF1 protein of the wild-type Anellovirus clade. In certain embodiments, the conserved motifs consist of about 5-10% (e.g., about 1- 20%, 1-10%, 5-20%, or 5-10%) of the sequence of the ORF1 molecule, and each show 80% sequence identity to the corresponding motifs in an ORF1 protein of the wild-type Anellovirus clade. In certain embodiments, the conserved motifs consist of about 10-50% (e.g., about 10-20%, 10-30%, 10-40%, 10- 50%, 20-40%, 20-50%, or 30-50%) of the sequence of the ORF1 molecule, and each show 60% sequence identity to the corresponding motifs in an ORF1 protein of the wild-type Anellovirus clade. In some embodiments, an ORF1 molecule comprises at least one difference (e.g., a mutation, chemical modification, or epigenetic alteration) relative to a wild-type ORF1 protein, e.g., as described herein (e.g., as shown in Table A1-A3). Conserved ORF1 Motif in N22 Domain In some embodiments, a polypeptide (e.g., an ORF1 molecule) described herein comprises the amino acid sequence YNPX2DXGX2N (SEQ ID NO: 829), wherein Xnis a contiguous sequence of any n amino acids. For example, X2indicates a contiguous sequence of any two amino acids. In some embodiments, the YNPX2DXGX2N (SEQ ID NO: 829) is comprised within the N22 domain of an ORF1 molecule, e.g., as described herein. In some embodiments, a genetic element described herein comprises a nucleic acid sequence (e.g., a nucleic acid sequence encoding an ORF1 molecule, e.g., as describedherein) encoding the amino acid sequence YNPX2DXGX2N (SEQ ID NO: 829), wherein Xnis acontiguous sequence of any n amino acids. In some embodiments, a polypeptide (e.g., an ORF1 molecule) comprises a conserved secondary structure, e.g., flanking and / or comprising a portion of the YNPX2DXGX2N (SEQ ID NO: 829) motif, e.g., in an N22 domain. In some embodiments, the conserved secondary structure comprises a first beta strand and / or a second beta strand. In some embodiments, the first beta strand is about 5-6 (e.g., 3, 4, 5, 6, 7, or 8) amino acids in length. In some embodiments, the first beta strand comprises the tyrosine (Y) residue at the N-terminal end of the YNPX2DXGX2N (SEQ ID NO: 829) motif. In some embodiments, the YNPX2DXGX2N (SEQ ID NO: 829) motif comprises a random coil (e.g., about 8-9 amino acids of random coil). In some embodiments, the second beta strand is about 7-8 (e.g., 5, 6, 7, 8, 9, or 10) amino acids in length. In some embodiments, the second beta strand comprises the asparagine (N) residue at the C-terminal end of the YNPX2DXGX2N (SEQ ID NO: 829) motif. Exemplary ORF1 Sequences In some embodiments, a polypeptide (e.g., an ORF1 molecule) described herein comprises an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more Anellovirus ORF1 subsequences, e.g., as described herein). In some embodiments, an Anelloviridae family vector (e.g., anellovector) described herein comprises an ORF1 molecule comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more Anellovirus ORF1 subsequences, e.g., as described herein. In some embodiments, an anellovector described herein comprises a nucleic acid molecule (e.g., a genetic element) encoding an ORF1 molecule comprising an amino acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to one or more Anellovirus ORF1 subsequences, e.g., as described herein. In some embodiments, the one or more Anellovirus ORF1 subsequences comprises one or more of an arginine (Arg)-rich domain, a jelly-roll domain, a hypervariable region (HVR), an N22 domain, or a C-terminal domain (CTD) (e.g., as listed herein), or sequences having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. In some embodiments, the ORF1 molecule comprises a plurality of subsequences from different Anelloviruses. In some embodiments, the ORF1 molecule comprises one or more of an Arg-rich domain, a jelly-roll domain, an N22 domain, and a CTD from one Anelloviridae family virus (e.g., Anellovirus), and an HVR from another. In some embodiments, the ORF1 molecule comprises one or more of a jelly-roll domain, an HVR, an N22 domain, and a CTD from one Anelloviridae family virus (e.g., Anellovirus), and an Arg- rich domain from another. In some embodiments, the ORF1 molecule comprises one or more of an Arg- rich domain, an HVR, an N22 domain, and a CTD from one Anelloviridae family virus (e.g., Anellovirus), and a jelly-roll domain from another. In some embodiments, the ORF1 molecule comprises one or more of an Arg-rich domain, a jelly-roll domain, an HVR, and a CTD from one Anelloviridae family virus (e.g., Anellovirus), and an N22 domain from another. In some embodiments, the ORF1 molecule comprises one or more of an Arg-rich domain, a jelly-roll domain, an HVR, and an N22 domain from one Anelloviridae family virus (e.g., Anellovirus), and a CTD from another. Identification of ORF1 protein sequences In some embodiments, an ORF1 protein sequence, or a nucleic acid sequence encoding an ORF1 protein, can be identified from the genome of an Anelloviridae family virus, e.g., an Anellovirus (e.g., a putative Anelloviridae family virus genome identified, for example, by nucleic acid sequencing techniques, e.g., deep sequencing techniques). In some embodiments, an ORF1 protein sequence is identified by one or more (e.g., 1, 2, or all 3) of the following selection criteria: (i) Length Selection: Protein sequences (e.g., putative ORF1 sequences passing the criteria described in (ii) or (iii) below) may be size-selected for those greater than about 600 amino acid residues to identify putative ORF1 proteins. In some embodiments, an ORF1 protein sequence is at least about 600, 650, 700, 750, 800, 850, 900, 950, or 1000 amino acid residues in length. In some embodiments, an Alphatorquevirus ORF1 protein sequence is at least about 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 900, or 1000 amino acid residues in length. In some embodiments, a Betatorquevirus ORF1 protein sequence is at least about 650, 660, 670, 680, 690, 700, 750, 800, 900, or 1000 amino acid residues in length. In some embodiments, a Gammatorquevirus ORF1 protein sequence is at least about 650, 660, 670, 680, 690, 700, 750, 800, 900, or 1000 amino acid residues in length. In some embodiments, a nucleic acid sequence encoding an ORF1 protein is at least about 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 nucleotides in length. In some embodiments, a nucleic acid sequence encoding an Alphatorquevirus ORF1 protein sequence is at least about 2100, 2150, 2200, 2250, 2300, 2400, or 2500 nucleotides in length. In some embodiments, a nucleic acid sequence encoding a Betatorquevirus ORF1 protein sequence is at least about 1900, 1950, 2000, 2500, 2100, 2150, 2200, 2250, 2300, 2400, or 2500 or 1000 nucleotides in length. In some embodiments, a nucleic acid sequence encoding a Gammatorquevirus ORF1 protein sequence is at least about 1900, 1950, 2000, 2500, 2100, 2150, 2200, 2250, 2300, 2400, or 2500 or 1000 nucleotides in length. (ii) Presence of ORF1 motif: Protein sequences (e.g., putative ORF1 sequences passing the criteria described in (i) above or (iii) below) may be filtered to identify those that contain the conserved ORF1 motif in the N22 domain described above. In some embodiments, a putative Anellovirus ORF1 sequence comprises the sequence YNPXXDXGXXN (SEQ ID NO: 829). In some embodiments, a putative Anellovirus ORF1 sequence comprises the sequence Y[NCS]PXXDX[GASKR]XX[NTSVAK]. (iii) Presence of arginine-rich region: Protein sequences (e.g., putative ORF1 sequences passing the criteria described in (i) and / or (ii) above) may be filtered for those that include an arginine-rich region (e.g., as described herein). In some embodiments, a putative ORF1 sequence comprises a contiguous sequence of at least about 30, 35, 40, 45, 50, 55, 60, 65, or 70 amino acids that comprises at least 30% (e.g., at least about 20%, 25%, 30%, 35%, 40%, 45%, or 50%) arginine residues. In some embodiments, a putative ORF1 sequence comprises a contiguous sequence of about 35-40, 40-45, 45-50, 50-55, 55-60, 60-65, or 65-70 amino acids that comprises at least 30% (e.g., at least about 20%, 25%, 30%, 35%, 40%, 45%, or 50%) arginine residues. In some embodiments, the arginine-rich region is positioned at least about 30, 40, 50, 60, 70, or 80 amino acids downstream of the start codon of the putative ORF1 protein. In some embodiments, the arginine-rich region is positioned at least about 50 amino acids downstream of the start codon of the putative ORF1 protein. In some embodiments, an ORF1 protein is identified in an Anellovirus genome sequence as described in Example 36 of PCT Publication No. WO2020 / 123816 (incorporated herein by reference in its entirety). ORF2 molecules In some embodiments, the anellovector comprises an ORF2 molecule and / or a nucleic acid encoding an ORF2 molecule. Generally, an ORF2 molecule comprises a polypeptide having the structural features and / or activity of an Anellovirus ORF2 protein (e.g., an Anellovirus ORF2 protein as described herein, e.g., as listed in Table A1-A3), or a functional fragment thereof. In some embodiments, an ORF2 molecule comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF2 protein sequence as shown in Table A1-A3. In some embodiments, an ORF2 molecule is encoded by an ORF2 nucleic acid. In some embodiments, the ORF2 nucleic acid comprises an antisense strand, which can be directly transcribed to produce mRNA encoding the ORF2 molecule. In some embodiments, the ORF2 nucleic acid comprises a sense strand. In some embodiments, an ORF2 molecule comprises an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to an Alphatorquevirus, Betatorquevirus, or Gammatorquevirus ORF2 protein. In some embodiments, an ORF2 molecule (e.g., an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to an Alphatorquevirus ORF2 protein) has a length of 250 or fewer amino acids (e.g., about 150- 200 amino acids). In some embodiments, an ORF2 molecule (e.g., an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to a Betatorquevirus ORF2 protein) has a length of about 50-150 amino acids. In some embodiments, an ORF2 molecule (e.g., an ORF2 molecule having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to a Gammatorquevirus ORF2 protein) has a length of about 100-200 amino acids (e.g., about 100-150 amino acids). In some embodiments, the ORF2 molecule comprises a helix-turn-helix motif (e.g., a helix- turn-helix motif comprising two alpha helices flanking a turn region). In some embodiments, the ORF2 molecule does not comprise the amino acid sequence of the ORF2 protein of TTV isolate TA278 or TTV isolate SANBAN. In some embodiments, an ORF2 molecule has protein phosphatase activity. In some embodiments, an ORF2 molecule comprises at least one difference (e.g., a mutation, chemical modification, or epigenetic alteration) relative to a wild-type ORF2 protein, e.g., as described herein (e.g., as shown in Table A1-A3). Conserved ORF2 Motif In some embodiments, a polypeptide (e.g., an ORF2 molecule) described herein comprises the amino acid sequence [W / F]X7HX3CX1CX5H (SEQ ID NO: 949), wherein Xnis a contiguous sequence of any n amino acids. In embodiments, X7indicates a contiguous sequence of any seven amino acids. In some embodiments, X3indicates a contiguous sequence of any three amino acids. In some embodiments, X1indicates any single amino acid. In some embodiments, X5indicates a contiguous sequence of any five amino acids. In some embodiments, the [W / F] can be either tryptophan or phenylalanine. In some embodiments, the [W / F]X7HX3CX1CX5H (SEQ ID NO: 949) is comprised within the N22 domain of an ORF2 molecule, e.g., as described herein. In some embodiments, a genetic element described herein comprises a nucleic acid sequence (e.g., a nucleic acid sequence encoding an ORF2 molecule, e.g., as described herein) encoding the amino acid sequence [W / F]X7HX3CX1CX5H (SEQ ID NO: 949), wherein Xnis a contiguous sequence of any n amino acids. Genetic Elements In some embodiments, the Anelloviridae family vector (e.g., anellovector) comprises a genetic element. In some embodiments, the genetic element has one or more of the following characteristics: is substantially non-integrating with a host cell’s genome, is an episomal nucleic acid, is a single stranded DNA, is circular, is about 1 to 10 kb, exists within the nucleus of the cell, can be bound by endogenous proteins, produces an effector, such as a polypeptide or nucleic acid (e.g., an RNA, iRNA, microRNA) that targets a gene, activity, or function of a host or target cell. In one embodiment, the genetic element is a substantially non-integrating DNA. In some embodiments, the genetic element comprises a packaging signal, e.g., a sequence that binds a capsid protein. In some embodiments, outside of the packaging or capsid-binding sequence, the genetic element has less than 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5% sequence identity to a wild type Anellovirus nucleic acid sequence, e.g., has less than 70%, 60%, 50%, 40%, 30%, 20%, 10%, 5% sequence identity to an Anellovirus nucleic acid sequence, e.g., as described herein. In some embodiments, outside of the packaging or capsid-binding sequence, the genetic element has less than 500, 450, 400, 350, 300, 250, 200, 150, or 100 contiguous nucleotides that are at least 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to an Anellovirus nucleic acid sequence. In certain embodiments, the genetic element is a circular, single stranded DNA that comprises a promoter sequence, a sequence encoding a therapeutic effector, and a capsid binding protein. In some embodiments, the genetic element may comprise other sequences that include DNA, RNA, or artificial nucleic acids. In some embodiments, the genetic element has at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus nucleic acid sequence, e.g., as described herein (e.g., as described in any of Tables N1-N3), or a fragment thereof, or a reverse complement thereof, or encodes an amino acid sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus amino acid sequence (e.g., as described in any of Tables A1-A3), or a fragment thereof. In some embodiments, the genetic element comprises a sequence encoding an effector (e.g., an endogenous effector or an exogenous effector, e.g., a payload), e.g., a polypeptide effector (e.g., a protein) or nucleic acid effector (e.g., a non-coding RNA, e.g., a miRNA, siRNA, mRNA, lncRNA, RNA, DNA, an antisense RNA, gRNA). In some embodiments, the genetic element has a length less than 20kb (e.g., less than about 19kb, 18kb, 17kb, 16kb, 15kb, 14kb, 13kb, 12kb, 11kb, 10kb, 9kb, 8kb, 7kb, 6kb, 5kb, 4kb, 3kb, 2kb, 1kb, or less). In some embodiments, the genetic element has, independently or in addition to, a length greater than 1000b (e.g., at least about 1.1kb, 1.2kb, 1.3kb, 1.4kb, 1.5kb, 1.6kb, 1.7kb, 1.8kb, 1.9kb, 2kb, 2.1kb, 2.2kb, 2.3kb, 2.4kb, 2.5kb, 2.6kb, 2.7kb, 2.8kb, 2.9kb, 3kb, 3.1kb, 3.2kb, 3.3kb, 3.4kb, 3.5kb, 3.6kb, 3.7kb, 3.8kb, 3.9kb, 4kb, 4.1kb, 4.2kb, 4.3kb, 4.4kb, 4.5kb, 4.6kb, 4.7kb, 4.8kb, 4.9kb, 5kb, or greater). In some embodiments, the genetic element has a length of about 2.5-4.6, 2.8-4.0, 3.0-3.8, or 3.2-3.7 kb. In some embodiments, the genetic element has a length of about 1.5-2.0, 1.5-2.5, 1.5-3.0, 1.5-3.5, 1.5-3.8, 1.5-3.9, 1.5-4.0, 1.5-4.5, or 1.5-5.0 kb. In some embodiments, the genetic element has a length of about 2.0-2.5, 2.0-3.0, 2.0-3.5, 2.0-3.8, 2.0-3.9, 2.0-4.0, 2.0-4.5, or 2.0-5.0 kb. In some embodiments, the genetic element has a length of about 2.5-3.0, 2.5-3.5, 2.5-3.8, 2.5-3.9, 2.5-4.0, 2.5-4.5, or 2.5-5.0 kb. In some embodiments, the genetic element has a length of about 3.0-5.0, 3.5-5.0, 4.0-5.0, or 4.5-5.0 kb. In some embodiments, the genetic element has a length of about 1.5-2.0, 2.0-2.5, 2.5-3.0, 3.0-3.5, 3.1-3.6, 3.2-3.7, 3.3-3.8, 3.4-3.9, 3.5-4.0, 4.0-4.5, or 4.5-5.0 kb. In some embodiments, the genetic element comprises one or more of the features described herein, e.g., a sequence encoding a substantially non-pathogenic protein, a protein binding sequence, one or more sequences encoding a regulatory nucleic acid, one or more regulatory sequences, one or more sequences encoding a replication protein, and other sequences. In some embodiments, the substantially non-pathogenic protein comprises an amino acid sequence or a functional fragment thereof or a sequence having at least about 60%, 65%, 70%, 75%, 80%, 85%, 90% 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of the amino acid sequences described herein, an Anellovirus amino acid sequence, e.g., as listed in any of Tables A1-A3. In some embodiments, the double-stranded circular DNA and / or the genetic element does not comprise one or more plasmid elements (e.g., an origin of replication or a selectable marker, e.g., a resistance gene). In some embodiments, the double-stranded circular DNA and / or the genetic element does not comprise a plasmid backbone. In some embodiments, the double-stranded circular DNA and / or the genetic element does not comprise one or more bacterial plasmid elements (e.g., a bacterial origin of replication or a selectable marker, e.g., a bacterial resistance gene). In some embodiments, the double- stranded circular DNA and / or the genetic element does not comprise a bacterial plasmid backbone. In some embodiments, the double-stranded circular DNA and / or the genetic element does not comprise one or more mammalian plasmid elements (e.g., a mammalian origin of replication or a selectable marker, e.g., a mammalian resistance gene). In some embodiments, the double-stranded circular DNA and / or the genetic element does not comprise a mammalian plasmid backbone. In some embodiments, the double- stranded circular DNA and / or the genetic element does not comprise one or more insect plasmid elements (e.g., an insect origin of replication or a selectable marker, e.g., an insect resistance gene). In some embodiments, the double-stranded circular DNA and / or the genetic element does not comprise an insect plasmid backbone. In some embodiments, a genetic element as described herein comprises a sequence (e.g., a TATA box, cap site, transcriptional start site, 5’ UTR, open reading frame (ORF), poly(A) signal, or GC-rich region sequence) as listed in any of Tables A1, A3, A5, A7, A9, A11, B1-B5, 1, 3, 5, 7, 9, 11, 13, 15, or 17 of PCT Publication No. WO2020 / 123816 (incorporated herein by reference in its entirety), or a reverse complement thereof, or a sequence having at least 70% 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity thereto. In some embodiments, a genetic element comprises a sequence encoding an effector (e.g., an exogenous effector). In some embodiments, the effector-encoding sequence is inserted into an Anellovirus genome sequence (e.g., as described herein). In some embodiments, the effector-encoding sequence replaces a contiguous sequence (e.g., of at least 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, or more nucleotides) from the Anellovirus genome sequence. In some embodiments, the effector-encoding sequence replaces a TATA box, cap site, transcriptional start site, 5’ UTR, open reading frame (ORF), poly(A) signal, or GC-rich region sequence, or a portion thereof (e.g., a portion consisting of at least 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, or more nucleotides), e.g., as described herein, or a sequence having at least 70% 80%, 85%, 90% 95%, 96%, 97%, 98% and 99% nucleotide sequence identity thereto. In some embodiments, the sequence of a first nucleic acid element comprised in a genetic element (e.g., a TATA box, cap site, transcriptional start site, 5’ UTR, open reading frame (ORF), poly(A) signal, or GC-rich region) overlaps with the sequence of a second nucleic acid element (e.g., a TATA box, cap site, transcriptional start site, 5’ UTR, open reading frame (ORF), poly(A) signal, or GC-rich region), e.g., by at least 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, or 500 nucleotides. In some embodiments, the sequence of a first nucleic acid element comprised in a genetic element (e.g., a TATA box, cap site, transcriptional start site, 5’ UTR, open reading frame (ORF), poly(A) signal, or GC- rich region) does not overlap with the sequence of a second nucleic acid element (e.g., a TATA box, cap site, transcriptional start site, 5’ UTR, open reading frame (ORF), poly(A) signal, or GC-rich region). Protein Binding Sequence In some embodiments, the genetic element encodes a protein binding sequence that binds to the substantially non-pathogenic protein. In some embodiments, the protein binding sequence facilitates packaging the genetic element into the proteinaceous exterior. In some embodiments, the protein binding sequence specifically binds an arginine-rich region of the substantially non-pathogenic protein. In some embodiments, the genetic element comprises a protein binding sequence having at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a 5’ UTR conserved domain or GC-rich domain of an Anellovirus sequence (e.g., to the reverse complement of the sequence annotated in any of Tables N1-N3). In embodiments, the protein binding sequence has at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the 5’ UTR conserved domain nucleotide sequence of any of Tables N1-N3. In embodiments, the protein binding sequence has at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as the GC-rich domain nucleotide sequence of any of Tables N1-N3. 5’ UTR Conserved Domains A genetic element may include an Anellovirus 5’ UTR conserved domain. Typically, the negative strand comprising the Anellovirus 5’ UTR conserved domain is packaged into a particle (e.g., an Anelloviridae family vector as described herein. In some embodiments, the Anellovirus 5’ UTR conserved domain is a wild-type Anellovirus 5’ UTR conserved domain. In some embodiments, the Anellovirus 5’ UTR conserved domain is an engineered Anellovirus 5’ UTR conserved domain having a nucleic acid sequence with at least one difference relative to the closest wild-type Anellovirus 5’ UTR conserved domain sequence. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as 5’ UTR conserved domain nucleotide sequence of any of Tables N1-N3 or Table 38. Table 38. Exemplary 5’ UTR sequences from Anelloviruses.

