Composition and methods for treating colorectal cancer liver metastasis (CRC liver METS)

Genetically modified iNKT cells with FAP-targeting CARs address the immunosuppressive tumor microenvironment in colorectal cancer liver metastases by killing FAP-expressing cells, enhancing immune response, and improving therapeutic efficacy.

WO2025212740A1PCT designated stage Publication Date: 2025-10-09MINK THERAPEUTICS INC +1
View PDF 4 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/022699
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-04-03
Filing Date
2025-04-02
Publication Date
2025-10-09

AI Technical Summary

Technical Problem

Liver metastases in colorectal cancer limit the efficacy of immunotherapy due to an immunosuppressive tumor microenvironment, primarily mediated by cancer-associated fibroblasts expressing fibroblast activation protein (FAP).

Method used

Genetically modified invariant natural killer T (iNKT) cells engineered with chimeric antigen receptors (CARs) targeting FAP are administered to kill FAP-expressing cells, such as cancer-associated fibroblasts, and combined with immune checkpoint inhibitors and/or CAR T cells to enhance immune response.

Benefits of technology

The iNKT cells reduce immunosuppression, increase immune cell infiltration, and enhance the efficacy of cancer therapy by directly killing FAP-expressing cells and promoting an anti-tumor immune response, thereby reducing tumor burden.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2025022699_09102025_PF_FP_ABST
    Figure US2025022699_09102025_PF_FP_ABST
Patent Text Reader

Abstract

The present disclosure, at least in part, is based on the discovery of treating colorectal cancer liver metastasis in a subject using an IL- 15 armored anti-FAP CAR iNKT cells. In some embodiments, an IL- 15 armored anti-FAP CAR iNKT cells can be used in combination with a CAR T cell expressing a tumor specific antigen and / or an immune check point inhibitor.
Need to check novelty before this filing date? Find Prior Art

Description

COMPOSITION AND METHODS FOR TREATING COLORECTAL CANCER LIVER METASTASIS (CRC LIVER METS)RELATED APPLICATIONS

[0001] This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application, U.S.S.N. 63 / 574,127, filed April 3, 2024, the entire contents of which are incorporated herein by reference.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

[0002] The contents of the electronic sequence listing (A132770011WO00-SEQ- LJG.xml; Size: 180,213 bytes; and Date of Creation: March 31, 2025) are herein incorporated by reference in its entirety.BACKGROUND

[0003] Fibroblast activation protein (FAP) is a cell surface protein high expressed on stroma cells (e.g., cancer-associated fibroblasts (CAFs) in the tumor microenvironment (TME). FAP can modulate the TME by remodeling the extracellular matrix (ECM), and its overexpression on CAFs is associated with poor prognosis in various cancers.

[0004] Liver metastases limit the efficacy of immunotherapy in patients colorectal cancer (CRC) due to the immunosuppressive tumor microenvironment (TME).SUMMARY

[0005] The present disclosure, at least in part, is based on the discovery that genetically modified cells (e.g., iNKT cells) expressing chimeric antigen receptors targeting fibroblast activation protein (FAP) are useful for killing FAP expressing cells (e.g., cancer- associated fibroblasts (CAFs)) in the tumor microenvironment (TME) in colorectal cancer liver metastases (CRC liver mets), as well as promoting immune response to the cancer cells when used in combination with, e.g., immune check point inhibitors and / or CAR T cells. In some embodiments, the anti-FAP CAR iNKT cell is engineered to express an armoring molecule (e.g., soluble IL- 15). In some embodiments, the anti-FAP CAR iNKT cells kill FAP expressing cells (e.g., FAP expressing tumor cells and / or FAP expressing cancer-associated fibroblasts (CAFs)). In some embodiments, the anti-FAP CAR iNKT cells reduce the immunosuppression in the TME, thereby increasing the efficacy of other cancer therapy (e.g.,CAR T cell targeting tumor antigen) In some embodiments, anti-FAP CAR iNKT cells described by the disclosure demonstrate improved properties relative to existing FAP-CAR cell therapy in the art, including but not limited to killing of FAP-expressing cells in vitro and in vivo', and enhanced persistence in a subject receiving the therapy.

[0006] In some aspects, the present disclosure provides a method for treating colorectal cancer liver metastasis in a subject, the method comprising administering the subject an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) that specifically binds fibroblast activation protein (FAP). In some embodiments, the anti-FAP CAR iNKT cells comprises a CAR having a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, a CDRH3 having the amino acid sequence of SEQ ID NO: 3, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 6. In some embodiments, the anti- FAP CAR iNKT cells comprises a CAR having a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 12, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 13. In some embodiments, the anti-FAP CAR iNKT cells comprises a CAR having a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43. In some embodiments, the anti-FAP CAR iNKT cells comprises a CAR having a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43. In some embodiments, the anti-FAP CAR iNKT cells comprises a CAR having a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 54, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 55. In some embodiments, theCAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0007] In the methods described herein, in some embodiments, a CAR comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, a CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising the amino acid sequence of SEQ ID NO: 15. In some embodiments, a CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45. In some embodiments, a CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48. In some embodiments, a CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 56 and a VL comprising the amino acid sequence of SEQ ID NO: 57.

[0008] In the methods described herein, in some embodiments, a CAR comprises a scFv comprising the amino acid sequence of SEQ ID NO: 9. In some embodiments, a CAR comprises a scFv comprising the amino acid sequence of SEQ ID NO: 16. In some embodiments, a CAR comprises a scFv comprising the amino acid sequence of SEQ ID NO: 46. In some embodiments, a CAR comprises a scFv comprising the amino acid sequence of SEQ ID NO: 49. In some embodiments, a CAR comprises a scFv comprising the amino acid sequence of SEQ ID NO: 58.

[0009] In the methods described herein, in some embodiments, a CAR further comprises a hinge region. In some embodiments, the hinge region comprises an amino acid sequence at least 80% identical to SEQ ID NO: 30. In some embodiments, the CAR further comprises a transmembrane domain. In some embodiments, the transmembrane domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 31. The method of any one of claims 1-7, wherein the CAR comprises a hinge / transmembrane domain comprising the amino acid sequence of any one of SEQ ID NOs: 83, 85, or 87. In some embodiments, the CAR further comprises one or more cytoplasmic domain. In some embodiments, the one or more cytoplasmic domain comprises the amino acid sequence of any one of SEQ ID NO: 32, 33, 39, 90, 92, 94, 96, 98, 100, 102, or 105. In someembodiments, the cytoplasmic domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 32. In some embodiments, the CAR further comprises an intracellular co-stimulatory domain. In some embodiments, the co- stimulatory domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 33. In some embodiments, the CAR comprises the amino acid sequence of any one of SEQ ID NOs: 17, 18, 59, 60, or 62. In some embodiments, the CAR comprises the amino acid sequence of SEQ ID NO: 60.

[0010] In the methods described herein, in some embodiments, an iNKT cell is engineered to express one or more immunoregulatory gene products. In some embodiments, the one or more immunoregulatory gene products comprises IL-15, IL-12, CD40L, or 4-1BB, IL-18, or IL-21. In some embodiments, the immunoregulatory gene product is a soluble IL-15 (sIL-15). In some embodiments, a CAR binds to FAP with a KD in the range of IE-10 M to 10E-7 M. In some embodiments, a CAR binds to FAP with a KD in the range of IE-8 M to3E-8 M, or 3E-8 M to 4E-7 M.

[0011] In some embodiments, the subject has micro satellite- stable (MSS) colorectal cancer.

[0012] In some embodiments, the cell in the tumor microenvironment (TME) of the CRC liver mets express FAP. In some embodiments, the administration reduces FAP expressing cells in the TME. In some embodiments, the FAP expressing cells are cancer associated fibroblasts.

[0013] In some embodiments, the administration is via injection. In some embodiments, the injection is intraperitoneal injection, intravenous injection, or intratumoral injection.