[0003] Identification of 5’ UTR sequences In some embodiments, an Anelloviridae family virus (e.g., Anellovirus) 5’ UTR sequence can be identified within the genome of an Anelloviridae family virus (e.g., Anellovirus) (e.g., a putative Anelloviridae family virus genome identified, for example, by nucleic acid sequencing techniques, e.g., deep sequencing techniques). In some embodiments, an Anelloviridae family virus (e.g., Anellovirus) 5’ UTR sequence is identified by one or both of the following steps: (i) Identification of circularization junction point: In some embodiments, a 5’ UTR will be positioned near a circularization junction point of a full-length, circularized Anelloviridae family virus (e.g., Anellovirus) genome. A circularization junction point can be identified, for example, by identifying overlapping regions of the sequence. In some embodiments, an overlapping region of the sequence can be trimmed from the sequence to produce a full-length Anelloviridae family virus (e.g., Anellovirus) genome sequence that has been circularized. In some embodiments, a genome sequence is circularized in this manner using software. Without wishing to be bound by theory, computationally circularizing a genome may result in the start position for the sequence being oriented in a non-biological. Landmarks within the sequence can be used to re-orient sequences in the proper direction. For example, landmark sequence may include sequences having substantial homology to one or more elements within an Anelloviridae family virus (e.g., Anellovirus) genome as described herein (e.g., one or more of a TATA box, cap site, initiator element, transcriptional start site, 5’ UTR conserved domain, ORF1, ORF1 / 1, ORF1 / 2, ORF2, ORF2 / 2, ORF2 / 3, ORF2t / 3, three open-reading frame region, poly(A) signal, or GC-rich region of an Anelloviridae family virus (e.g., Anellovirus), e.g., as described herein). (ii) Identification of 5’ UTR sequence: Once a putative Anelloviridae family virus (e.g., Anellovirus) genome sequence has been obtained, the sequence (or portions thereof, e.g., having a length between about 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 nucleotides) can be compared to one or more Anelloviridae family virus (e.g., Anellovirus) 5’ UTR sequences (e.g., as described herein) to identify sequences having substantial homology thereto. In some embodiments, a putative Anelloviridae family virus (e.g., Anellovirus) 5’ UTR region has at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anelloviridae family virus (e.g., Anellovirus) 5’ UTR sequence as described herein. GC-Rich Regions A genetic element may include an Anellovirus GC-rich region. Typically, the negative strand comprising the Anellovirus GC-rich region is packaged into a particle (e.g., an Anelloviridae family vector as described herein. In some embodiments, the Anellovirus GC-rich region is a wild-type Anellovirus GC-rich region. In some embodiments, the Anellovirus GC-rich region is an engineered Anellovirus GC-rich region having a nucleic acid sequence with at least one difference relative to the closest wild-type Anellovirus GC-rich region sequence. In some embodiments, the Anellovirus GC-rich region comprises a contiguous sequence of at least 20, 25, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 consecutive nucleotides having a GC content of at least 70%, 75%, 80%, 85%, 90%, 95%, or 99%. In some embodiments, the genetic element comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse complement of the sequence annotated as GC-rich region nucleotide sequence of any of Tables N1-N3 or Table 39. Table 39. Exemplary GC-rich sequences from Anelloviruses.

[0004] Effectors In some embodiments, the genetic element encodes an effector, e.g., an exogenous effector. In some embodiments, the genetic element comprises a therapeutic expression sequence, e.g., a sequence that encodes an effector such as a therapeutic peptide or polypeptide, e.g., an intracellular peptide or intracellular polypeptide, a secreted polypeptide, or a protein replacement therapeutic. In some embodiments, the intracellular polypeptide is a cytosolic polypeptide, a regulatory intracellular peptide, or an anti-apoptotic agent. In some embodiments, the secreted polypeptide is a cytokine, a hormone, a growth factor, an antibody molecule that binds a hormone or a growth factor, a polypeptide that specifically binds to a VEGF, or a clotting-associated factor. In some embodiments, an effector described herein comprises an anti-VEGF antibody molecule. In some embodiments, the protein replacement therapeutic is an enzymatic effector, a non-enzymatic effector, erythropoietin, a micro-dystrophin, or a functional variant of a wild-type protein. In some embodiments, the genetic element includes a sequence encoding a protein e.g., a therapeutic protein. Some examples of therapeutic proteins may include, but are not limited to, a hormone, a cytokine, an enzyme, an antibody (e.g., one or a plurality of polypeptides encoding at least a heavy chain or a light chain), a transcription factor, a receptor (e.g., a membrane receptor), a ligand, a membrane transporter, a secreted protein, a peptide, a carrier protein, a structural protein, a nuclease, or a component thereof. Some examples of peptides include, but are not limited to, fluorescent tag or marker, antigen, peptide therapeutic, synthetic or analog peptide from naturally-bioactive peptide, agonist or antagonist peptide, anti-microbial peptide, a targeting or cytotoxic peptide, a degradation or self-destruction peptide, and degradation or self-destruction peptides. In some embodiments, the effector comprises a regeneration, repair, and fibrosis factor (e.g., a growth factor, an antibody or fragment thereof against such growth factors, or miRNAs that promote regeneration and repair). In some embodiments, the effector comprises a transformation factor (e.g., protein factors or miRNAs that transform fibroblasts into differentiated cells). In some embodiments, the effector comprises a protein that stimulates cellular regeneration. In some embodiments, the effector comprises a secreted STING modulator (e.g., a STING inhibitor or a STING activator). In some embodiments, the genetic element comprises an effector-encoding sequence. In some embodiments, the effector comprises a regulatory nucleic acid (e.g., miRNA, siRNA, mRNA, lncRNA, dsRNA, shRNA, RNA, DNA, an antisense RNA, or a gRNA). In some embodiments, the genetic element comprises a sequence that encodes small peptides, peptidomimetics (e.g., peptoids), amino acids, and amino acid analogs. In some embodiments, the effector mentioned in this section may also be a functional variant, homologue, or fragment thereof. In some embodiments, the genetic element comprises a sequence encoding an exogenous effector, e.g., as described in PCT publication No. WO / 2020 / 123753 pp.337-366, PCT publication No. WO / 2020 / 123773 pp.334-361, and PCT publication No. WO / 2020 / 123795 pp.333-358, each of which is incorporated by reference herein in its entirety. Chimeric Antigen Receptors (CARs) The present disclosure provides, in some embodiments, an Anelloviridae family vector (e.g., anellovector) encoding an exogenous effector, wherein the exogenous effector is a chimeric antigen receptor (CAR). The genetic element of the anellovector may encode the CAR. The genetic element may further comprise a promoter to drive expression of the CAR. A CAR may comprise at least an antigen binding domain (which is extracellular), a transmembrane domain, and a signaling domain (which is intracellular). In some embodiments, the antigen binding domain comprises an antibody molecule (e.g., an antibody or a functional fragment or variant thereof, e.g., an scFv). In some embodiments, the signaling domain comprises a primary signaling domain (e.g., a primary signaling domain of CD3-zeta). In some embodiments, the signaling domain comprises one or more signaling domains derived from at least one costimulatory molecule. In some embodiments, the CAR comprises a chimeric fusion protein comprising an antigen binding domain, a transmembrane domain and a signaling domain comprising a signaling domain derived from a stimulatory molecule. In some embodiments, the CAR comprises a chimeric fusion protein comprising an antigen binding domain, a transmembrane domain and a signaling domain comprising a signaling domain derived from a costimulatory molecule and a signaling domain derived from a stimulatory molecule. In some embodiments the CAR comprises an optional leader sequence at the amino-terminus of the CAR fusion protein, wherein the leader sequence is optionally cleaved from the antigen binding domain (e.g., a scFv) during cellular processing and localization of the CAR to the cellular membrane. In some embodiments the leader comprises a leader from CD8, or a functional variant thereof. The CAR may be, e.g., a first generation, second generation, or third generation CAR. In some embodiments, a first generation CAR comprises an antigen binding domain, a transmembrane domain, and a signaling domain. In some embodiments a signaling domain mediates downstream signaling during T-cell activation. In some embodiments a second generation CAR comprises an antigen binding domain, a transmembrane domain, and two signaling domains. In some embodiments the first signaling domain mediates downstream signaling during T-cell activation. In some embodiments the second signaling domain is a costimulatory domain. In some embodiments, a costimulatory domain enhances cytokine production, CAR T-cell proliferation, and or CAR T-cell persistence during T cell activation. In some embodiments, a third generation CAR comprises an antigen binding domain, a transmembrane domain, and at least three signaling domains. In some embodiments the first signaling domain mediates downstream signaling during T-cell activation. In some embodiments the second signaling domain is a costimulatory domain. In some embodiments, a costimulatory domain enhances cytokine production, CAR T-cell proliferation, and or CAR T-cell persistence during T cell activation. In some embodiments, a third generation CAR comprises at least two costimulatory domains. In some embodiments, the at least two costimulatory domains are not the same. In some embodiments, a CAR comprises one or more spacers. In some embodiments, a CAR comprises a spacer between the antigen binding domain and the transmembrane domain. In some embodiments, a CAR comprises a spacer between a transmembrane domain and a signaling domain. In some embodiments, the anellovector delivers the genetic element to a target cell or tissue, such that the target cell or tissue expresses the CAR. In some embodiments, the target cell that expresses the CAR is a T-cell. In some embodiments, the target tissue that expresses the CAR is a tissue comprising T- cells. In some embodiments, the target tissue that expresses the CAR is spleen tissue. In some embodiments, the anellovector delivers the genetic element to a target cell or tissue in vivo in a living subject. In some embodiments, the anellovector is administered systemically, e.g., by intravenous (IV) injection. CAR Antigen Binding Domains In some embodiments, a CAR comprises an antigen binding domain (a CAR antigen binding domain). In some embodiments, the CAR antigen binding domain binds a cancer associated antigen. Typically, the antigen binding domain is extracellular. In some embodiments, a CAR antigen binding domain is or comprises an antibody molecule (e.g., an antibody or a functional fragment, variant, or antigen-binding portion thereof). In some embodiments, a CAR antigen binding domain is or comprises an scFv or Fab. In some embodiments a CAR antigen binding domain (e.g., an antigen binding domain that comprises an scFv or Fab fragment) binds an antigen chosen from CD19 and BCMA. In some embodiments, the CAR antigen binding domain is an antigen-binding fragment of an antibody. Non-limiting examples of antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al. (1988) Science 242:423- 426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883); (viii) a single domain antibody. In some embodiments, the CAR antigen binding domain comprises a first VHH that binds a first epitope and a second VHH that binds a second epitope. In some embodiments the antigen bound by the CAR is a molecule (typically a protein, carbohydrate or lipid) that is expressed on the surface of a cell, either entirely or as a fragment (e.g., MHC / peptide). In some embodiments a CAR antigen binding domain binds an antigen characteristic of an infectious disease (e.g. a viral infection or a bacterial infection). In some embodiments a CAR antigen binding domain binds an antigen characteristic of an autoimmune or inflammatory disorder. CAR Transmembrane and Hinge Domains In some embodiments, a CAR comprises a transmembrane domain (a “CAR transmembrane domain”). In some embodiments, the transmembrane domain comprises a hydrophobic alpha helix. In some embodiments a CAR comprises a transmembrane region of CD8 or CD28, or a functional variant thereof. In some embodiments, a CAR comprises a hinge domain between the transmembrane domain and the antigen binding domain. In some embodiments, a CAR comprises a hinge domain of CD8 or CD28, or a functional variant thereof. CAR Intracellular Domains In some embodiments, a CAR comprises a signaling domain (a “CAR signaling domain”) in an intracellular domain. In some embodiments, the signaling domain is a functional portion of a protein which acts by transmitting information within a cell to regulate cellular activity via defined signaling pathways. In some embodiments, a CAR comprises a signaling domain that induces or promotes activation of a cell that expresses the CAR. In some embodiments a CAR comprises a signaling domain of CD3- zeta or a functional variant thereof. In some embodiments a CAR comprises a signaling domain which is a costimulatory domain. In some embodiments a CAR comprises a second costimulatory domain. In some embodiments a CAR comprises a costimulatory domain selected from 4-1BB or CD28, or a functional variant thereof. Regulatory Sequences In some embodiments, the genetic element comprises a regulatory sequence, e.g., a promoter or an enhancer, operably linked to the sequence encoding the effector. In some embodiments, a promoter includes a DNA sequence that is located adjacent to a DNA sequence that encodes an expression product. A promoter may be linked operatively to the adjacent DNA sequence. A promoter typically increases an amount of product expressed from the DNA sequence as compared to an amount of the expressed product when no promoter exists. A promoter from one organism can be utilized to enhance product expression from the DNA sequence that originates from another organism. For example, a vertebrate promoter may be used for the expression of jellyfish GFP in vertebrates. In addition, one promoter element can increase an amount of products expressed for multiple DNA sequences attached in tandem. Hence, one promoter element can enhance the expression of one or more products. Multiple promoter elements are well-known to persons of ordinary skill in the art. In some embodiments, a native promoter for a gene or nucleic acid sequence of interest is used. The native promoter may be used when it is desired that expression of the gene or the nucleic acid sequence should mimic the native expression. The native promoter may be used when expression of the gene or other nucleic acid sequence must be regulated temporally or developmentally, or in a tissue- specific manner, or in response to specific transcriptional stimuli. In a further embodiment, other native expression control elements, such as enhancer elements, polyadenylation sites or Kozak consensus sequences may also be used to mimic the native expression. In one embodiment, high-level constitutive expression is desired. Examples of such promoters include, without limitation, the retroviral Rous sarcoma virus (RSV) long terminal repeat (LTR) promoter / enhancer, the cytomegalovirus (CMV) immediate early promoter / enhancer (see, e.g., Boshart et al, Cell, 41:521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the cytoplasmic .beta.-actin promoter and the phosphoglycerol kinase (PGK) promoter. In another embodiment, inducible promoters may be desired. Inducible promoters are those which are regulated by exogenously supplied compounds, either in cis or in trans. Other types of inducible promoters which may be useful in this context are those which are regulated by a specific physiological state, e.g., temperature, acute phase, or in replicating cells only. In some embodiments, the genetic element comprises a gene operably linked to a tissue-specific promoter. The genetic element may include an enhancer, e.g., a DNA sequence that is located adjacent to the DNA sequence that encodes a gene. Enhancer elements are typically located upstream of a promoter element or can be located downstream of or within a coding DNA sequence (e.g., a DNA sequence transcribed or translated into a product or products). Hence, an enhancer element can be located 100 base pairs, 200 base pairs, or 300 or more base pairs upstream or downstream of a DNA sequence that encodes the product. Enhancer elements can increase an amount of recombinant product expressed from a DNA sequence above increased expression afforded by a promoter element. Multiple enhancer elements are readily available to persons of ordinary skill in the art. Surface Moieties An Anelloviridae family vector as described herein may, in some instances, include one or more moieties attached to its surface (e.g., a surface moiety that can act as an effector and / or a targeting agent). In some instances, an Anelloviridae family vector comprises more than one distinct surface moiety (e.g., a first surface moiety having an effector function as described herein and a second surface moiety that targets the Anelloviridae family vector to a cell or tissue of interest). In some instances, the surface moiety is covalently attached to the surface of the Anelloviridae family vector. For example, the surface moiety may be covalently attached to the proteinaceous exterior or a component thereof (e.g., covalently attached to an ORF1 molecule of the proteinaceous exterior). In certain embodiments, the surface moiety is fused to an ORF1 molecule. In some instances, the surface moiety is noncovalently attached to the surface of the Anelloviridae family vector. For example, the surface moiety may be noncovalently bound to the proteinaceous exterior or a component thereof (e.g., noncovalently bound to an ORF1 molecule of the proteinaceous exterior). In certain embodiments, the surface moiety comprises a region that specifically binds to a cognate moiety on or attached to the ORF1 molecule. In an embodiment, the ORF1 molecule comprises a binding moiety (e.g., an antibody molecule) that specifically recognizes an epitope on the region on the surface moiety. In an embodiment, the surface moiety comprises a binding moiety (e.g., an antibody molecule) that specifically recognizes an epitope on the ORF1 molecule. The surface moiety can, in some instances, comprise a polypeptide. The surface moiety may, in some instances, comprise a nucleic acid molecule (e.g., DNA and / or RNA). The surface moiety may, in some instances, comprise a small molecule. In some instances, a surface moiety comprises an antigen (e.g., an antigen recognized by the immune system of a subject to be delivered the Anelloviridae family vector). In some instances, a surface moiety as described herein comprises a ligand (e.g., a ligand that binds specifically to a receptor on a target cell). In some instances, the surface moiety comprises an effector function (e.g., as described herein). For example, the surface moiety may modulate a biological activity, e.g., of a target cell or organ. In some instances, the surface moiety induces modulation of the biological activity via binding to a cognate moiety on a target cell. For example, the surface moiety may comprise a ligand that binds to a receptor on the surface of the target cell, e.g., wherein binding of the surface moiety to the receptor initiates a downstream signaling cascade of interest. In some instances, the effector activity comprises increasing or decreasing enzymatic activity, gene expression, cell signaling, and / or cellular or organ function within a target cell or organ. Effector activities may also include binding regulatory proteins to modulate activity of the regulator, such as transcription or translation. Effector activities also may include activator or inhibitor functions. In some instances, the surface moiety can target the Anelloviridae family vector to a target cell. For example, the surface moiety may specifically bind to a cognate moiety on the surface of the target cell. The cognate moiety on the surface of the target cell may be, for example, a molecule specifically expressed or preferentially expressed by the target cell. The cognate moiety may be, for example, a polypeptide, lipid, sugar, or small molecule. In certain embodiments, the cognate moiety is a transmembrane protein (e.g., comprising an extracellular domain that binds to the surface moiety of the Anelloviridae family vector). In certain embodiments, the cognate moiety is tethered to the surface of the cell (e.g., via a GPI anchor). In some instances, the surface moiety provides a tropism (e.g., to a target tissue or target cell type) for the Anelloviridae family vector. In an aspect, the disclosure provides an ORF1 molecule comprising: (i) the amino acid sequence of an Anellovirus ORF1 protein, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto; and (ii) a click handle (e.g., an NHS click handle or a maleimide click handle, e.g., as described herein). In certain embodiments, the click handle is covalently attached to the ORF1 molecule. In certain embodiments, the click handle is noncovalently attached to the ORF1 molecule. In certain embodiments, the click handle is used to attach the ORF1 molecule to a surface moiety, e.g., via a click reaction, e.g., as described herein. A “click handle,” as that term is used herein, refers to a chemical moiety that is capable of reacting with a second click handle in a click reaction. In some embodiments, a click handle comprises an NHS moiety and / or a maleimide moiety. In certain embodiments, a click handle comprises a DBCO moiety. In certain embodiments, a click handle comprises an azide moiety. In some embodiments, a click handle is attached to a polypeptide (e.g., an ORF1 molecule). In other embodiments, a click handle comprises a reactive group capable of forming a covalent bond with a polypeptide (e.g., an ORF1 molecule). A “click reaction”, as that term is used herein, refers to a range of reactions used to covalently link a first and a second moiety, for convenient production of linked products. It typically has one or more of the following characteristics: it is fast, is specific, is high-yield, is efficient, is spontaneous, does not significantly alter biocompatibility of the linked entities, has a high reaction rate, produces a stable product, favors production of a single reaction product, has high atom economy, is chemoselective, is modular, is stereoselective, is insensitive to oxygen, is insensitive to water, is high purity, generates only inoffensive or relatively non-toxic byproducts that can be removed by nonchromatographic methods (e.g., crystallization or distillation), needs no solvent or can be performed in a solvent that is benign or physiologically compatible, e.g., water, stable under physiological conditions. Examples include an alkyne / azide reaction, a diene / dienophile reaction, or a thiol / alkene reaction. Other reactions can be used. II. Compositions and Methods for Making Anelloviridae Family Vectors The present disclosure provides, in some aspects, Anelloviridae family vectors (e.g., anellovectors) and methods thereof for delivering effectors. In some embodiments, the Anelloviridae family vectors (e.g., anellovectors) or components thereof can be made as described below. In some embodiments, the compositions and methods described herein can be used to produce a genetic element or a genetic element construct. In some embodiments, the compositions and methods described herein can be used to produce one or more Anelloviridae family virus capsid proteins (e.g., Anellovirus ORF) molecules (e.g., an ORF1, ORF2, ORF2 / 2, ORF2 / 3, ORF1 / 1, or ORF1 / 2molecule, or a functional fragment or splice variant thereof). In some embodiments, the compositions and methods described herein can be used to produce a proteinaceous exterior or a component thereof (e.g., an ORF1 molecule), e.g., in a host cell. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or components thereof can be made using a tandem construct, e.g., as described in PCT Publication No. WO 2021252955, which is incorporated herein by reference in its entirety. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or components thereof (e.g., an Anelloviridae family polypeptide, e.g., an ORF1, ORF2, ORF2 / 2, ORF2 / 3, ORF1 / 1, and / or ORF1 / 2 molecule, or a functional fragment or splice variant thereof) can be made using a bacmid / insect cell system, e.g., as described as described in PCT Publication No. WO 2021 / 252943, which is incorporated herein by reference in its entirety. Methods of producing an anellovector using a host cell are described, for example, below in the section entitled “Host Cells and Methods of Using Host Cells for Producing an Anellovector”. Method of producing an anellovector in a cell-free system are described, for example, below in the section entitled “In vitro assembly methods”. Without wishing to be bound by theory, rolling circle amplification may occur via Rep protein binding to a Rep binding site (e.g., comprising a 5’ UTR, e.g., comprising a hairpin loop and / or an origin of replication, e.g., as described herein) positioned 5’ relative to (or within the 5’ region of) the genetic element region. The Rep protein may then proceed through the genetic element region, resulting in the synthesis of the genetic element. The genetic element may then be circularized and then encapsulated within a proteinaceous exterior to form an Anelloviridae family vector (e.g., anellovector). Genetic Element Constructs, e.g., for assembly of Anelloviridae family vectors In some methods of making as described herein, the genetic element is made using a genetic element construct, wherein the genetic element construct can act as a template for the production of the genetic element. In some embodiments, a genetic element construct comprises a genetic element region and optionally other sequence such as vector backbone. A genetic element construct may be any nucleic acid construct suitable for delivery of the sequence of the genetic element into a host cell in which the genetic element can be encapsulated within a proteinaceous exterior. In some embodiments, the genetic element construct comprises a promoter. In some embodiments, the genetic element construct is a linear nucleic acid molecule. In some embodiments, the genetic element construct is a circular nucleic acid molecule (e.g., a plasmid, viral nucleic acid, bacmid, artificial chromosome, or a minicircle, e.g., as described herein). In some embodiments, a step of in vitro circularization may be used in producing a genetic element, e.g., as described herein. In embodiments, the double-stranded circular nucleic acid construct (e.g., minicircle) can be introduced into a host cell, in which it can be converted into or used as a template for generating single-stranded circular genetic elements, e.g., as described herein. In some embodiments, the genetic element is generated by a polymerase based on a template sequence in the nucleic acid construct. In some embodiments, the polymerase produces a single-stranded copy of the genetic element sequence, which can optionally be circularized to form a genetic element as described herein. The genetic element construct may, in some embodiments, be double-stranded. In some embodiments, the genetic element construct comprises RNA. In some embodiments, the genetic element construct comprises one or more modified nucleotides. Tandem Constructs In some embodiments, a genetic element construct comprises a first copy of a genetic element sequence (e.g., the nucleic acid sequence of a genetic element, e.g., as described herein) and at least a portion of a second copy of a genetic element sequence (e.g., the nucleic acid sequence of the same genetic element, or the nucleic acid sequence of a different genetic element), arranged in tandem. Genetic element constructs having such a structure are generally referred to herein as tandem constructs. Such tandem constructs are used for producing an Anelloviridae family vector (e.g., anellovector) genetic element. The first copy of the genetic element sequence and the second copy of the genetic element sequence may, in some instances, be immediately adjacent to each other on the genetic acid construct. In other instances, the first copy of the genetic element sequence and the second copy of the genetic element sequence may be separated, e.g., by a spacer sequence. Without being bound by theory, a tandem construct described herein may, in some embodiments, replicate by rolling circle replication. In some embodiments, a tandem construct is a plasmid. In some embodiments, a tandem construct is circular. In some embodiments, a tandem construct is linear. In some embodiments, a tandem construct is single- stranded. In some embodiments, a tandem construct is double-stranded. In some embodiments, a tandem construct is DNA. In some embodiments, a tandem construct comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus 5’ UTR conserved domain, e.g., as described herein (e.g., as described in any of Tables N1- N3), or a fragment thereof, or a reverse complement thereof. In some embodiments, a tandem construct comprises a nucleic acid sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus GC-rich region, e.g., as described herein (e.g., as described in any of Tables N1-N3), or a fragment thereof, or a reverse complement thereof. In some embodiments, a tandem construct comprises a nucleic acid sequence encoding an amino acid sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF1, e.g., as described herein (e.g., as described in any of Tables N1-N3), or a fragment thereof. In some embodiments, a tandem construct comprises a nucleic acid sequence encoding an amino acid sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF2, e.g., as described herein (e.g., as described in any of Tables N1-N3), or a fragment thereof. In some embodiments, a tandem construct comprises a nucleic acid sequence encoding an amino acid sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an Anellovirus ORF3, e.g., as described herein (e.g., as described in any of Tables N1-N3), or a fragment thereof. In some embodiments, a tandem construct comprises the sequence of SEQ ID NO: 504, or a sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 504, or a reverse complement thereof. In some embodiments, a tandem construct comprises the sequence of SEQ ID NO: 1126, or a sequence having at least about 70%, 75%, 80%, 8%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to SEQ ID NO: 1126, or a reverse complement thereof. Additional descriptions of tandem constructs that can be used with the invention are described, for example, PCT Publication No. WO 2021252955, incorporated herein by reference in its entirety. Cis / Trans Constructs In some embodiments, a genetic element construct as described herein comprises one or more sequences encoding one or more Anelloviridae family virus ORFs, e.g., proteinaceous exterior components (e.g., polypeptides encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein). For example, the genetic element construct may comprise a nucleic acid sequence encoding an Anellovirus ORF1 molecule. Such genetic element constructs can be suitable for introducing the genetic element and the Anelloviridae family virus ORF(s) into a host cell in cis. In other embodiments, a genetic element construct as described herein does not comprise sequences encoding one or more Anelloviridae family virus ORFs, e.g., proteinaceous exterior components (e.g., polypeptides encoded by an Anellovirus ORF1 nucleic acid, e.g., as described herein). For example, the genetic element construct may not comprise a nucleic acid sequence encoding an Anellovirus ORF1 molecule. Such genetic element constructs can be suitable for introducing the genetic element into a host cell, with the one or more Anelloviridae family virus ORFs to be provided in trans (e.g., via introduction of a second nucleic acid construct encoding one or more of the Anelloviridae family virus ORFs, or via an Anelloviridae family virus ORF cassette integrated into the genome of the host cell). In some embodiments, an ORF1 molecule is provided in trans, e.g., as described herein. In some embodiments, an ORF2 molecule is provided in trans, e.g., as described herein. In some embodiments, an ORF1 molecule and an ORF2 molecule are both provided in trans, e.g., as described herein. In some embodiments, the genetic element construct comprises a sequence encoding an Anellovirus ORF1 molecule, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein). In embodiments, the portion of the genetic element that does not comprise the sequence of the genetic element comprises the sequence encoding the Anellovirus ORF1 molecule, or splice variant or functional fragment thereof (e.g., in a cassette comprising a promoter and the sequence encoding the Anellovirus ORF1 molecule, or splice variant or functional fragment thereof). In further embodiments, the portion of the construct comprising the sequence of the genetic element comprises a sequence encoding an Anellovirus ORF1 molecule, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein). In embodiments, encapsulation of such a genetic element in a proteinaceous exterior (e.g., as described herein) produces a replication-component Anelloviridae family vector (e.g., anellovector) (e.g., an Anelloviridae family vector that upon infecting a cell, enables the cell to produce additional copies of the anellovector without introducing further nucleic acid constructs, e.g., encoding one or more Anelloviridae family virus ORFs as described herein, into the cell). In other embodiments, the genetic element does not comprise a sequence encoding an Anellovirus ORF1 molecule, or a splice variant or functional fragment thereof (e.g., a jelly-roll region, e.g., as described herein). In embodiments, encapsulation of such a genetic element in a proteinaceous exterior (e.g., as described herein) produces a replication-incompetent Anelloviridae family vector (e.g., anellovector) (e.g., an Anelloviridae family vector that, upon infecting a cell, does not enable the infected cell to produce additional Anelloviridae family vector, e.g., in the absence of one or more additional constructs, e.g., encoding one or more Anellovirus ORFs as described herein). Recombinase-based production of genetic elements and Anellovectors A genetic element for an Anelloviridae family vector (e.g., an anellovector) may be produced via site-specific recombination of a genetic element construct to produce a circular nucleic acid molecule comprising the genetic element sequence. In some embodiments, the circular nucleic acid molecule is a double-stranded DNA minicircle. In some embodiments, the circular nucleic acid molecule is in turn converted to a circular single-stranded DNA molecule, which can in turn serve as the genetic element of an Anelloviridae family vector (e.g., an anellovector) as described herein. Generally, the genetic element construct comprises a set of recombinase recognition sequences flanking the sequence of a genetic element of an Anelloviridae family vector. The recombinase recognition sites may be recognized by a site-specific recombinase. The remainder of the genetic element construct may, in some instances, comprise a vector backbone comprising elements for replication of the construct in a cell, such as a mammalian cell. Contacting the genetic element construct with the site-specific recombinase (e.g., in a host cell) may result in excision of the genetic element sequence from the remainder of the construct and the formation of two circular nucleic acid molecules, one comprising the genetic element sequence and the other comprising the remainder of the vector backbone. In some embodiments, the circular nucleic acid molecule (e.g., a minicircle) comprising the genetic element sequence is converted to cssDNA in the host cell (e.g., a mammalian host cell), and is then encapsulated in a proteinaceous exterior comprising ORF1 molecules (e.g., as described herein) to produce an Anelloviridae family vector. In some embodiments, a site specific recombinase-based system for producing genetic elements comprises three plasmids: (1) a first plasmid (e.g., a vector plasmid) comprising the sequence of the genetic element, flanked by a pair of recombinase recognition sites; (2) an expression plasmid comprising a cassette encoding a site-specific recombinase (e.g., as described herein) capable of recognizing the recombinase recognition sites; and (3) a plasmid (e.g., a self-replicating rescue (SRR) plasmid) providing one or more Anelloviridae family viral proteins (e.g., Anellovirus ORF1, ORF3, and / or ORF3 molecules), including a capsid protein (e.g., an ORF1 molecule, e.g., as described herein). In some embodiments, a site specific recombinase-based system for producing genetic elements comprises two plasmids: (1) a first plasmid (e.g., a vector plasmid) comprising the sequence of the genetic element, flanked by a pair of recombinase recognition sites; and (2) a second plasmid (e.g., a self- replicating rescue (SRR) plasmid) providing one or more Anelloviridae family viral proteins (e.g., Anellovirus ORF1, ORF3, and / or ORF3 molecules), including a capsid protein (e.g., an ORF1 molecule , e.g., as described herein). Self-replicating rescue (SRR) constructs (e.g., SRR plasmids) In some embodiments, a rescue construct can be used to provide one or more Anelloviridae family viral proteins, or functional fragments or variants thereof (e.g., one or more of Anellovirus ORF1, ORF2, and / or ORF3 molecules). In some embodiments, the rescue construct is capable of self-replicating in a host cell (e.g., a self-replicating rescue (SRR) plasmid). In some embodiments, the SRR plasmid can be used in the site-specific recombinase based systems. In some embodiments, the rescue construct includes an expression cassette comprising the protein coding sequence of an Anelloviridae family virus (e.g., an Anellovirus as described herein), or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the rescue construct includes a sequence encoding a replication protein (e.g., a large T antigen, a PCV Rep, or a PCV Rep’), or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the rescue construct includes an exogenous origin of replication (e.g., a viral origin, e.g., an SV40, PCV, or AAV origin). In certain embodiments, the replication protein coding sequence is downstream of an internal ribosome entry site (IRES) positioned downstream of the expression cassette comprising the protein coding sequence of the Anelloviridae family virus. In certain embodiments, the replication protein coding sequence is comprised in a separate cassette from the expression cassette comprising the protein coding sequence of the Anelloviridae family virus. In some embodiments, the rescue construct further comprises one or more additional expression cassettes, e.g., encoding a site-specific recombinase, an Anelloviridae family viral protein (e.g., an Anellovirus ORF1 molecule), a replication protein and / or viral origin (e.g., as described herein), or another transgene of interest. In some embodiments, the rescue construct comprises a single expression cassette (e.g., as described above). In some embodiments, the rescue construct comprises two expression cassettes. In some embodiments, the rescue construct comprises three expression cassettes. In some embodiments, the rescue construct comprises four expression cassettes. In some embodiments, the rescue construct comprises five or more expression cassettes. The exemplary expression cassettes described herein can be positioned in any order within the rescue construct. In some embodiments, one or more of the expression cassettes is in the opposite orientation relative to one or more of the other expression cassettes. In other embodiments, all of the expression cassettes in a rescue construct are in the same orientation relative to each other. In some embodiments, the rescue construct does not contain an Anellovirus NCR sequence (e.g. does not contain an Anellovirus 5’ NCR sequence and / or an Anellovirus 3’ NCR sequence). In some embodiments, the rescue construct does not comprise an Anellovirus 5’ UTR conserved domain. In some embodiments, the rescue construct does not comprise an Anellovirus GC-rich region. In some embodiments, the rescue construct does not contain Anellovirus sequences homologous to the vector plasmid (e.g., a contiguous sequence of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, 400, or 500 nucleotides having sequence identity to any Anellovirus sequence of the same length in the vector plasmid). Exemplary SV40 Large T Antigen amino acid sequence: MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKK MEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHS TPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNS YNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEH DFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHE KHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGS ADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELC GGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKV NLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIA LLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDE DSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPT PPPEPET (SEQ ID NO: 1101) Exemplary site-specific recombinases and recombinase recognition sites The recombinase-based systems described herein utilize site-specific recombinases to induce recombination of vector plasmids at recombinase recognition sites, thereby producing double-stranded DNA molecules (e.g., minicircles) comprising the sequence between the recombinase recognition sites (e.g., comprising the sequence of a genetic element for an Anelloviridae family vector as described herein). In some embodiments, the site-specific recombinase comprises a Cre recombinase (e.g., as described herein, e.g., in Table V2), or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the site-specific recombinase comprises the amino acid sequence of Cre as listed in Table V2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the site- specific recombinase comprises the amino acid sequence of SV40-NLS-iCre as listed in Table V2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, at least one (e.g., one or both) of the recombinase recognition sites comprises a lox66 site as listed in Table V3, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, at least one (e.g., one or both) of the recombinase recognition sites comprises a lox71 site as listed in Table V3, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, a circular double-stranded nucleic acid molecule (e.g., minicircle) produced after a Cre recombination event (e.g., as described herein) comprises a loxP site as listed in Table V3, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, a circular double-stranded nucleic acid molecule (e.g., minicircle) produced after a Cre recombination event (e.g., as described herein) comprises a lox72 site as listed in Table V3, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the site-specific recombinase comprises a Bxb1 recombinase (e.g., as described herein, e.g., in Table V2), or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the site-specific recombinase comprises the amino acid sequence of Bxb1 as listed in Table V2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In some embodiments, the site-specific recombinase comprises the amino acid sequence of SV40-NLS-HA_Bxb1 as listed in Table V2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, at least one of the recombinase recognition sites comprises an attB site as listed in Table V4, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, at least one of the recombinase recognition sites comprises an attP site as listed in Table V4, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, one recombinase recognition site comprises an attB site as listed in Table V4, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and the other recombinase recognition site comprises an attP site as listed in Table V4, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, a circular double-stranded nucleic acid molecule (e.g., minicircle) produced after a Bxb1 recombination event (e.g., as described herein) comprises an attL site as listed in Table V4, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. In certain embodiments, a circular double-stranded nucleic acid molecule (e.g., minicircle) produced after a Bxb1 recombination event (e.g., as described herein) comprises an attR site as listed in Table V4, or a nucleic acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. Table V2. Exemplary site-specific recombinase polypeptides i Table V3. Exemplary recombinase recognition sequences and recombinase hybrid sites for Cre recombinases llll Table V4. Exemplary recombinase recognition sequences for Bxb1 recombinases