[0014] In some embodiments, the iNKT cell is administered in combination with a therapeutic agent. In some embodiments, the therapeutic agent is a CAR T cell specific for a tumor antigen. In some embodiments, the therapeutic agent is an immune checkpoint inhibitor or agonist.

[0015] In some embodiments, the killing of cancer-associated fibroblasts results in reduced immunosuppression in the TME relative to immunosuppression in the subject prior to the administration. In some embodiments, the killing of cancer-associated fibroblasts results in increased immune cell infiltration in the TME relative to immune cell infiltration in the subject prior to the administration. In some embodiments, the administration of the anti-FAP CAR iNKT cells leads to reduced tumor burden relative to tumor burden in the subject prior to the administration. In some embodiments, the administration of the anti-FAP CAR iNKT cells leads to resistance to T cell exhaustion, enhancement of tissue homing of anti- FAP iNKT cells, selective cytotoxicity towards M2 macrophages, and / or stimulation of dendritic cell maturation. In some embodiments, the anti-FAP CAR iNKT cells retain response to CD Id and / or NK receptor ligand. In some embodiments, the administration of the anti-FAP CAR iNKT cells reduces CXCL12 expression and / or activity in CRC liver mets cells. In some embodiments, the administration of the anti-FAP CAR iNKT cells increases proinflammatory cytokines in CRC liver mets cells. In some embodiments, the cytokine is CX3CL1, CXCL19, CCL3, IL-8, CD40L, CD137, IFNy, GZMB, or FASL.

[0016] In some aspects, the present disclosure provides an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) that specifically binds fibroblast activation protein (FAP). In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, a CDRH3 having the amino acid sequence of SEQ ID NO: 3, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 6. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 12, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 13. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43. In some embodiments, the chimeric antigen receptor of theiNKT cells comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 54, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0017] In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a VH comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising the amino acid sequence of SEQ ID NO: 15. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a VH comprising the amino acid sequence of SEQ ID NO: 56 and a VL comprising the amino acid sequence of SEQ ID NO: 57.

[0018] In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a scFv comprising the amino acid sequence of SEQ ID NO: 9. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a scFv comprising the amino acid sequence of SEQ ID NO: 16. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a scFv comprising the amino acid sequence of SEQ ID NO: 46. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a scFv comprising the amino acid sequence of SEQ ID NO: 49. In some embodiments, the chimeric antigen receptor of the iNKT cells comprises a scFv comprising the amino acid sequence of SEQ ID NO: 58.

[0019] In some embodiments, an iNKT cell comprises a CAR that further comprises a hinge region. In some embodiments, the hinge region comprises an amino acid sequence at least 80% identical to SEQ ID NO: 30. In some embodiments, an iNKT cell comprises a CAR that further comprises a transmembrane domain. In some embodiments, the transmembrane domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 31. In some embodiments, an iNKT cell comprises a CAR that further comprises ahinge / transmembrane domain comprising the amino acid sequence of any one of SEQ ID NOs: 83, 85, or 87. In some embodiments, an iNKT cell comprises a CAR that further comprises one or more cytoplasmic domain. In some embodiments, the one or more cytoplasmic domain comprises the amino acid sequence of any one of SEQ ID NO: 32, 33, 39, 90, 92, 94, 96, 98, 100, 102, or 105. In some embodiments, the cytoplasmic domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 32. In some embodiments, an iNKT cell comprises a CAR that further comprises an intracellular costimulatory domain. In some embodiments, the co-stimulatory domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 33. In some embodiments, the CAR comprises the amino acid sequence of any one of SEQ ID NOs: 17, 18, 59, 60, 61, or 62.

[0020] In some embodiments, an anti-FAP CAR iNKT cell is engineered to express one or more immunoregulatory gene products (i.e., armoring molecule). In some embodiments, the one or more immunoregulatory gene products comprises IL-15, IL-12, CD40L, or 4-1BB, IL-18, or IL-21. In some embodiments, the immunoregulatory gene product is a soluble IL- 15 (sIL-15).

[0021] In some embodiments, the CAR binds to FAP with a KD in the range of IE- 10 M and 10E-7 M. In some embodiments, the CAR binds to FAP with a KD in the range of 1E- 8 M and 3E-8 M.

[0022] In some aspects, the present disclosure provides an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) that specifically binds fibroblast activation protein (FAP), wherein the iNKT cell expresses IL-15 (e.g., soluble IL-15). In some embodiments, an anti-FAP CAR iNKT cell comprises a CAR comprising an antigen binding moiety that specifically binds to FAP derived from the antigen binding moiety of any one of the anti-FAP antibodies set forth in Tables 2 and 3.

[0023] In some aspects, the present disclosure provides a composition comprising an FAP CAR iNKT cell described herein, and a pharmaceutically acceptable carrier.

[0024] In some aspects, the present disclosure provides a method for killing a cell, the method comprising contacting the cell with an anti-FAP iNKT cell described herein or the composition thereof. In some embodiments, the cell is a cancer cell. In some embodiments, the cancer cell is a lung cancer cell, a breast cancer cell, a colorectal cancer cell, a prostate cancer cell, a stomach cancer cell, a pancreatic cancer cell, a prostate cancer cell, a thyroid cancer cell, a cervical cancer cell, a urothelial cancer cell, or a sarcoma cell. In someembodiments, the lung cancer is non-small cell lung cancer. In some embodiments, the cell in the tumor microenvironment express FAP.

[0025] In some aspects, the present disclosure provides a method for treating tumor in a subject, the method comprising administering to a subject having or suspected of having cancer an anti-FAP iNKT described herein or a composition thereof.

[0026] In some aspects, the present disclosure provides a method for reducing tumor growth, the method comprising contacting the tumor in a subject an anti-FAP iNKT described herein or a composition thereof. In some embodiments, the administration is via injection. In some embodiments, the injection is intraperitoneal injection, intravenous injection, or intratumoral injection. In some embodiments, an anti-FAP CAR iNKT cell is administered in combination with a therapeutic agent. In some embodiments, the therapeutic agent is a CAR T cell specific for a tumor antigen. In some embodiments, the therapeutic agent is an immune checkpoint inhibitor or agonist.

[0027] In some aspects, the present disclosure provides a method for treating a tumor in a subject, the method comprising administering the subject a composition comprising an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) having an anti-FAP binding moiety.

[0028] In some aspects, the present disclosure provides a method for killing tumor cells, the method comprising contacting the tumor cells with a composition comprising an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) having an anti-FAP binding moiety.

[0029] In some aspects, the present disclosure provides method for reducing immunosuppression in the tumor microenvironment (TME) of a subject relative to immunosuppression in the subject prior to the administration, the method comprising administering the subject a composition comprising an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) having an anti-FAP binding moiety.

[0030] In some embodiments, the anti-FAP CAR iNKT cells express an armoring molecule. In some embodiments, armoring molecule is soluble IL-15 (sIL-15).

[0031] In some embodiments, the tumor is a solid tumor. In some embodiments, the tumor is of epithelial cell origin. In some embodiments, the solid tumor is lung cancer tumor, breast cancer tumor, colorectal cancer tumor, prostate cancer tumor, stomach cancer tumor, pancreatic cancer tumor, prostate cancer tumor, thyroid cancer tumor, cervical cancer tumor, urothelial cancer tumor, or sarcoma tumor.

[0032] In some embodiments, the anti-FAP CAR iNKT cells kill FAP expressing cells in the TME. In some embodiments, the FAP expressing cells in the TME comprise tumor cells expressing FAP, and / or cancer-associated fibroblasts. In some embodiments, the anti-FAP CAR iNKT cells kill FAP expressing cells directly. In some embodiments, the anti- FAP CAR iNKT cells kill FAP expressing cells indirectly. In some embodiments, the killing of cancer-associated fibroblasts results in reduced immunosuppression in the TME relative to immunosuppression in the subject prior to the administration. In some embodiments, the killing of cancer-associated fibroblasts results in increased immune cell infiltration in the TME relative to immune cell infiltration in the subject prior to the administration.