[0005] As used herein, the term “recombinase hybrid site” refers to a DNA site having a sequence that, when in double stranded form, is capable of being produced by a site-specific recombinase that recombines two recombinase recognition sites. No particular process of making is implied: a recombinase hybrid site can be produced by a site specific recombinase or another method, such as DNA replication of an existing sequence. In some embodiments, a single stranded DNA that comprises a recombinase hybrid site was produced by a method wherein a site-specific recombinase generated a double stranded DNA comprising a recombinase hybrid site, followed by conversion of the double stranded DNA to a single stranded DNA. In some embodiments (e.g., with Cre recombinase) the recombinase hybrid site has the same sequence as one of the corresponding recombinase recognition sites. In some embodiments (e.g., with Bxb1 recombinase), the recombinase hybrid site has a different site from either of the two corresponding recombinase recognition sites. In some embodiments, the recombinase hybrid site is a loxP site, an attL site, or an attR site. As used herein, the term “recombinase recognition site” refers to a DNA site having a sequence that is capable of being recognized by a site-specific recombinase and recombined with a second recombinase recognition site, thereby producing a recombinase hybrid site. In some embodiments, the two recombinase recognition sites recognized by the recombinase have the same sequence, and in other emobdiments, they have different seuqences. In some embodiments, the recombinase recognition site is a loxP site, an attB site, or an attP site. Host Cells and Methods of Using Host Cells for Producing an Anellovector The Anelloviridae family vector (e.g., anellovector) described herein can be produced, for example, in a host cell. Generally, a host cell is provided that comprises an Anelloviridae family vector (e.g., anellovector) genetic element and the components of an Anelloviridae family vector (e.g., anellovector) proteinaceous exterior (e.g., a polypeptide encoded by an Anellovirus ORF1 nucleic acid, or an Anellovirus ORF1 molecule). For example, in some embodiments, the host cell comprises a nucleic acid sequence encoding an Anellovirus ORF1 molecule, e.g., a splice variant or a functional fragment of an Anellovirus ORF1 polypeptide (e.g., a wild-type Anellovirus ORF1 protein or a polypeptide encoded by a wild-type Anellovirus ORF1 nucleic acid, e.g., as described herein). In embodiments, the nucleic acid sequence encoding the Anellovirus ORF1 molecule is comprised in a nucleic acid construct (e.g., a plasmid, viral vector, virus, minicircle, bacmid, or artificial chromosome) comprised in the host cell. In embodiments, the nucleic acid sequence encoding the Anellovirus ORF1 molecule is integrated into the genome of the host cell. Producing an Anelloviridae family vector (e.g. anellovector) using the compositions or methods described herein may also involve expression of an Anellovirus ORF2 molecule (e.g., as described herein), or a splice variant or functional fragment thereof. In some embodiments, the anellovector does not comprise an ORF2 molecule, or a splice variant or functional fragment thereof, and / or a nucleic acid encoding an ORF2 molecule, or a splice variant or functional fragment thereof. In some embodiments, producing the anellovector comprises expression of an ORF2 molecule, or a splice variant or functional fragment thereof, but the ORF2 molecule is expressed from a nucleic acid other than Anelloviridae family vector. The host cell is then incubated under conditions suitable for enclosure of the genetic element within the proteinaceous exterior (e.g., culture conditions as described herein). In some embodiments, the host cell is further incubated under conditions suitable for release of the Anelloviridae family vector (e.g., anellovector) from the host cell, e.g., into the surrounding supernatant. In some embodiments, the host cell is lysed for harvest of Anelloviridae family vector (e.g., anellovector) from the cell lysate. In some embodiments, an Anelloviridae family vector (e.g., anellovector) may be introduced to a host cell line grown to a high cell density. In some embodiments, a host cell is an Expi-293 cell. In an aspect, the present disclosure provides a host cell (e.g., as described herein). In some embodiments, the host or host cell is a plant, insect, bacteria, fungus, vertebrate, mammal (e.g., human), or other organism or cell. Introduction of genetic elements into host cells The genetic element, or a nucleic acid construct comprising the sequence of a genetic element, may be introduced into a host cell. In some embodiments, the genetic element itself is introduced into the host cell. In some embodiments, a genetic element construct comprising the sequence of the genetic element (e.g., as described herein) is introduced into the host cell. A genetic element or genetic element construct can be introduced into a host cell, for example, using methods known in the art. For example, a genetic element or genetic element construct can be introduced into a host cell by transfection (e.g., stable transfection or transient transfection). In embodiments, the genetic element or genetic element construct is introduced into the host cell by lipofectamine transfection. In embodiments, the genetic element or genetic element construct is introduced into the host cell by calcium phosphate transfection. In some embodiments, the genetic element or genetic element construct is introduced into the host cell by electroporation. In some embodiments, the genetic element or genetic element construct is introduced into the host cell using a gene gun. In some embodiments, the genetic element or genetic element construct is introduced into the host cell by nucleofection. In some embodiments, the genetic element or genetic element construct is introduced into the host cell by PEI transfection. In some embodiments, the genetic element is introduced into the host cell by contacting the host cell with an Anelloviridae family vector (e.g., anellovector) comprising the genetic element. In some embodiments, cells are suspended in 2S Chica buffers. In embodiments, the genetic element construct is capable of replication once introduced into the host cell. In embodiments, the genetic element can be produced from the genetic element construct once introduced into the host cell. In some embodiments, the genetic element is produced in the host cell by a polymerase, e.g., using the genetic element construct as a template. In some embodiments, the genetic elements or vectors comprising the genetic elements are introduced (e.g., transfected) into cell lines that express a viral polymerase protein in order to achieve expression of the Anelloviridae family vector (e.g., anellovector). To this end, cell lines that express an Anelloviridae family vector (e.g., anellovector) polymerase protein may be utilized as appropriate host cells. Host cells may be similarly engineered to provide other viral functions or additional functions. To prepare the Anelloviridae family vector (e.g., anellovector) disclosed herein, a genetic element construct may be used to transfect cells that provide Anelloviridae family vector (e.g., anellovector) proteins and functions required for replication and production. Alternatively, cells may be transfected with a second construct (e.g., a virus) providing Anelloviridae family vector (e.g., anellovector) proteins and functions before, during, or after transfection by the genetic element or vector comprising the genetic element disclosed herein. In some embodiments, the second construct may be useful to complement production of an incomplete viral particle. The second construct (e.g., virus) may have a conditional growth defect, such as host range restriction or temperature sensitivity, e.g., which allows the subsequent selection of transfectant viruses. In some embodiments, the second construct may provide one or more replication proteins utilized by the host cells to achieve expression of the Anelloviridae family vector (e.g., anellovector). In some embodiments, the host cells may be transfected with vectors encoding viral proteins such as the one or more replication proteins. In some embodiments, the second construct comprises an antiviral sensitivity. The genetic element or vector comprising the genetic element disclosed herein can, in some instances, be replicated and produced into Anelloviridae family vectors (e.g., anellovectors) using techniques known in the art. For example, various viral culture methods are described, e.g., in U.S. Pat. No.4,650,764; U.S. Pat. No.5,166,057; U.S. Pat. No.5,854,037; European Patent Publication EP 0702085A1; U.S. patent application Ser. No.09 / 152,845; International Patent Publications PCT WO97 / 12032; WO96 / 34625; European Patent Publication EP-A780475; WO 99 / 02657; WO 98 / 53078; WO 98 / 02530; WO 99 / 15672; WO 98 / 13501; WO 97 / 06270; and EPO 78047SA1, each of which is incorporated by reference herein in its entirety. Exemplary cell types Exemplary host cells suitable for production of Anelloviridae family vector (e.g., anellovector) include, without limitation, mammalian cells, e.g., human cells and insect cells. In some embodiments, the host cell is a human cell or cell line. In some embodiments, the cell is an immune cell or cell line, e.g., a T cell or cell line, a cancer cell line, a hepatic cell or cell line, a neuron, a glial cell, a skin cell, an epithelial cell, a mesenchymal cell, a blood cell, an endothelial cell, an eye cell (e.g., a photoreceptor cell, a retinal cell, a cell of the posterior eye cup (PEC), retinal ganglion cell, a cell of the optic nerve, a cell of the optic nerve head, or a retinal pigmented epithelium (RPE) cell), a gastrointestinal cell, a progenitor cell, a precursor cell, a stem cell, a lung cell, a cardiac cell, or a muscle cell. In some embodiments, the host cell is an animal cell (e.g., a mouse cell, rat cell, rabbit cell, or hamster cell, or insect cell). In some embodiments, the host cell is a human cell. In embodiments, the host cell is a HEK293T cell, HEK293F cell, A549 cell, Jurkat cell, Raji cell, Chang cell, HeLa cell Phoenix cell, MRC-5 cell, NCI-H292 cell, or Wi38 cell. In some embodiments, the host cell is a non-human primate cell (e.g., a Vero cell, CV-1 cell, or LLCMK2 cell). In some embodiments, the host cell is a murine cell (e.g., a McCoy cell). In some embodiments, the host cell is a hamster cell (e.g., a CHO cell or BHK 21 cell). In some embodiments, the host cell is a MARC-145, MDBK, RK-13, or EEL cell. In some embodiments, the host cell is an epithelial cell (e.g., a cell line of epithelial lineage). In some embodiments, the host cell is a lymphoid cell. In some embodiments, the host cell is a T cell or an immortalized T cell. In embodiments, the host cell is a Jurkat cell. In embodiments, the host cell is a MOLT cell (e.g., a MOLT-4 or a MOLT-3 cell). In embodiments, the host cell is a MOLT-4 cell. In embodiments, the host cell is a MOLT-3 cell. In some embodiments, the host cell is an acute lymphoblastic leukemia (ALL) cell, e.g., a MOLT cell, e.g., a MOLT-4 or MOLT-3 cell. In some embodiments, the host cell is a B cell or an immortalized B cell. In some embodiments, the host cell comprises a genetic element construct (e.g., as described herein). In some embodiments, the host cell is a MOLT cell (e.g., a MOLT-4 or a MOLT-3 cell). In some embodiments, the host cell is an acute lymphoblastic leukemia (ALL) cell, e.g., a MOLT cell, e.g., a MOLT-4 or MOLT-3 cell. In some embodiments, the host cell is a 293 cell (e.g., a HEK293 cell, a HEK293T cell, or an Expi-293 cell). In some embodiments, the host cell is an Expi-293F cell. In an aspect, the present disclosure provides a method of manufacturing an Anelloviridae family vector (e.g., anellovector) comprising a genetic element enclosed in a proteinaceous exterior, the method comprising providing a Expi-293 cell comprising an Anelloviridae family vector (e.g., anellovector) genetic element, and incubating the Expi-293 cell under conditions that allow the Anelloviridae family vector (e.g., anellovector) genetic element to become enclosed in a proteinaceous exterior in the Expi-293 cell. In some embodiments, the Expi-293 cell further comprises one or more Anellovirus proteins (e.g., an Anellovirus ORF1 molecule) that form part or all of the proteinaceous exterior. In some embodiments, the Anelloviridae family vector (e.g., anellovector) genetic element is produced in the Expi-293 cell, e.g., from a genetic element construct (e.g., as described herein). In some embodiments, the method further comprises introducing the Anelloviridae family vector (e.g., anellovector) genetic element construct into the Expi-293 cell. In an aspect, the present disclosure provides a method of manufacturing an Anelloviridae family vector (e.g., anellovector) comprising a genetic element enclosed in a proteinaceous exterior, the method comprising providing a MOLT-4 cell comprising an Anelloviridae family vector (e.g., anellovector) genetic element, and incubating the MOLT-4 cell under conditions that allow the Anelloviridae family vector (e.g., anellovector) genetic element to become enclosed in a proteinaceous exterior in the MOLT-4 cell. In some embodiments, the MOLT-4 cell further comprises one or more Anellovirus proteins (e.g., an Anellovirus ORF1 molecule) that form part or all of the proteinaceous exterior. In some embodiments, the Anelloviridae family vector (e.g., anellovector) genetic element is produced in the MOLT-4 cell, e.g., from a genetic element construct (e.g., as described herein). In some embodiments, the method further comprises introducing the Anelloviridae family vector (e.g., anellovector) genetic element construct into the MOLT-4 cell. In an aspect, the present disclosure provides a method of manufacturing an Anelloviridae family vector (e.g., anellovector) comprising a genetic element enclosed in a proteinaceous exterior, the method comprising providing a MOLT-3 cell comprising an Anelloviridae family vector (e.g., anellovector) genetic element, and incubating the MOLT-3 cell under conditions that allow the Anelloviridae family vector (e.g., anellovector) genetic element to become enclosed in a proteinaceous exterior in the MOLT-3 cell. In some embodiments, the MOLT-3 cell further comprises one or more Anellovirus proteins (e.g., an Anellovirus ORF1 molecule) that form part or all of the proteinaceous exterior. In some embodiments, the Anelloviridae family vector (e.g., anellovector) genetic element is produced in the MOLT-3 cell, e.g., from a genetic element construct (e.g., as described herein). In some embodiments, the method further comprises introducing the Anelloviridae family vector (e.g., anellovector) genetic element construct into the MOLT-3 cell. In some embodiments, the Anelloviridae family vector (e.g., anellovector) is cultivated in continuous animal cell line (e.g., immortalized cell lines that can be serially propagated). Culture Conditions Host cells comprising a genetic element and components of a proteinaceous exterior can be incubated under conditions suitable for enclosure of the genetic element within the proteinaceous exterior, thereby producing an Anelloviridae family vector (e.g., anellovector). In some embodiments, the host cells are incubated in liquid media (e.g., Grace’s Supplemented (TNM-FH), IPL-41, TC-100, Schneider’s Drosophila, SF-900 II SFM, or and EXPRESS-FIVE™ SFM). In some embodiments, the host cells are incubated in adherent culture. In some embodiments, the host cells are incubated in suspension culture. In some embodiments, the host cells are incubated in a tube, bottle, microcarrier, or flask. In some embodiments, the host cells are incubated in a dish or well (e.g., a well on a plate). In some embodiments, the host cells are incubated under conditions suitable for proliferation of the host cells. In some embodiments, the host cells are incubated under conditions suitable for the host cells to release Anelloviridae family vectors (e.g., anellovectors) produced therein into the surrounding supernatant. The production of Anelloviridae family vector (e.g., anellovector)-containing cell cultures according to the present invention can be carried out in different scales (e.g., in flasks, roller bottles or bioreactors). The media used for the cultivation of the cells to be infected generally comprise the standard nutrients required for cell viability, but may also comprise additional nutrients dependent on the cell type. Optionally, the medium can be protein-free and / or serum-free. Depending on the cell type the cells can be cultured in suspension or on a substrate. In some embodiments, different media is used for growth of the host cells and for production of Anelloviridae family vectors (e.g., anellovectors). Harvest Anelloviridae family vectors (e.g., anellovectors) produced by host cells can be harvested, e.g., according to methods known in the art. For example, Anelloviridae family vectors (e.g., anellovectors) released into the surrounding supernatant by host cells in culture can be harvested from the supernatant. In some embodiments, the supernatant is separated from the host cells to obtain the Anelloviridae family vectors (e.g., anellovectors). In some embodiments, the host cells are lysed before or during harvest. In some embodiments, the Anelloviridae family vectors (e.g., anellovectors) are harvested from the host cell lysates. In some embodiments, the Anelloviridae family vectors (e.g., anellovectors) are harvested from both the host cell lysates and the supernatant. In some embodiments, the purification and isolation of Anelloviridae family vectors (e.g., anellovectors) is performed according to known methods in virus production, for example, as described in Rinaldi, et al., DNA Vaccines: Methods and Protocols (Methods in Molecular Biology), 3rd ed.2014, Humana Press (incorporated herein by reference in its entirety). In some embodiments, the Anelloviridae family vector (e.g., anellovector) may be harvested and / or purified by separation of solutes based on biophysical properties, e.g., ion exchange chromatography or tangential flow filtration, prior to formulation with a pharmaceutical excipient. In vitro assembly methods An Anelloviridae family vector (e.g., anellovector) may be produced, e.g., by in vitro assembly, e.g., in a cell-free suspension or in a supernatant. In some embodiments, the genetic element is contacted to an ORF1 molecule in vitro, e.g., under conditions that allow for assembly. In some embodiments, baculovirus constructs are used to produce Anelloviridae family virus (e.g., Anellovirus) proteins. These proteins may then be used, e.g., for in vitro assembly to encapsulate a genetic element, e.g., a genetic element comprising RNA. In some embodiments, a polynucleotide encoding one or more Anelloviridae family virus (e.g., Anellovirus) protein is fused to a promoter for expression in a host cell, e.g., an insect or animal cell. In some embodiments, the polynucleotide is cloned into a baculovirus expression system. In some embodiments, a host cell, e.g., an insect cell is infected with the baculovirus expression system and incubated for a period of time. In some embodiments, an infected cell is incubated for about 1, 2, 3, 4, 5, 10, 15, or 20 days. In some embodiments, an infected cell is lysed to recover the Anelloviridae family virus (e.g., Anellovirus) protein. In some embodiments, an isolated Anelloviridae family virus (e.g., Anellovirus) protein is purified. In some embodiments, an Anellovirus protein is purified using purification techniques including but not limited to chelating purification, heparin purification, gradient sedimentation purification, and / or SEC purification. In some embodiments, a purified Anelloviridae family virus (e.g., Anellovirus) protein is mixed with a genetic element to encapsulate the genetic element, e.g., a genetic element comprising RNA. In some embodiments, a genetic element is encapsulated using an ORF1 protein, ORF2 protein, or modified version thereof. In some embodiments two nucleic acids are encapsulated. For instance, the first nucleic acid may be an mRNA e.g., chemically modified mRNA, and the second nucleic acid may be DNA. In some embodiments, DNA encoding Anellovirus (AV) ORF1 (e.g., wildtype ORF1 protein, ORF1 proteins harboring mutations, e.g., to improve assembly efficiency, yield or stability, chimeric ORF1 protein, or fragments thereof) are expressed in insect cell lines (e.g., Sf9 and / or HighFive), animal cell lines (e.g., chicken cell lines (MDCC)), bacterial cells (e.g., E. coli) and / or mammalian cell lines (e.g., 293expi and / or MOLT4). In some embodiments, DNA encoding AV ORF1 may be untagged. In some embodiments, DNA encoding AV ORF1 may contain tags fused N-terminally and / or C-terminally. In some embodiments, DNA encoding AV ORF1 may harbor mutations, insertions or deletions within the ORF1 protein to introduce a tag, e.g., to aid in purification and / or identity determination, e.g., through immunostaining assays (including but not limited to ELISA or Western Blot). In some embodiments, DNA encoding AV ORF1 may be expressed alone or in combination with any number of helper proteins. In some embodiments, DNA encoding AV ORF1 is expressed in combination with AV ORF2 and / or ORF3 proteins. In some embodiments, ORF1 proteins harboring mutations to improve assembly efficiency may include, but are not limited to, ORF1 proteins that harbor mutations introduced into the N-terminal Arginine Arm (ARG arm) to alter the pI of the ARG arm permitting pH sensitive nucleic acid binding to trigger particle assembly. In some embodiments, ORF1 proteins harboring mutations that improve stability may include mutations to an interprotomer contacting beta strands F and G of the canonical jellyroll beta-barrel to alter hydrophobic state of the protomer surface and improve thermodynamic favorability of capsid formation. In some embodiments, the present disclosure describes a method of making an anellovector, the method comprising: (a) providing a mixture comprising: (i) a genetic element, and (ii) an ORF1 molecule and (b) incubating the mixture under conditions suitable for encapsulating the genetic element within a proteinaceous exterior comprising the ORF1 molecule, thereby making an anellovector; optionally wherein the mixture is not comprised in a cell. In some embodiments, the method further comprises, prior to the providing of (a), expressing the ORF1 molecule, e.g., in a host cell (e.g., an insect cell or a mammalian cell). In some embodiments, the expressing comprises incubating a host cell (e.g., an insect cell or a mammalian cell) comprising a nucleic acid molecule (e.g., a baculovirus expression vector) encoding the ORF1 molecule under conditions suitable for producing the ORF1 molecule. In some embodiments, the method further comprises, prior to the providing of (a), purifying the ORF1 molecule expressed by the host cell. In some embodiments, the method is performed in a cell-free system. In some embodiments, the present disclosure describes a method of manufacturing an anellovector composition, comprising: (a) providing a plurality of anellovectors or compositions according to any of the preceding embodiments; (b) optionally evaluating the plurality for one or more of: a contaminant described herein, an optical density measurement (e.g., OD 260), particle number (e.g., by HPLC), infectivity (e.g., particle:infectious unit ratio, e.g., as determined by fluorescence and / or ELISA); and (c) formulating the plurality of anellovectors, e.g., as a pharmaceutical composition suitable for administration to a subject, e.g., if one or more of the parameters of (b) meet a specified threshold. In vitro circularization In some instances, the genetic element to be packaged into a proteinaceous exterior is a single stranded circular DNA. In some embodiments, double-stranded circular DNA is produced by in vitro circularization, e.g., as described in Example 35 of PCT Publication No. WO 2020 / 123816, incorporated by reference herein in its entirety. Generally, in vitro circularized DNA constructs can be produced by digesting a plasmid comprising the sequence of a genetic element to be packaged, such that the genetic element sequence is excised as a linear DNA molecule. The resultant linear DNA can then be ligated, e.g., using a DNA ligase, to form a double-stranded circular DNA. In some embodiments, the double- stranded DNA construct is smaller than a plasmid. In some embodiments, the double-stranded DNA construct is excised from a plasmid and then circularized, e.g., by in vitro circularization. In some embodiments, a genetic element to be used for in vitro assembly of a particle (e.g., an anellovector) as described herein is produced in a cell. In some embodiments, a cell is transfected with a construct (e.g., a plasmid, tandem construct, and / or an in vitro circularized nucleic acid molecule, e.g., as described herein) comprising the sequence of a genetic element. In embodiments, the cell is incubated under conditions suitable for replication of the construct. In embodiments, the cell is incubated under conditions suitable for production and / or replication of the genetic element (e.g., from the construct). In embodiments, the cell is lysed to recover the genetic element. In some embodiments, a genetic element to be used for in vitro assembly is a DNA, e.g., a single-stranded DNA (ssDNA). In embodiments, the genetic element is a negative sense ssDNA. In some embodiments, a genetic element to be used for in vitro assembly comprises RNA (e.g., an mRNA). Enrichment and purification Harvested Anelloviridae family vectors can be purified and / or enriched, e.g., to produce an anellovector preparation. In some embodiments, the harvested anellovectors are isolated from other constituents or contaminants present in the harvest solution, e.g., using methods known in the art for purifying viral particles (e.g., purification by sedimentation, chromatography, and / or ultrafiltration). In some embodiments, the purification steps comprise removing one or more of serum, host cell DNA, host cell proteins, particles lacking the genetic element, and / or phenol red from the preparation. In some embodiments, the harvested Anelloviridae family vectors are enriched relative to other constituents or contaminants present in the harvest solution, e.g., using methods known in the art for enriching viral particles. In some embodiments, the resultant preparation or a pharmaceutical composition comprising the preparation will be stable over an acceptable period of time and temperature, and / or be compatible with the desired route of administration and / or any devices this route of administration will require, e.g., needles or syringes. III. Pharmaceutical Compositions The Anelloviridae family vector, anellovector, or other vector described herein may also be included in pharmaceutical compositions with a pharmaceutical excipient, e.g., as described herein. In some embodiments, the pharmaceutical composition comprises at least 105, 106, 107, 108, 109, 1010, 1011, 1012, 1013, 1014, or 1015Anelloviridae family vectors. In some embodiments, the pharmaceutical composition comprises about 105-1015, 105-1010, or 1010-1015Anelloviridae family vectors. In some embodiments, the pharmaceutical composition comprises about 108(e.g., about 105, 106, 107, 108, 109, or 1010) genomic equivalents / mL of the Anelloviridae family vector. In some embodiments, the pharmaceutical composition comprises 105-1010, 106-1010, 107-1010, 108-1010, 109-1010, 105-106, 105-107, 105-108, 105-109, 105-1011, 105-1012, 105-1013, 105-1014, 105-1015, or 1010-1015genomic equivalents / mL of the Anelloviridae family vector. In some embodiments, the pharmaceutical composition comprises sufficient Anelloviridae family vectors to deliver at least 1, 2, 5, or 10, 100, 500, 1000, 2000, 5000, 8,000, 1 x 104, 1 x 105, 1 x 106, 1 x 107or greater copies of a genetic element comprised in the Anelloviridae family vectors per cell to a population of the eukaryotic cells. In some embodiments, the pharmaceuticalcomposition comprises sufficient Anelloviridae family vectors to deliver at least about 1 x 104, 1 x 105, 1x 106, 1 x or 107, or about 1 x 104-1 x 105, 1 x 104-1 x 106, 1 x 104-1 x 107, 1 x 105-1 x 106, 1 x 105-1 x 107, or 1 x 106-1 x 107copies of a genetic element comprised in the Anelloviridae family vectors per cell to a population of the eukaryotic cells. In some embodiments, the pharmaceutical composition has one or more of the following characteristics: the pharmaceutical composition meets a pharmaceutical or good manufacturing practices (GMP) standard; the pharmaceutical composition was made according to good manufacturing practices (GMP); the pharmaceutical composition has a pathogen level below a predetermined reference value, e.g., is substantially free of pathogens; the pharmaceutical composition has a contaminant level below a predetermined reference value, e.g., is substantially free of contaminants; or the pharmaceutical composition has low immunogenicity or is substantially non-immunogenic, e.g., as described herein. In some embodiments, the pharmaceutical composition comprises below a threshold amount of one or more contaminants. Exemplary contaminants that are desirably excluded or minimized in the pharmaceutical composition include, without limitation, host cell nucleic acids (e.g., host cell DNA and / or host cell RNA), animal-derived components (e.g., serum albumin or trypsin), replication- competent viruses, non-infectious particles, free viral capsid protein, adventitious agents, and aggregates. In embodiments, the contaminant is host cell DNA. In embodiments, the composition comprises less than about 10 ng of host cell DNA per dose. In embodiments, the level of host cell DNA in the composition is reduced by filtration and / or enzymatic degradation of host cell DNA. In embodiments, the pharmaceutical composition consists of less than 10% (e.g., less than about 10%, 5%, 4%, 3%, 2%, 1%, 0.5%, or 0.1%) contaminant by weight. In one aspect, the invention described herein includes a pharmaceutical composition comprising: a) an Anelloviridae family vector (e.g., anellovector) comprising a genetic element comprising (i) a sequence encoding a non-pathogenic exterior protein, (ii) an exterior protein binding sequence that binds the genetic element to the non-pathogenic exterior protein, and (iii) a sequence encoding a regulatory nucleic acid; and a proteinaceous exterior that is associated with, e.g., envelops or encapsulates, the genetic element; and b) a pharmaceutical excipient. IV. Methods of Use The Anelloviridae family vectors, e.g., anellovectors, and compositions comprising Anelloviridae family vectors, e.g., anellovectors, described herein may be used in methods of treating a disease, disorder, or condition, e.g., in a subject (e.g., a mammalian subject, e.g., a human subject) in need thereof. Administration of a pharmaceutical composition described herein may be, for example, by way of parenteral (including intravenous, intratumoral, intraperitoneal, intramuscular, intracavity, and subcutaneous) administration. In some embodiments, an Anelloviridae family vector, e.g., anellovector, or pharmaceutical composition as described herein is administered subretinally. In some embodiments, an Anelloviridae family vector, e.g., anellovector, or pharmaceutical composition as described herein is administered intravitreally. In some embodiments, an Anelloviridae family vector, e.g., anellovector, or pharmaceutical composition as described herein is administered suprachoroidally. The anellovectors may be administered alone or formulated as a pharmaceutical composition. In some embodiments, an Anelloviridae family vector as described herein may be used in a method of treating a disease or disorder. In certain embodiments, the Anelloviridae family vector as described herein may be used in a method of treating a cancer (e.g., a solid tumor or a liquid tumor). In certain embodiments, the Anelloviridae family vector as described herein (e.g., an anellovector encoding a BCMA CAR) may be used in a method of treating myeloma, e.g., relapsed / refractory multiple myeloma. In certain embodiments, the Anelloviridae family vector as described herein (e.g., an anellovector encoding a CD19 CAR) may be used in a method of treating lymphoma, e.g., B-cell acute lymphocytic leukemia, relapsed / refractory diffuse large B-cell lymphoma, follicular lymphoma, relapsed / refractory mantle cell lymphoma, relapsed / refractory B-cell precursor acute lymphocytic leukemia, or relapsed / refractory large B-cell lymphoma. The Anelloviridae family vector (e.g., anellovector) may be administered in the form of a unit- dose composition, such as a unit dose parenteral composition. Such compositions are generally prepared by admixture and can be suitably adapted for parenteral administration. Such compositions may be, for example, in the form of injectable and infusible solutions or suspensions or suppositories or aerosols. In some embodiments, administration of an Anelloviridae family vector (e.g., anellovector) or composition comprising same, e.g., as described herein, may result in delivery of a genetic element comprised by the Anelloviridae family vector (e.g., anellovector) to a target cell, e.g., in a subject. In some embodiments, the Anelloviridae family vector (e.g., anellovector), or copies thereof, are detectable in a cell 24 hours (e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 30 days, or 1 month) after delivery into a cell. In embodiments, an Anelloviridae family vector (e.g., anellovector) or composition thereof mediates an effect on a target cell, and the effect lasts for at least 1, 2, 3, 4, 5, 6, or 7 days, 2, 3, or 4 weeks, or 1, 2, 3, 6, or 12 months. In some embodiments (e.g., wherein the Anelloviridae family vector (e.g., anellovector) or composition thereof comprises a genetic element encoding an exogenous protein), the effect lasts for less than 1, 2, 3, 4, 5, 6, or 7 days, 2, 3, or 4 weeks, or 1, 2, 3, 6, or 12 months. Tissue-specific delivery of Anelloviridae family vectors An Anelloviridae family vector (e.g., anellovector) or composition thereof described herein, e.g., comprising or encoding an effector (e.g., an endogenous or exogenous effector), may be used to selectively deliver the effector to a cell or tissue of interest. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to spleen, ovary, lymph node, lung, liver, kidney, bone marrow, skeletal muscle, or a tissue thereof. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the spleen. In certain embodiments, Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a splenic tissue. For example, the Anelloviridae family vector (e.g., anellovector) or composition thereof may be used to deliver the effector to the white pulp or the red pulp of the spleen. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the spleen. In certain embodiments, use of the Anelloviridae family vector (e.g., anellovector) or composition thereof to deliver the effector to a spleen tissue comprises delivery of the effector to immune cells within the spleen (e.g., B cells and / or T cells). In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the ovary. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to an ovarian tissue (e.g., epithelial tissue or mesenchymal tissue of the ovary). In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the ovary. In certain embodiments the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to an ovarian follicle. In certain embodiments the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to an oocyte. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a lymph node. In certain embodiments, Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a capsule of the lymph node. In certain embodiments, Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a sinus of the lymph node. In certain embodiments, Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a cortex of the lymph node. In certain embodiments, Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a medulla of the lymph node. In certain embodiments, use of the Anelloviridae family vector (e.g., anellovector) or composition thereof to deliver the effector to a lymph node tissue comprises delivery of the effector to immune cells within the lymph node (e.g., B cells and / or T cells). In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the lymph node. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the lung. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to alveoli of the lung. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of bronchi of the lung. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of a respiratory epithelium of the lung. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the lung. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the liver. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to hepatocytes. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the liver. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the kidney. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the lobes of the kidney. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the nephrons of the kidney. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the kidney. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the bone marrow. In certain embodiments, use of the Anelloviridae family vector (e.g., anellovector) or composition thereof to deliver the effector to a bone marrow tissue comprises delivery of the effector to immune cells within the bone marrow (e.g., B cells and / or T cells). In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to hematopoietic cells within the bone marrow. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to adipose tissue within the bone marrow. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the skeletal muscle. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a connective tissue of the skeletal muscle. In certain embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to myocytes of the skeletal muscle. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to the eye of a subject, e.g., a mammalian subject, e.g., a human subject. In some embodiments, the Anelloviridae family vector (e.g., anellovector) or composition thereof is used to deliver the effector to a cell of the eye of a subject, e.g., a mammalian subject, e.g., a human subject. In certain embodiments, the cell of the eye is a photoreceptor cell, a retinal cell, a cell of the posterior eye cup (PEC), retinal ganglion cell, a cell of the optic nerve, a cell of the optic nerve head, or a retinal pigmented epithelium (RPE) cell. Delivery of an effector by administration of an Anelloviridae family vector (e.g., anellovector) composition described herein may modulate (e.g., increase or decrease) expression levels of a noncoding RNA or polypeptide in the cell, tissue, or subject. Modulation of expression level in this fashion may result in alteration of a functional activity in the cell to which the effector is delivered. In some embodiments, the modulated functional activity may be enzymatic, structural, or regulatory in nature. In some embodiments, the effector is a therapeutic effector, e.g., wherein the modulated functional activity is treating or preventing a disease or disorder, or a symptom thereof. V. Redosing The Anelloviridae family vector (e.g., anellovector) as described herein can, in some instances, be used as a delivery vehicle that can be administered in multiple doses (e.g., doses administered separately). While not wishing to be bound by theory, in some embodiments, an Anelloviridae family vector (e.g., anellovector) (e.g., as described herein) induces a relatively low immune response (as measured, for example, as 50% GMT values), e.g., allowing for repeated dosing of a subject with one or more Anelloviridae family vectors (e.g., anellovectors) (e.g., multiple doses of the same Anelloviridae family vector (e.g., anellovector) or different Anelloviridae family vectors (e.g., anellovectors)). In an aspect, the invention provides a method of delivering an effector, comprising administering to a subject a first plurality of Anelloviridae family vectors (e.g., anellovectors) and then a second plurality of Anelloviridae family vectors (e.g., anellovectors). In some embodiments, the second plurality of Anelloviridae family vectors (e.g., anellovectors) comprise the same proteinaceous exterior as the Anelloviridae family vectors (e.g., anellovectors) of the first plurality. In some embodiments, the Anelloviridae family vector (e.g., anellovector) administered in multiple doses (e.g., in the first plurality or the second plurality) delivers an effector (e.g., an exogenous effector) to spleen tissue, ovary tissue, lymph node tissue, skeletal muscle tissue, lung tissue, liver tissue, kidney tissue, or bone marrow tissue. In some embodiments, the Anelloviridae family vector (e.g., anellovector) administered in multiple doses (e.g., in the first plurality or the second plurality) is administered to the subject systemically (e.g., by intravenous (IV) injection). In some embodiments, the administration of the second plurality of Anelloviridae family vectors (e.g., anellovectors) results in increased copies of the genetic element relative to the copies of the genetic element delivered by the first plurality of Anelloviridae family vectors (e.g., anellovectors). In some embodiments, administration of the second plurality of Anelloviridae family vectors (e.g., anellovectors) results in detection of the genetic element or the exogenous effector at levels of at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 fold higher than detection of the genetic element or the exogenous effector after administration of the first plurality of Anelloviridae family vectors (e.g., anellovectors). In another aspect, the invention provides a method of selecting a subject (e.g., a human subject) to receive an effector, wherein the subject previously received, or was identified as having received, a first plurality of Anelloviridae family vectors (e.g., anellovectors) comprising a genetic element encoding an effector, in which the method involves selecting the subject to receive a second plurality of Anelloviridae family vectors (e.g., anellovectors) comprising a genetic element encoding an effector (e.g., the same effector as that encoded by the genetic element of the first plurality of Anelloviridae family vectors (e.g., anellovectors), or a different effector as that encoded by the genetic element of the first plurality of Anelloviridae family vectors (e.g., anellovectors)). In another aspect, the invention provides a method of identifying a subject (e.g., a human subject) as suitable to receive a second plurality of Anelloviridae family vectors (e.g., anellovectors), the method comprising identifying the subject has having previously received a first plurality of Anelloviridae family vectors (e.g., anellovectors) comprising a genetic element encoding an effector, wherein the subject being identified as having received the first plurality of Anelloviridae family vectors (e.g., anellovectors) is indicative that the subject is suitable to receive the second plurality of Anelloviridae family vectors (e.g., anellovectors). All references and publications cited herein are hereby incorporated by reference. The following examples are provided to further illustrate some embodiments of the present invention, but are not intended to limit the scope of the invention; it will be understood by their exemplary nature that other procedures, methodologies, or techniques known to those skilled in the art may alternatively be used. EXAMPLES Table of Contents Example 1: Anellovector production for intravenous administration Example 2: Intravenous (IV) administration with an Anellovector Example 3: Wild type and Anellovector production for redosing and intravenous administration Example 4: Redosing and intravenous (IV) administration of an Anellovector Example 5: Wild-type production for intravenous administration Example 6: Intravenous (IV) administration with an Anellovector Example 7: Detection of Ring19-eGFP in CD45+ and CD3+ cells Example 1: Anellovector production for intravenous administration This example describes the production of the Anellovector and AAV control vector used below for intravenous administration into animals. AAV2-fCMV-eGFP control AAV2-fCMV-eGFP is an adeno-associated virus based on the plasmid pRTx-2770 (SEQ ID NO: 501) with a payload comprising from the 5’ to 3’ direction an AAV2 ITR, Ring25’ NCR, CMV promoter, eGFP, SV40pA, Ring23’ NCR, and AAV2 ITR (Table Z6). The payload was packaged into AAV2 by Packgene Biotech Inc (Houston, Texas). Prior to injection, AAV2-fCMV-eGFP was diluted in sterile 1X PBS to the desired titer. Table Z6. pRTx-2770 Name pRTx-2770 Type Plasmid Length 5128 bp 1 GTCAGTGAGC GAGGAAGCGG AAGAGCGCCC AATACGCAAA CCGCCTCTCC CCGCGCGTTG 61 GCCGATTCAT TAATGCAGCT GGCACGACAG GTTTCCCGAC TGGAAAGCGG GCAGTGAGCG 121 CAACGCAATT AATGTGAGTT AGCTCACTCA TTAGGCACCC CAGGCTTTAC ACTTTATGCT 181 TCCGGCTCGT ATGTTGTGTG GAATTGTGAG CGGATAACAA TTTCACACAG GAAACAGCTA 241 TGACCATGAT TACGCCAAGC TTGCATGCCC TGCAGGCAGC TGCGCGCTCG CTCGCTCACT 301 GAGGCCGCCC GGGCAAAGCC CGGGCGTCGG GCGACCTTTG GTCGCCCGGC CTCAGTGAGC 361 GAGCGAGCGC GCAGAGAGGG AGTGGCCAAC TCCATCACTA GGGGTTCCTG CGAAAGATAT 421 CTAATAAATA TTCAACAGGA AAACCACCTA ATTTAAATTG CCGACCACAA ACCGTCACTT 481 AGTTCCCCTT TTTGCAACAA CTTCTGCTTT TTTCCAACTG CCGGAAAACC ACATAATTTG 541 CATGGCTAAC CACAAACTGA TATGCTAATT AACTTCCACA AAACAACTTC CCCTTTTAAA 601 ACCACACCTA CAAATTAATT ATTAAACACA GTCACATCCT GGGAGGTACT ACCACACTAT 661 AATACCAAGT GCTAATCCGA ATGGCTGAGT TTATGCCGCT AGACGGAGAA CGCATCAGTT 721 ACTGACTGCG GACTGAACTT GGGCGGGTGC CGAAGGTGAG TGAAACCACC GAAGTCAAGG 781 GGCAATTCGG GCTAGTTCAG TCTAGCGGAA CGGGCAAGAA ACTTAAAATT ATTTTATTTT 841 TCAGATGGAT GGCTGATCGA GTGTAGCCAG ATCTGCGATC GACATTGATT ATTGACTAGT 901 TATTAATAGT AATCAATTAC GGGGTCATTA GTTCATAGCC CATATATGGA GTTCCGCGTT 961 ACATAACTTA CGGTAAATGG CCCGCCTGGC TGACCGCCCA ACGACCCCCG CCCATTGACG 1021 TCAATAATGA CGTATGTTCC CATAGTAACG CCAATAGGGA CTTTCCATTG ACGTCAATGG 1081 GTGGAGTATT TACGGTAAAC TGCCCACTTG GCAGTACATC AAGTGTATCA TATGCCAAGT 1141 ACGCCCCCTA TTGACGTCAA TGACGGTAAA TGGCCCGCCT GGCATTATGC CCAGTACATG 1201 ACCTTATGGG ACTTTCCTAC TTGGCAGTAC ATCTACGTAT TAGTCATCGC TATTACCATG 1261 GTGATGCGGT TTTGGCAGTA CATCAATGGG CGTGGATAGC GGTTTGACTC ACGGGGATTT 1321 CCAAGTCTCC ACCCCATTGA CGTCAATGGG AGTTTGTTTT GGCACCAAAA TCAACGGGAC 1381 TTTCCAAAAT GTCGTAACAA CTCCGCCCCA TTGACGCAAA TGGGCGGTAG GCGTGTACGG 1441 TGGGAGGTCT ATATAAGCAG AGCTCTCTGG CTAACTGGAT CTACAAAAAA GCAGATCCAC 1501 CGGTCGCCAC CATGGTGAGC AAGGGCGAGG AGCTGTTCAC CGGGGTGGTG CCCATCCTGG 1561 TCGAGCTGGA CGGCGACGTA AACGGCCACA AGTTCAGCGT GTCCGGCGAG GGCGAGGGCG 1621 ATGCCACCTA CGGCAAGCTG ACCCTGAAGT TCATCTGCAC CACCGGCAAG CTGCCCGTGC 1681 CCTGGCCCAC CCTCGTGACC ACCCTGACCT ACGGCGTGCA GTGCTTCAGC CGCTACCCCG 1741 ACCACATGAA GCAGCACGAC TTCTTCAAGT CCGCCATGCC CGAAGGCTAC GTCCAGGAGC 1801 GCACCATCTT CTTCAAGGAC GACGGCAACT ACAAGACCCG CGCCGAGGTG AAGTTCGAGG 1861 GCGACACCCT GGTGAACCGC ATCGAGCTGA AGGGCATCGA CTTCAAGGAG GACGGCAACA 1921 TCCTGGGGCA CAAGCTGGAG TACAACTACA ACAGCCACAA CGTCTATATC ATGGCCGACA 1981 AGCAGAAGAA CGGCATCAAG GTGAACTTCA AGATCCGCCA CAACATCGAG GACGGCAGCG 2041 TGCAGCTCGC CGACCACTAC CAGCAGAACA CCCCCATCGG CGACGGCCCC GTGCTGCTGC 2101 CCGACAACCA CTACCTGAGC ACCCAGTCCG CCCTGAGCAA AGACCCCAAC GAGAAGCGCG 2161 ATCACATGGT CCTGCTGGAG TTCGTGACCG CCGCCGGGAT CACTCTCGGC ATGGACGAGC 2221 TGTACAAGTA ATAAGCTTGC GGCCGCTTCG AGCAGACATG ATAAGATACA TTGATGAGTT 2281 TGGACAAACC ACAACTAGAA TGCAGTGAAA AAAATGCTTT ATTTGTGAAA TTTGTGATGC 2341 TATTGCTTTA TTTGTAACCA TTATAAGCTG CAATAAACAA GTTAACAACA ACAATTGCAT 2401 GAATGAATAA AGGCCAGCAT TAATTCACTT AAGGAGTCTG TTTATTTAAG TTAAACCTTA 2461 ATAAACGGTC ACCGCCTCCC TAATACGCAG GCGCAGAAAG GGGGCTCCGC CCCCTTTAAC 2521 CCCCAGGGGG CTCCGCCCCC TGAAACCCCC AAGGGGGCTA CGCCCCCTTA CACCCCCGAT 2581 ATCCCCGCAG GAACCCCTAG TGATGGAGTT GGCCACTCCC TCTCTGCGCG CTCGCTCGCT 2641 CACTGAGGCC GGGCGACCAA AGGTCGCCCG ACGCCCGGGC TTTGCCCGGG CGGCCTCAGT 2701 GAGCGAGCGA GCGCGCAGCT GCCTGCAGGG GCGCCTGGGT ACCGAGCTCG AATTCACTGG 2761 CCGTCGTTTT ACAACGTCGT GACTGGGAAA ACCCTGGCGT TACCCAACTT AATCGCCTTG 2821 CAGCACATCC CCCTTTCGCC AGCTGGCGTA ATAGCGAAGA GGCCCGCACC GATCGCCCTT 2881 CCCAACAGTT GCGCAGCCTG AATGGCGAAT GGCGCCTGAT GCGGTATTTT CTCCTTACGC 2941 ATCTGTGCGG TATTTCACAC CGCATATGGT GCACTCTCAG TACAATCTGC TCTGATGCCG 3001 CATAGTTAAG CCAGCCCCGA CACCCGCCAA CACCCGCTGA CGCGCCCTGA CGGGCTTGTC 3061 TGCTCCCGGC ATCCGCTTAC AGACAAGCTG TGACCGTCTC CGGGAGCTGC ATGTGTCAGA 3121 GGTTTTCACC GTCATCACCG AAACGCGCGA GACGAAAGGG CCTCGTGATA CGCCTATTTT 3181 TATAGGTTAA TGTCATGATA ATAATGGTTT CTTAGACGTC AGGTGGCACT TTTCGGGGAA 3241 ATGTGCGCGG AACCCCTATT TGTTTATTTT TCTAAATACA TTCAAATATG TATCCGCTCA 3301 TGAGACAATA ACCCTGATAA ATGCTTCAAT AATATTGAAA AAGGAAGAGT ATGAGTATTC 3361 AACATTTCCG TGTCGCCCTT ATTCCCTTTT TTGCGGCATT TTGCCTTCCT GTTTTTGCTC 3421 ACCCAGAAAC GCTGGTGAAA GTAAAAGATG CTGAAGATCA GTTGGGTGCA CGAGTGGGTT 3481 ACATCGAACT GGATCTCAAC AGCGGTAAGA TCCTTGAGAG TTTTCGCCCC GAAGAACGTT 3541 TTCCAATGAT GAGCACTTTT AAAGTTCTGC TATGTGGCGC GGTATTATCC CGTATTGACG 3601 CCGGGCAAGA GCAACTCGGT CGCCGCATAC ACTATTCTCA GAATGACTTG GTTGAGTACT 3661 CACCAGTCAC AGAAAAGCAT CTTACGGATG GCATGACAGT AAGAGAATTA TGCAGTGCTG 3721 CCATAACCAT GAGTGATAAC ACTGCGGCCA ACTTACTTCT GACAACGATC GGAGGACCGA 3781 AGGAGCTAAC CGCTTTTTTG CACAACATGG GGGATCATGT AACTCGCCTT GATCGTTGGG 3841 AACCGGAGCT GAATGAAGCC ATACCAAACG ACGAGCGTGA CACCACGATG CCTGTAGCAA 3901 TGGCAACAAC GTTGCGCAAA CTATTAACTG GCGAACTACT TACTCTAGCT TCCCGGCAAC 3961 AATTAATAGA CTGGATGGAG GCGGATAAAG TTGCAGGACC ACTTCTGCGC TCGGCCCTTC 4021 CGGCTGGCTG GTTTATTGCT GATAAATCTG GAGCCGGTGA GCGTGGGTCT CGCGGTATCA 4081 TTGCAGCACT GGGGCCAGAT GGTAAGCCCT CCCGTATCGT AGTTATCTAC ACGACGGGGA 4141 GTCAGGCAAC TATGGATGAA CGAAATAGAC AGATCGCTGA GATAGGTGCC TCACTGATTA 4201 AGCATTGGTA ACTGTCAGAC CAAGTTTACT CATATATACT TTAGATTGAT TTAAAACTTC 4261 ATTTTTAATT TAAAAGGATC TAGGTGAAGA TCCTTTTTGA TAATCTCATG ACCAAAATCC 4321 CTTAACGTGA GTTTTCGTTC CACTGAGCGT CAGACCCCGT AGAAAAGATC AAAGGATCTT 4381 CTTGAGATCC TTTTTTTCTG CGCGTAATCT GCTGCTTGCA AACAAAAAAA CCACCGCTAC 4441 CAGCGGTGGT TTGTTTGCCG GATCAAGAGC TACCAACTCT TTTTCCGAAG GTAACTGGCT 4501 TCAGCAGAGC GCAGATACCA AATACTGTTC TTCTAGTGTA GCCGTAGTTA GGCCACCACT 4561 TCAAGAACTC TGTAGCACCG CCTACATACC TCGCTCTGCT AATCCTGTTA CCAGTGGCTG 4621 CTGCCAGTGG CGATAAGTCG TGTCTTACCG GGTTGGACTC AAGACGATAG TTACCGGATA 4681 AGGCGCAGCG GTCGGGCTGA ACGGGGGGTT CGTGCACACA GCCCAGCTTG...