[0033] In some embodiments, the method further comprises administering the subject a CAR T cell targeting a tumor antigen comprising NY-ESO-1, or BCMA.

[0034] In some embodiments, the administration of the anti-FAP CAR iNKT cells leads to reduced tumor burden relative to tumor burden in the subject prior to the administration.

[0035] In some embodiments, the administration of the anti-FAP CAR iNKT cells leads to resistance to T cell exhaustion, enhancement of tissue homing of anti-FAP iNKT cells, selective cytotoxicity towards M2 macrophages, and / or stimulation of dendritic cell maturation. In some embodiments, the anti-FAP CAR iNKT cells retain response to CD Id and / or NK receptor ligand.

[0036] In some embodiments, the anti-FAP CAR iNKT cells comprise a CAR comprising any one of the FAP binding moieties set forth in table 2 and Table 3.

[0037] In some embodiments, the anti-FAP CAR iNKT cells comprise a CAR comprising any one of the FAP antibodies set forth in Table 2.

[0038] In some embodiments, the subject is a human. In some embodiments, the subject is diagnosed as having a solid tumor comprising lung cancer, breast cancer, colorectal cancer, prostate cancer, stomach cancer, pancreatic cancer, prostate cancer, thyroid cancer, cervical cancer, urothelial cancer, or sarcoma.

[0039] In some aspects, the present disclosure provides an antibody or antigen binding fragment that specifically binds to an amino acid sequence having at least 85% identity to SEQ ID NOs: 35-38. In some embodiments, the antibody specifically binds an amino acid sequence set forth as: SEQ ID NOs: 35-38.

[0040] In some aspects, the present disclosure provides an antibody or antigen binding fragment that comprises a heavy chain variable region having the sequence set forth as in SEQ ID NOs: 7 or 14.

[0041] In some embodiments, the antibody comprises a heavy chain variable region having the sequence set forth as: SEQ ID NOs: 7 or 14 and a light chain variable region having the sequence set forth as: SEQ ID NO: 8 or 15.

[0042] In some embodiments, wherein the antibody comprises: (i) heavy chain variable region having the sequence set forth in SEQ ID NO: 7 and / or the light chain variable region having the sequence set forth in SEQ ID NO: 8; or (ii) heavy chain variable region having the sequence set forth in SEQ ID NO: 14 and / or the light chain variable region having the sequence set forth in SEQ ID NO: 15.

[0043] In some aspects, the present disclosure provides an antibody or antigen binding fragment that comprises a variable heavy chain region comprising a complementarity determining region 3 (CDRH3) having the sequence set forth in SEQ ID NOs: 3 or 12.

[0044] In some embodiments, the antibody or antigen binding fragment further comprising a variable light chain region comprising a complementarity determining region 3 (CDRL3) having the sequence set forth in SEQ ID NOs: 6 or 13.

[0045] In some aspects, the present disclosure provides ab antibody or antigen binding fragment that comprises six complementarity determining regions (CDRs): CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3, wherein (i) CDRH1 comprises the sequence as set forth in SEQ ID NO: 1, CDRH2 comprises the sequence as set forth in SEQ ID NO: 2, CDRH3 comprises the sequence as set forth in SEQ ID NO: 3, CDRL1 comprises the sequence as set forth in SEQ ID NO: 4, CDRL2 comprises the sequence as set forth in SEQ ID NO: 5, and CDRL3 comprises the sequence as set forth in SEQ ID NO: 6; or (ii) CDRH1 comprises the sequence as set forth in SEQ ID NO: 10, CDRH2 comprises the sequence as set forth in SEQ ID NO: 11, CDRH3 comprises the sequence as set forth in SEQ ID NO: 12, CDRL1 comprises the sequence as set forth in SEQ ID NO: 4, CDRL2 comprises the sequence as set forth in SEQ ID NO: 5, and CDRL3 comprises the sequence as set forth in SEQ ID NO: 13.

[0046] In some embodiments, the antibody or antigen binding fragment is chimeric. In some embodiments, wherein the antibody or antigen binding fragment is humanized.

[0047] In some embodiments, the antibody or antigen binding fragment is a singlechain variable fragment (scFv). In some embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NOs: 9 or 16.

[0048] In some aspects, the present disclosure provides an isolated nucleic acid encoding the antibody or antigen binding fragment described herein.

[0049] In some embodiments, the nucleic acid sequence encoding an anti-FAP scFv is set forth in SEQ ID NOs: 21 or 26. In some embodiments, the nucleic acid sequence encoding an anti-FAP CAR is set forth in SEQ ID NOs: 22 or 27.

[0050] In some aspects, the present disclosure provides a vector comprising the isolated nucleic acid described herein. In some embodiments, the vector is a viral vector. In some embodiments, the viral vector is a lentiviral vector. In some embodiments, the lentiviral vector comprises the sequence set forth in SEQ ID NOs: 23 or 28.

[0051] In some aspects, the present disclosure provides a host cell comprising the antibody or antigen binding fragment, the isolated nucleic acid, or the vector described herein. In some embodiments, the cell is a mammalian cell, bacterial cell, yeast cell, or insect cell. In some embodiments, the cell is a hybridoma cell.

[0052] In some aspects, the present disclosure provides a chimeric antigen receptor (CAR) comprising the antigen binding fragment described herein. In some embodiments, the CAR further comprises a hinge region. In some embodiments, the hinge region comprises an amino acid sequence at least 80% identical to SEQ ID NO: 30.

[0053] In some embodiments, the CAR further comprises a transmembrane domain. In some embodiments, the transmembrane domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 31.

[0054] In some embodiments, the CAR further comprises a cytoplasmic domain. In some embodiments, the cytoplasmic domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 32.

[0055] In some embodiments, the CAR further comprises a co-stimulatory domain. In some embodiments, the co-stimulatory domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 33.

[0056] In some embodiments, the CAR comprises the amino acid sequence of SEQ ID NOs: 17 or 18.

[0057] In some aspects, the present disclosure comprises an immune cell comprising the CAR of described herein.

[0058] In some embodiments, the immune cell is a natural killer (NK) cell or a T cell. In some embodiments, the immune cell is an invariant natural killer T (iNKT) cell.

[0059] In some embodiments, the immune cell is engineered to express one or more immunoregulatory gene products. In some embodiments, the one or more immunoregulatory gene products comprises IL-15, IL-12, CD40L, or 4-1BB, IL-18, or IL-21.

[0060] In some aspects, the present disclosure provides a pharmaceutical composition comprising the antibody or antigen binding fragment or the immune cell described herein, and a pharmaceutically acceptable excipient.BRIEF DESCRIPTION OF THE DRAWINGS

[0061] The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate certain embodiments, and together with the written description, serve to provide non-limiting examples of certain aspects of the compositions and methods disclosed herein.

[0062] FIG. 1 shows an exemplary format for an anti-FAP CAR iNKT cell.

[0063] FIG. 2 shows a process for assessing a therapeutic window for targeting FAP positive cells (e.g., cancer-associated fibroblasts (CAFs)) in the tumor microenvironment. FAP expression in different types of cancer associated fibroblast. Quantitation of FAP molecule expression on the surface of different cell types was done using the Quantibrite™ approach. CAFs from 8 dissociated tumor samples (DTCs) of colorectal cancer (CRC) patients were assessed. FAP expression in CAF-S1 subpopulation was >10 fold higher than in the CAF-S3 subpopulation. Similarly, expression of FAP in CAF-S1 samples was 10-fold higher than in normal lung fibroblasts (NLF) post thawing. Passaging of NLF (P0, P3) led to an increase in the FAP expression to similar levels to CAFs. Different FAP expressing tumor cell lines from multiple passages exhibited a range of FAP expression between levels observed for Primary healthy fibroblasts to CAF S3. In the case of U138 cells, there was variability based on the passage. For discovery purposes we transfected T2 cells with low or high amount of FAP (T21ow and T2high respectively). Finally, for the in vivo studies, A375 cells expressing FAP at the same levels as T2high were generated.