Claims

CLAIMS What is claimed is:

1. A method of delivering a genetic element to a spleen tissue, ovary tissue, or lymph node tissue of a subject, the method comprising administering to the subject an anellovector, wherein the anellovector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element.

2. The method of claim 1, which results in production of the exogenous effector in the spleen tissue, ovary tissue, or lymph node tissue.

3. A method of delivering a genetic element to a subject, the method comprising administering to the subject an anellovector, wherein the anellovector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the genetic element or exogenous effector is at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a heart tissue or thymus tissue relative to the level in the heart tissue or thymus tissue.

4. A method of delivering a genetic element to cells or a tissue of a subject, the method comprising administering to the subject an anellovector, wherein the anellovector comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule comprising the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto, wherein the tissue is chosen from liver tissue, spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue, or the cells are chosen from liver, spleen, ovary, lymph node, lung, liver, bone marrow, kidney, or skeletal muscle cells.

5. The method of embodiment 4, wherein the cells comprise CD3+ PBMCs (e.g., activated CD3+ PBMCs).

6. The method of any of the preceding claims, wherein the genetic element or exogenous effector is detected at levels at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, or 10,000-fold higher in a tissue of the subject other than a heart tissue or thymus tissue relative to the level detected in the heart tissue or thymus tissue.

7. The method of any of the preceding claims, wherein the subject is a human subject.

8. The method of any of the preceding claims, wherein the exogenous effector is a peptide or polypeptide, e.g., an intracellular peptide or intracellular polypeptide, a secreted polypeptide, or a protein replacement therapeutic.

9. The method of claim 8, wherein the exogenous effector is a hormone, a ligand, a secreted protein, or a functional fragment thereof.

10. The method of any of the preceding claims, wherein the administration is intravenous administration, e.g., intravenous limb vein administration, e.g., intravenous arm vein administration.

11. The method of any of the preceding claims, which results in anellovector in the spleen tissue at a level of at least 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 50,000, or 100,000 copies of the genetic element / µg total DNA.

12. The method of any of the preceding claims, which results in anellovector in the lymph node tissue at a level of at least 100, 200, 300, 400, 500, 1000, or 1500 copies of the genetic element / µg total DNA.

13. The method of any of the preceding claims, which results in anellovector in the bone marrow tissue at a level of at least 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1,000 copies of the genetic element / µg total DNA.

14. The method of any of the preceding claims, which results in anellovector in the ovary tissue at a level of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 copies of the genetic element / µg total DNA.

15. The method of any of the preceding claims, which results in production of the exogenous effector in a tissue of the subject.

16. The method of any of the preceding claims, wherein the proteinaceous exterior of the anellovector comprises a polypeptide comprising the amino acid sequence of SEQ ID NO: 58, or an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto.

17. The method of any of the preceding claims, which results in genetic element in CD45+ cells of the spleen tissue at a level of at least 1,000, 2,000, 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000, 10,000, 50,000, or 100,000 copies of the genetic element / µg total DNA.

18. The method of any of the preceding claims, further comprising one or more additional administrations of anellovectors.

19. A method of delivering a genetic element to a mammalian cell, the method comprising contacting the cell with an anellovector, wherein the anellovector comprises: a genetic element encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR), and a proteinaceous exterior enclosing the genetic element.

20. A mammalian cell (e.g., a T cell) comprising a genetic element encoding a CAR.

21. A mammalian cell (e.g., a T cell) comprising a single stranded DNA molecule encoding a CAR.

22. A genetic element comprising: one or both of: (i) an Anellovirus 5’ UTR conserved domain, and / or (ii) an Anellovirus GC-rich region; a promoter; anda sequence encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR).

23. A nucleic acid molecule (e.g., a genetic element or a genetic element construct) comprising: one or both of: (i) an Anellovirus 5’ UTR conserved domain, and / or (ii) an Anellovirus GC-rich region; a promoter; and a sequence encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR).

24. An anellovector comprising: the genetic element of claim 22 or 23, and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule.

25. An anellovector comprising: a genetic element encoding an exogenous effector, wherein the exogenous effector comprises a chimeric antigen receptor (CAR), and a proteinaceous exterior enclosing the genetic element, wherein the proteinaceous exterior comprises an ORF1 molecule.

26. The method, cell, genetic element, nucleic acid molecule, or anellovector of any of claims 19-25, wherein the CAR comprises an antigen binding domain, a transmembrane domain, and a signaling domain.

27. The method, cell, genetic element, nucleic acid molecule, or anellovector of claim 26, wherein: (a) the antigen binding domain comprises an scFv; (b) the antigen binding domain binds an antigen chosen from CD19 and BCMA; (c) the transmembrane domain comprises a transmembrane region of CD8 or CD28; (d) the signaling domain comprises a signaling domain of CD3-zeta; and / or (e) the CAR further comprises a costimulatory signaling domain, optionally wherein the costimulatory domain is selected from 4-1BB or CD28.

28. A method of delivering a genetic element to a spleen tissue, ovary tissue, or lymph node tissue of a subject who has been previously administered a first plurality of anellovectors, the method comprising administering to the subject a second plurality of anellovectors, wherein the first and second plurality of anellovectors comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element.

29. A method of delivering a genetic element to a spleen tissue, ovary tissue, lymph node tissue, lung tissue, liver tissue, bone marrow tissue, kidney tissue, or skeletal muscle tissue of a subject who has been previously administered a first plurality of Anelloviridae family vectors, the method comprising administering to the subject a second plurality of Anelloviridae family vectors, wherein the first and second plurality of Anelloviridae family vectors each comprises: a genetic element encoding an exogenous effector, and a proteinaceous exterior enclosing the genetic element; and wherein the subject is a human subject.

Images