[0064] FIGs. 3A-3N are graphs showing the generation of anti-FAP CARs capable of binding to human and mouse FAP, and killing FAP expressing cells. FIG. 3A shows a process of identifying a panel of anti-FAP candidate scFvs. FIG. 3B shows an exemplary workflow of the transient anti-FAP iNKT assays. FIG. 3C shows expression level of FAP intarget T2 cells electroporated with either 0.3 pg or 10 pg of either human or mouse FAP. FIG. 3D shows binding of human or mouse FAP of a pool of exemplary anti-FAP scFvs. FIG. 3E shows target cell killing of a pool of exemplary anti-FAP CAR iNKT cells. FIGs. 3F & G shows binding of a different pool of candidate anti-FAP CARs candidates expressed in 2 different donors respectively. FIG. 3F shows iNKT cells derived from donor 1 in binding human FAP. FIG. 3G shows a different pool of candidate anti-FAP CARs iNKT cells derived from donor 2 in binding human FAP. FIGs. 3H-3I show target cell killing at E:T ratio 1:1 (FIG. 3H), or 5:1 (FIG. 31). All anti-FAP candidate CAR iNKT candidates were able to kill more U87 and HS683 cells compared to mock control. FIGs. 3J-3K show target cell induced iNKT cell activation by measuring the cytokines CD25 and CD69 markers at E:T ratio of 1:1 (FIG. 3J) or 5:1 (FIG. 3K). FIGs 3L-3M show target cell induced iNKT cell activation by measuring the 4-lbb marker at E:T ratio of 1:1 (FIG. 3K) or 5:1 (FIG. 3M). FIGs. 3N shows that the candidate selection process identified two distinct groups of anti-FAP-CARs. Left plot. Cytotoxicity of T2 cells expressing high levels of mouse FAP vs high levels of human FAP. Top candidates selected through CARDIS were transiently transfected into iNKT cells. In parallel, T2 cells were transfected with high human or mouse FAP. The following day CAR-iNKT cells were co-cultured with mouse or human T2high in a 5:1 E:T ratio and killing of target cells was assessed 24 hours afterwards. All candidates kill robustly cells expressing high levels of mouse or human FAP. Right plot. Cytotoxicity of T2 cells expressing low levels of mouse vs low levels of human FAP. Transiently transfected CAR-iNKT cells were co-cultured with mouse or human T21ow cells. Assessment of the killing of target cells 24 hours afterwards revealed two groups of cells: group 1 retained their ability to robustly kill T21ow cells, whereas the second group spared those cells carrying similar levels of FAP to CAF-S3 or normal fibroblasts. Importantly, both groups recognize mouse and human FAP at equivalent levels.

[0065] FIGs. 4A-4D show in vitro assays evaluating candidate anti-FAP CAR iNKT cells. FIGs. 4A-4B show that FAP-CAR iNKT candidates respond to FAP+ tumors in vitro (FIG. 4A (donor 1) and FIG. 4B (donor 2)). FIGs. 4C and 4D show that anti-FAP CAR iNKT cells were polyfunctional in response to A-375-FAP tumor cells in vitro (FIG. 4C (donor 1) and FIG. 4D (donor 2)).

[0066] FIGs. 5A-5E show FAP-CAR iNKT demonstrating in vivo tumor control toward tumor expressing FAP in the melanoma A-375-FAP+ cancer model. FIG. 5A shows a schematic of in vivo A-375-FAP tumor challenge with FAP-CAR iNKT cells. FIG. 5B showsa curve graph illustrating tumor growth. FIG. 5C shows a curve graph representing tumor growth of individual mice for each group. FIG. 5D shows survival analysis of A-375-FAP tumor bearing mice untreated, treated with MiNK FAP-CAR iNKT cells, sibrotuzumab-CAR NKT cells or control BCMA-CAR iNKT cells. FIG. 5E shows weight of tumor outgrowth in each treatment group.

[0067] FIGs. 6A-6B show FAP-CAR-IL-15 iNKT cells have the capacity to enhance cytotoxicity of T cells which have undergone repeated antigen stimulation. FIG. 6A shows cytotoxicity of NYESO-1 -specific T cells which have undergone multiple rounds of antigen exposure (up to 8 rounds [R#]) against tumor cells which express HLA-A*02:01- SLLMWITQC (SEQ ID NO: 108). FIG. 6B shows cytotoxicity of NYESO-l-specific T cells against tumor cells expressing NYESO-1 which have been exposed with antigen twice (AE2), three times (AE3), or six times (AE6) and co-culture in either media alone or with supernatant from activated FAP-CAR-IL-15 iNKT cells.

[0068] FIGs. 7A-7B show E07 FAP-CAR-IL-15 iNKT cells have the capacity to target mouse FAP. FIG. 7A shows cytotoxicity of FAP-CAR-IL-15 iNKT cells to elicit cytotoxicity against MC38 tumor cells engineered to express mouse FAP at different effector- to-target (E:T) ratios. FIG. 7B shows cytotoxicity of FAP-CAR-IL-15 iNKT cells to elicit cytotoxicity against 4T1 tumor cells engineered to express mouse FAP at different effector- to-target (E:T) ratios.

[0069] FIGs. 8A-8H show schematic of in vivo NSCLC xenograft model developed to illustrate FAP-CAR-iNKT drug mode of action targeting FAP-expressing cancer associated fibroblasts (CAFs) while tumor cells (A549) do not express FAP. FIG. 8A shows experimental design of NSCLC xenograft tumor model treated with FAP-CAR iNKT cells. FIG. 8B shows schematic illustrating of the FAP-CAR-IL-15 iNKT cells drug mode of action. FIG. 8C shows the establishment of tumor within the lungs of mice by bioluminescence imaging of NOG mice injected with 2 million A-549 tumor cells expressing HLA-A*02:01-SLLMWITQC (SEQ ID NO: 108) and nano luciferase intravenously. Images shown are from treatment-naive animals, demonstrating robust tumor take in the lungs of mice seven days after tumor inoculation. FIG. 8D shows H&E staining of lungs of mice administered with A-549 tumor cells 14 days post tumor implantation. FIG. 6E left panel shows tumor burden kinetics by bioluminescence imaging of tumor-bearing animals over 21 days . Right panel shows quantification of tumor area by histology over the same 21 days in the lungs of tumor-bearing mice. Both tumor burden quantification by bioluminescentimaging and histological characterization illustrates progressive tumor outgrowth in treatment-naive conditions. FIG. 8F shows FAP expression as evaluated by immunohistochemistry. Three representative mice are shown for whole-lung (left panels) and representative section (right panel) for FAP expression for weeks 1-3 post-tumor establishment. Normal lungs and controls (no primary and isotype) are shown in the last three right panels. Graphical quantitation of FAP expression is shown below. FIG. 8G shows a- smooth muscle actin (a-SMA), as illustrated by immunohistochemistry at week 1 and week 3 post-tumor establishment. Graphical quantitation of a-SMA expression is shown to the right in which there is a modest, but small, increase in the expression of a-SMA in tumors from weeks 1-3 post-tumor establishment. FIG. 8H shows lungs analyzed by qPCR for murine fap, coll lAl, 116 and Tgfb expression.

[0070] FIGs. 9A-9B show FAP-CAR-IL-15 iNKT promote NSCLC tumor control. FIG. 9A shows individual tumor burdens of NOG mice challenged with A-549 tumor cells expressing HLA-A*02:01-SLLMWITQC (SEQ ID NO: 108) which have been left untreated or treated with non-specific CAR-IL-15 iNKT cells alone, FAP-CAR-IL-15 iNKT cells alone, T cells expressing NYESO-1 TCR, or EAP-CAR-IL-15 iNKT and T cells expressing NYESO TCR. FIG. 9B shows survival analysis of mice treated under conditions described in FIG. 9A.

[0071] FIGs. 10A-10E show mice treated with MiNK FAP-CAR-IL-15 demonstrating reduced tumor burdens in the lung tissue following T cells or FAP-CAR-IL-15 plus T cells. FIG. 10A shows bioluminescence imaging of mice treated with FAP-CAR-IL-15 iNKT + T cells (left panel) and T cells only (right panel) at day 18 and day 25. FIG. 10B shows percent change of tumor burden from day 3 to day 24 post tumor injection in mice treated with either T cells only or FAP-CAR-IL-15 iNKT cells + T cells. FIG. 10C shows H&E staining of lungs of mice treated with FAP-CAR-IL-15 iNKT + T cells or T cells harvested at day 25 (left panel). Right panel shows quantification of the tumoral surface area of the lungs from mice treated with FAP-CAR-IL-15 iNKT cells + T cells or T cells only. FIG. 10D shows immunohistochemistry staining of FAP in lungs of mice treated with T cells or FAP-CAR-IL-15 + T cells harvested at day 25 (left panel). Right panel shows quantification of the FAP expression of the lungs from mice treated with FAP-CAR-IL-15 iNKT + T cells or T cells only. FIG. 10E shows immunohistochemistry staining of a-SMA in lungs of mice treated with T cells or FAP-CAR-IL-15 + T cells harvested at day 25 (leftpanel). Right panel shows quantification of the a-SMA expression of the lungs from mice treated with FAP-CAR-IL-15 iNKT + T cells or T cells only.

[0072] FIGs. 11A-1 IE show that animals treated with FAP-CAR-IL-15 iNKT showed higher levels of immune cells activation and tumor tissue infiltration. FIG. 11 A shows measurement of IFN-g in the serum of mice treated with FAP-CAR-IL-15 iNKT + T cells or T cells only. EIG. 1 IB shows quantification of the number of iNKT cells detected by flow cytometry in lung tissues from groups EAP-CAR-IL-15 iNKT + T cells and T cells only. EIG. 11C shows quantification of the number of T cells detected by flow cytometry in lung tissues from groups EAP-CAR-IL-15 iNKT + T cells and T cells only. FIG. 11D shows measurement of proliferation of iNKT cells in blood, lung, spleen and bone marrow tissues of animal treated with FAP-CAR-IL-15 iNKT + T cells. FIG. HE shows measurement of activation and proliferation of T cells in blood, lung, spleen and bone marrow tissues of animal treated with FAP-CAR-IL-15 iNKT + T cells compare to T cells only.

[0073] FIGs. 12A-12F show configurations of 2ndgeneration CAR and cell killing assay testing the same. FIG. 12A shows A modular FAP-CAR iNKT library comprised of 4 different modules was generated according to the structure of a 2nd generation CAR (scFv, TM / Hinge region, 1st ICD region and 2nd ICD region). Each region had the following number of possible domains: scFv (3), TM / hinge (3), 1st ICD region (24), 2nd ICD region (24) to give a library with a total possible diversity of 5,184 combinations. This library was packaged as lentivirus and transduced into iNKT cells and FAP-CAR+ iNKTs were enriched by sorting on day 17 post transduction. FIG. 12B shows that, on day 21 post transduction, iNKT cells were co-cultured with FAP expressing antigen presenting cells to specifically activate FAP-CAR iNKTs and enrich for ICDs having good activation / proliferation. On day 35 post transduction, a further round of co-culture with FAP expressing antigen presenting cells was performed for a further 14 days, giving over 15000 enrichments over the 4 weeks of co-culture. FIG. 12C shows results of nanopore sequencing of DNA recovered from the initial plasmid library and DNA extracted from aliquots taken on day 21 post iNKT transduction and day 14 post 1st and 2nd enrichment round. FIGs. 12D-12F are results showing cell killing by iNKT cells of different configuration. iNKT cells were electroporated with mRNA encoding FAP-CAR constructs (or water for mock) with the different domains of the tested CARs listed on the x-axis. Target cells (T2) were electroporated with mRNA encoding FAP at high levels (2ug mRNA) or low levels (lOOng mRNA) or mock (water). At 24hrs post electroporation, target cells were labelled with CFSE and were then mixed withiNKT cells at a 5:1 effector: target ratio and co-cultured for 24hrs. Killing was then assessed by flow cytometry by analyzing the % of CFSE+ cells staining positive with live / dead dye.

[0074] FIGs. 13A-13G show Biacore biding kinetics and epitope mapping of the anti- FAP antibodies. FIG. 13A show SPR binding of E07, DOI, B08, A07 and D05 to human and mouse FAP. FIG. 13B shows results of epitope binning using 'Tandem using dual' method. White - no competition. Yellow - competition. Experiment was run on the Biacore 8K. FIG. 13C shows crystal structure of FAP and its related homolog DPP4. FIG. 13D shows human FAP (hFAP) and DPP4 (hDPP4) chimeric constructs used for epitope mapping. FIGs. 13E- 13G show DOI, E07 and B08 do not bind to the human DPP4 but bind to human FAP domain from amino acid 141 to 290.

[0075] FIG. 14 shows expansion of FAP-CAR-IL15-iNKT cells.

[0076] FIG. 15 shows killing of FAP expressing cancer cell by iNKT cells expressing CAR comprising D01 or B08. iNKT cells were transiently transfected with either the D01 or the B08 CAR and co-cultured at 5:1 effector:target ratio with T2 cells transfected to express low or high levels of FAP. Killing of target cells was assessed 24 hours later via flow cytometry.

[0077] FIG. 16 shows the CRC liver metastases organoid model.

[0078] FIGs. 17A-17F show CRC liver mets organoids retain key pathological features of human CRC liver mets.

[0079] FIGs. 18A-18J show CRC liver mets organoids recapitulates Fibroblast Activation Protein-a (FAP) and CXCL12 expression profiles of human metastatic lesions.

[0080] FIGs. 19A-19C show CRC liver mets organoids are refractory to PD-l / CTLA- 4 immune checkpoint blockade (ICB).

[0081] FIGs. 20A-20E show IL- 15 armored FAP targeting CAR-iNKT cell overcomes the limits of PD-l / CTLA-4 blockade to enhance tumor killing in CRC liver mets organoid.

[0082] FIGs. 21A-21B show IL- 15 armored FAP targeting CAR-iNKT cell promotes CD8+ T cells into HCT-15 CRC liver mets organoids.

[0083] FIGs. 22A-22C show IL- 15 armored FAP targeting CAR-iNKT cell kills FAP+ cells and increases CD8+ T cell infiltration in HCC-2998 CRC liver mets organoids.

[0084] FIGs. 23A-23O show IL- 15 armored FAP targeting CAR-iNKT cell reduces CXCL12 expression in CRC liver mets organoids (HCT-15).

[0085] FIG. 24 shows IL- 15 armored FAP targeting CAR-iNKT cell promotes a proinflammatory milieu for T cell trafficking and, enhances T cell activation and effector function.

[0086] FIG. 25 is a schematic showing IL- 15 armored FAP targeting CAR-iNKT cell remodels the tumor stroma, and enhances T cell infiltration and effector function to eradicate tumor cells in CRC liver metastasis organoids.DETAILED DESCRIPTION

[0087] The present disclosure, at least in part, is based on the discovery that genetically modified immune cells (e.g., iNKT cells) expressing chimeric antigen receptors targeting fibroblast activation protein (FAP) are capable of killing FAP expressing cells (e.g., cancer-associated fibroblasts (CAFs)) in the tumor microenvironment (TME). In some embodiments, the anti-FAP CAR iNKT cell is engineered to express an armoring molecule (e.g., soluble IL- 15). In some embodiments, the anti-FAP CAR iNKT cells reduce the immunosuppression in the TME, thereby increasing the efficacy other cancer therapies (e.g., T cell targeting a tumor antigen). In some embodiments, anti-FAP CAR iNKT cells described by the disclosure demonstrate improved properties relative to existing FAP-CAR cell therapy in the art, including killing of FAP-expressing cancer cells in vitro and in vivo', and enhanced persistence in a subject receiving the therapy.

[0088] The foregoing and other aspects, implementations, acts, functionalities, features and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.I. Definitions

[0089] Additional terms of the present disclosure are defined throughout the specification

[0090] Administering: As used herein, the terms “administering” or “administration” means to provide a complex to a subject in a manner that is physiologically and / or pharmacologically useful (e.g., to treat a condition in the subject).

[0091] Affinity Matured Antibody: “Affinity Matured Antibody” is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an improvement in the affinity (i.e., KD, kd or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s). In some embodiments, affinitymatured antibodies will have nanomolar or even picomolar affinities for the target antigen. A variety of procedures for producing affinity matured antibodies are known in the art, including the screening of a combinatory antibody library that has been prepared using biodisplay. For example, Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and / or framework residues is described by Barbas et al., Proc. Nat. Acad. Sci. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169: 147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson et al., J. Immunol., 154(7): 3310-3319 (1995); and Hawkins et al, J. Mol. Biol., 226: 889-896 (1992). Selective mutation at selective mutagenesis positions and at contact or hypermutation positions with an activity-enhancing amino acid residue is described in U.S. Pat. No. 6,914,128 Bl.

[0092] Antibody: As used herein, the term “antibody” or “antibodies” refers to a polypeptide that includes at least one immunoglobulin variable domain or at least one antigenic determinant, e.g., paratope that specifically binds to an antigen. Examples of antibodies include monoclonal antibodies, recombinantly produced antibodies, monospecific antibodies, multi- specific antibodies (including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, immunoglobulins, synthetic antibodies, tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, an antibody heavy chain monomer, an antibody light chain dimer, an antibody heavy chain dimer, an antibody light chain- antibody heavy chain pair, intrabodies, heteroconjugate antibodies, antibody-drug conjugates, single domain antibodies, monovalent antibodies, single chain antibodies or single-chain Fvs (scFv), camelized antibodies, affybodies, Fab fragments, F(ab’)2 fragments, disulfide-linked Fvs (sdFv), anti-idiotypic (anti-Id) antibodies (including, e.g., anti-anti-Id antibodies), and antigen-binding fragments of any of the above. In some embodiments, an antibody is a full-length antibody. In some embodiments, an antibody is a chimeric antibody. In some embodiments, an antibody is a humanized antibody. However, in some embodiments, an antibody is a Fab fragment, a F(ab')2 fragment, a Fv fragment or a scFv fragment. In some embodiments, an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody. In some embodiments, an antibody is a diabody. In some embodiments, an antibody comprises a framework having germline sequence from a species e.g., a human germline sequence). In some embodiments, an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and / or a light (L) chain variable region (abbreviated herein as VL). In someembodiments, the VH comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the heavy chain variable domain provided herein. In some embodiments, the VL comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the light chain variable domain provided herein. In some embodiments, an antibody comprises a constant domain, e.g., an Fc region. An immunoglobulin constant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known. In another embodiment, an antibody comprises a heavy chain constant domain selected from the group consisting of IgG, IgGl, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgAl, IgA2, IgD, IgM, and IgE constant domains. With respect to the heavy chain, in some embodiments, the heavy chain of an antibody described herein can be an alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In some embodiments, the heavy chain of an antibody described herein can comprise a human alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In a particular embodiment, an antibody described herein comprises a human gamma 1 CHI, CH2, and / or CH3 domain. In some embodiments, the amino acid sequence of the VH domain comprises the amino acid sequence of a human gamma (y) heavy chain constant region, such as any known in the art. Non-limiting examples of human constant region sequences have been described in the art, e.g., see U.S. Pat. No. 5,693,780 and Kabat E A et al., (1991) supra. In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecule are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, or a phospholipid unit.

[0093] Approximately: As used herein, the term “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range ofvalues that fall within 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).

[0094] Binding affinity: As used herein, the term “binding affinity” generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an epitope). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair. The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured and / or expressed in a number of ways known in the art, including, but not limited to, equilibrium dissociation constant (KD) and equilibrium association constant (KA). The KD is calculated from the quotient of koff / kon, whereas KA is calculated from the quotient of kon / koff. konrefers to the association rate constant of, e.g., an antibody to an epitope, and koff refers to the dissociation rate constant of, e.g., an antibody to an epitope.

[0095] Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance (SPR), florescent activated cell sorting (FACS) or spectroscopy (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS- P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v / v) surfactant P20) and PBS buffer (lOmM PO4-3, 137mM NaCl, and 2.7mM KC1). These techniques can be used to measure the concentration of bound proteins as a function of target protein concentration. The concentration of bound protein ([Bound]) is generally related to the concentration of free target protein ([Free]) by the following equation:[Bound] = [Free] / (Kd+[Free])

[0096] It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.

[0097] Binding Moiety: As used herein, the term “binding moiety” refers a molecule or part of a molecule that specifically bind or interact with a target molecule via covalentand / or non-coven lent interactions. Binding moieties of the present disclosure include but are not limited to antibodies or antigen-binding fragments thereof (e.g., antibodies, scFv, Fab, Fab’, single chain binding fragment); binding peptides, ligands, receptors, oligonucleotides, small molecules, or aptamers.

[0098] CDR: As used herein, the term “CDR” refers to the complementarity determining region within antibody variable sequences. A typical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding. The VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the IMGT definition, the Chothia definition, the AbM definition, and / or the contact definition, all of which are well known in the art. See, e.g., Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; IMGT®, the international ImMunoGeneTics information system® imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); Lefranc, M.-P., Nucleic Acids Res., 29:207-209 (2001); Lefranc, M.-P., Nucleic Acids Res., 31:307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [Epub], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009);Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17:132-143 (2004). See also bioinf.org.uk / abs. As used herein, a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the Kabat definition.

[0099] Generally, there are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions. The term “CDR set” as used herein refers to a group of three CDRs thatoccur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Sub-portions of CDRs may be designated as LI, L2 and L3 or Hl, H2 and H3 where the “L” and the “H” designates the light chain and the heavy chains regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133-139 (1995)) and MacCallum (J Mol Biol 262(5):732- 45 (1996)). Still other CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems.

[0100] The CDRs of an antibody may have different amino acid sequences when different definition systems are used (e.g., the IM GT definition, the Kabat definition, or the Chothia definition). A definition system annotates each amino acid in a given antibody sequence (e.g., VH or VL sequence as listed in Table 2) with a number, and numbers corresponding to the heavy chain and light chain CDRs are provided in Table 1. The CDRs of the anti-FAP antibodies provided herein (e.g., CDRs listed in Table 2) are defined in accordance with the Kabat definition. One skilled in the art is able to derive the CDR sequences using the different numbering systems for the anti-FAP antibodies provided in Table 2.Table 1. CDR Definitions1IMGT®, the international ImMunoGeneTics information system®, imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999)2Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-32423Chothia et al., J. Mol. Biol. 196:901-917 (1987))

[0101] Chimeric antigen receptor: As used herein, a “chimeric antigen receptor” or “CAR” refers to an engineered receptor that binds specificity for an antigen (e.g., FAP) or other ligand or molecule onto an immune effector cell (e.g., a T cell, NK cell, a NKT cell, an iNKT cell). A chimeric antigen receptor typically comprises at least an extracellular ligandbinding domain or moiety capable of specifically binding an antigen and an intracellular domain that comprises one or more signaling domains and / or co- stimulatory domains.

[0102] In some embodiments, extracellular ligand-binding domain of a CAR is in the form of a binding protein, small molecule, a peptide, a targeting agent, an agonist, or an antagonist. In some embodiments, the binding protein is an antibody, an antigen-binding fragment of an antibody (e.g., a scFv), a ligand, a cytokine, or a receptor. In some embodiments, the antigen binding fragment is a scFv (e.g., a scFv targeting FAP).

[0103] In a particular embodiment, the extracellular ligand-binding domain is in the form of a single-chain variable fragment (scFv) derived from an antibody (e.g., a monoclonal antibody), which provides specificity for a particular epitope or antigen (e.g., an epitope or antigen preferentially present on the surface of a cell, such as a cancer cell or other diseasecausing cell or particle).

[0104] In some embodiments, the CAR comprises an intracellular signaling domain. Intracellular signaling domains are cytoplasmic domains that transmit an activation signal to the cell following binding of the extracellular domain. An intracellular signaling domain can be any intracellular signaling domain of interest that is known in the art. Such cytoplasmic signaling domains can include, without limitation, CD3 C,. In some embodiments, the intracellular domain also includes one or more intracellular co- stimulatory domains, such as those described herein, which transmit a co- stimulatory signal which promotes cell proliferation, cell survival, and / or cytokine secretion after binding of the extracellular domain. Such intracellular co- stimulatory domains can include, without limitation, any costimulatory domain disclosed herein or those domains known in the art, such as, CD27, CD28, CD8, 4-1BB (CD137), 0X40, CD30, CD40, CD127, PD-1, ICOS, lymphocytefunction-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, Nl, N6, or any combination thereof. Additional suitable co-stimulatory domains are described in PCT International Application No.PCT / US2017 / 055133, which is incorporated by reference herein in its entirety. In some embodiments, the co-stimulatory domain is 4-1BB (CD137). In some embodiments, a chimeric antigen receptor further includes additional structural elements, including a transmembrane domain which is attached to the extracellular ligand-binding domain via a hinge or junction sequence. The transmembrane domain can be derived from any membranebound or transmembrane protein. For example, the transmembrane polypeptide can be a subunit of the T-cell receptor (i.e., an a, P, y or polypeptide constituting CD3 complex), IL2 receptor p55 (a chain), p75 (P chain) or y chain, subunit chain of Fc receptors (e.g., Fey receptor III) or CD proteins such as the CD8 alpha chain. Alternatively, the transmembrane domain can be synthetic and can comprise predominantly hydrophobic residues such as leucine and valine. In some embodiments, the CAR comprises a CD8 transmembrane domain. The hinge region refers to any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand-binding domain. For example, a hinge region may comprise up to 300 amino acids, 10 to 100 amino acids and 25 to 50 amino acids. Hinge regions may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region. Alternatively, the hinge region may be a synthetic sequence that corresponds to a naturally occurring hinge sequence, or may be an entirely synthetic hinge sequence. In some embodiments, a hinge domain can comprise a part of a human CD8 alpha chain, FcyRllla receptor or IgGl. In some embodiments, the CAR comprises a CD8 hinge region.

[0105] CDR-grafted antibody: The term “CDR-grafted antibody” refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and / or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.

[0106] Chimeric antibody: The term “chimeric antibody” refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.

[0107] Complementary: As used herein, the term “complementary” refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides. In particular, complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. For example, if a base at one position of an oligonucleotide is capable of hydrogen bonding with a base at the corresponding position of a target nucleic acid (e.g., an mRNA), then the bases are considered to be complementary to each other at that position. Base pairings may include both canonical Watson-Crick base pairing and non- Watson-Crick base pairing (e.g., Wobble base pairing and Hoogsteen base pairing). For example, in some embodiments, for complementary base pairings, adenosine-type bases (A) are complementary to thymidine- type bases (T) or uracil-type bases (U), that cytosine-type bases (C) are complementary to guanosine-type bases (G), and that universal bases such as 3-nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T. Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A, C, U or T.

[0108] Conservative amino acid substitution: As used herein, a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Fourth Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2012, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.

[0109] Co-stimulatory domain: As used herein, a “co-stimulatory domain” refers to a polypeptide domain which transmits an intracellular proliferative and / or cell-survival signal upon activation. Activation of a co- stimulatory domain may occur following homodimerization of two co-stimulatory domain polypeptides. Activation may also occur, for example, following activation of a construct comprising the co-stimulatory domain (e.g., a chimeric antigen receptor or an inducible regulatory construct). Generally, a co-stimulatory domain can be derived from a transmembrane co- stimulatory receptor, particularly from anintracellular portion of a co- stimulatory receptor. Non-limiting examples of co- stimulatory polypeptides include, but are not limited to, 4- IBB, CD28, ICOS, OX-40, and CD27 and any other co-stimulatory domain described further herein. In some embodiments, the CAR described herein comprises a 4- IBB co-stimulatory domain.

[0110] Co-stimulatory signal: As used herein, a “co-stimulatory signal” refers to an intracellular signal induced by a co-stimulatory domain that promotes cell proliferation, expansion of a cell population in vitro and / or in vivo, promotes cell survival, modulates (e.g., upregulates or downregulates) the secretion of cytokines, and / or modulates the production and / or secretion of other immunomodulatory molecules. In some embodiments, a co- stimulatory signal is induced following homodimerization of two co-stimulatory domain polypeptides. In some embodiments, a co-stimulatory signal is induced following activation of a construct comprising the co-stimulatory domain (e.g. a chimeric antigen receptor or an inducible regulatory construct).

[0111] Cross-reactive: As used herein and in the context of a targeting agent (e.g., antibody), the term “cross-reactive,” refers to a property of the agent being capable of specifically binding to more than one antigen of a similar type or class (e.g., antigens of multiple homologs, paralogs, or orthologs) with similar affinity or avidity. For example, in some embodiments, an antibody that is cross-reactive against human and non-human primate antigens of a similar type or class (e.g., a human FAP and non-human primate FAP) is capable of binding to the human antigen and non-human primate antigens with a similar affinity or avidity. In some embodiments, an antibody is cross-reactive against a human antigen and a rodent antigen of a similar type or class. In some embodiments, an antibody is cross-reactive against a rodent antigen and a non-human primate antigen of a similar type or class. In some embodiments, an antibody is cross-reactive against a human antigen, a non- human primate antigen, and a rodent antigen of a similar type or class.

[0112] Effective Amount: As used herein, “an effective amount” refers to the amount of each active agent (e.g., iNKT cells with FAP CAR binding moiety) required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. In some embodiments, the therapeutic effect includes but is not limited to reducing tumor size, eradicating tumor, or alleviating symptoms associated with tumor.

[0113] Epitope: As used herein, an “epitope” is a term in the art and refers to a localized region of an antigen (e.g., a peptide or a peptide-MHC complex) to which an antibody or a chimeric antigen receptor can bind. In certain embodiments, the epitope to 1which an antibody or a chimeric antigen receptor can be determined by, e.g., NMR spectroscopy, X-ray diffraction crystallography studies, ELISA assays, hydrogen / deuterium exchange coupled with mass spectrometry (e.g., liquid chromatography electrospray mass spectrometry), flow cytometry analysis, mutagenesis mapping (e.g., site-directed mutagenesis mapping), and / or structural modeling. For X-ray crystallography, crystallization may be accomplished using any of the known methods in the art (e.g., Giege R et al., (1994) Acta Crystallogr D Biol Crystallogr 5O(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen NE (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251: 6300-6303, each of which is herein incorporated by reference in its entirety).Antibody: antigen crystals may be studied using well-known X-ray diffraction techniques and may be refined using computer software such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see, e.g., Meth Enzymol (1985) volumes 114 & 115, eds Wyckoff HW et al.,; U.S. 20040014194), and BUSTER (Bricogne G (1993) Acta Crystallogr D Biol Crystallogr 49(Pt 1): 37-60; Bricogne G (1997) Meth Enzymol 276A: 361-423, ed Carter CW; Roversi P et al., (2000) Acta Crystallogr D Biol Crystallogr 56(Pt 10): 1316- 1323), each of which is herein incorporated by reference in its entirety. Mutagenesis mapping studies may be accomplished using any method known to one of skill in the art. See, e.g., Champe M et al., (1995) J Biol Chem 270: 1388-1394 and Cunningham BC & Wells JA (1989) Science 244: 1081-1085, each of which is herein incorporated by reference in its entirety, for a description of mutagenesis techniques, including alanine scanning mutagenesis techniques. In some embodiments, the epitope of an antigen is determined using alanine scanning mutagenesis studies. In some embodiments, the epitope of an antigen is determined using hydrogen / deuterium exchange coupled with mass spectrometry.

[0114] Framework: As used herein, the term “framework” or “framework sequence” refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations. The six CDRs (CDR-L1, CDR-L2, and CDR-L3 of light chain and CDR-H1, CDR-H2, and CDR-H3 of heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred by others, represents the combined FRs within the variable region of a single,naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region. Human heavy chain and light chain acceptor sequences are known in the art. In one embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.

[0115] Fibroblast Activation Protein (FAP): The term “fibroblast activation protein” or “FAP”, as used herein, refers to a 97-kDa type II transmembrane serine protease. FAP is a member of the prolyl peptidase family, which also contains dipeptidyl peptidase IV (DPPIV, CD26), DPP7 (DPP II, quiescent cell proline dipeptidase), DPP8, DPP9, and prolyl carboxypeptidase (PCP, angiotensinase C). FAP contains dipeptidyl peptidase enzymatic activity and endopeptidase activity. Exemplary human FAP amino acid sequences are set forth in Accession Number AAB49652.1 (SEQ ID NO: 35). Accession Numbers AAB44837.1, AAE30605.1, AAX04090.1, ADL88098.1, AQN54508.1, ATK13500.1, ATK18094.1, AWT87270.1, AYI13559.1, QBE27403.1, QFN60450.1, QNB70086.1, and QYQ07220.1 also describe the same FAP amino acid sequence of SEQ ID NO: 35.Exemplary mouse FAP amino acid sequences are set forth in Accession Number CAA71116.1 (SEQ ID NO: 36), AND76664.1 (SEQ ID NO: 37), and AAH19190.1 (SEQ ID NO: 38).

[0116] Fibroblast activation protein-a (FAP) is a cell surface antigen expressed on various cells (e.g., reactive stromal fibroblasts in tumor microenvironment, soft tissue sarcomas, granulation tissue of wound healing and certain fetal mesenchymal fibroblasts). The expression level of FAP on certain cells is higher (e.g., fibroblasts in the tumor microenvironment) than FAP expression level on normal tissues. FAP can also be shed from the plasma membrane forming a soluble FAP (Lee et al., Antiplasmin-cleaving enzyme is a soluble form of fibroblast activation protein. Blood (2006) 107:1397-404. 10.118). Hence, it is not restricted to the cell surface.

[0117] Human antibody: The term “human antibody”, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term “human antibody”, as used herein, is not intended to include antibodies in which CDR sequences derived from thegermline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.

[0118] Humanized antibody: The term “humanized antibody” refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and / or VL sequence has been altered to be more “human-like”, i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR-grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences. In one embodiment, humanized anti-FAP antibodies and antigen binding fragments thereof are provided. Such antibodies may be generated by obtaining murine anti- FAP monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT Publication No. WO 2005 / 123126 A2. In some embodiments, a humanized antibody comprises human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some embodiments, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Antibodies may have Fc regions modified as described in WO 99 / 58572. Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.

[0119] Invariant natural killer T cells (iNKT): The term “invariant Natural Killer T cells”, or “invariant NKT cells”, “iNKT cells”, or “Type I NKT cell), as used herein, refer toa population of T lymphocytes expressing a conserved semi-invariant TCR specific for lipid antigens (Ags) restricted for the monomorphic MHC class I-related molecule CD Id. Natural killer T cells (NKT cells) were originally characterized in mice as T cells that express both a TCR and NK1.1 (NKR-Pla-c or CD161), a C-type lectin NK receptor. Invariant NKT (iNKT) cells express a semi-invariant aP TCR (e.g., formed by an invariant TRAV11- TRAJ18 (4) rearrangement in mice, or the homologous invariant TRAV10-TRAJ18 chain in humans), paired with a limited set of diverse VP chains, predominantly TRBV1, TRBV29, or TRBV13 in mice (6) and TRBV25 in humans(see., e.g., Dellabona et al., An invariant V alpha 24-J alpha Q / V beta 11 T cell receptor is expressed in all individuals by clonally expanded CD4-8- T cells. J Exp Med. (1994) 180:1171-6. 10.1084). The semi-invariant TCR recognizes exogenous and endogenous lipid Ags presented by the monomorphic MHC class I-related molecule CDld (see., e.g., Brennan et al., Invariant natural killer T cells: an innate activation scheme linked to diverse effector functions. Nat Rev Immunol. (2013) 13:101-17. 10.1038). Exogenous lipid Ags include the prototypical a-Galactosylceramide (a-GalCer) (Kawano et al., CD Id-restricted and TCR-mediated activation of valphal4 NKT cells by glycosylceramides. Science. (1997) 278:1626-9. 10.1126) and a number of bacterial-derived Ags can activate iNKT cells.

[0120] iNKT cells undergo a distinct developmental pathway compared to T cells, leading to the acquisition of innate effector functions already in the thymus. Thymic iNKT cells indeed express markers usually upregulated by peripheral effector / memory T cells, such as CD44 and CD69, together with distinctive NK differentiation markers, such as NK1.1 (in some mouse genetic backgrounds, CD161 in humans), CD122 (the IL-2R / IL-15R P-chain), CD94 / NKG2 and Ly49(A-J), and a broad spectrum of TH1 / 2 / 17 effector cytokines. Once migrated in the periphery, iNKT cells form a tissue resident population that survey the cellular integrity and rapidly respond to local damage and inflammation, jump starting the reaction by cells of the innate and adaptive immune response.

[0121] Because iNKT cells can rapidly produce IFNy, IL-4, or both, they have been found to play a role in various diseases by establishing a context-dependent Thl- or Th2- based immune response. In bacterial and viral infections, iNKT cells typically help in early control of the pathogen by establishing a productive Thl response. In both mouse and human studies, roles for iNKT cells have been described in diseases associated with excessive Thl responses like type 1 diabetes and chronic obstructive pulmonary disease. Roles have also been described for iNKT cells helping to suppress Thl responses and drive tolerogenicresponses to grafts. As an example, following hematopoietic stem cell transfer, the presence of iNKT cells is predictive for survival with a reduction in graft versus host disease (GvHD) in patients and preclinical models.

[0122] Isolated antibody: An “isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds FAP is substantially free of antibodies that specifically bind antigens other than FAP). Moreover, an isolated antibody may be substantially free of other cellular material and / or chemicals.

[0123] Percent identity: The determination of “percent identity” or “percent identical” between two sequences (e.g., amino acid sequences or nucleic acid sequences) can be accomplished using a mathematical algorithm. A specific, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin S & Altschul SF (1990) PNAS 87: 2264-2268, modified as in Karlin S & Altschul SF (1993) PNAS 90: 5873-5877, each of which is herein incorporated by reference in its entirety. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul SF et al., (1990) J Mol Biol 215: 403, which is herein incorporated by reference in its entirety. BLAST nucleotide searches can be performed with the NBLAST nucleotide program parameters set, e.g., at score=100, word length=12 to obtain nucleotide sequences homologous to a nucleic acid molecule described herein. BLAST protein searches can be performed with the XBLAST program parameters set, e.g., at score=50, word length=3 to obtain amino acid sequences homologous to a protein molecule described herein. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul SF et al., (1997) Nuc Acids Res 25: 3389-3402, which is herein incorporated by reference in its entirety. Alternatively, PSI BLAST can be used to perform an iterated search which detects distant relationships between molecules. Id. When utilizing BLAST, Gapped BLAST, and PSI Blast programs, the default parameters of the respective programs (e.g., of XBLAST and NBLAST) can be used (see, e.g., National Center for Biotechnology Information (NCBI) on the worldwide web, ncbi.nlm.nih.gov). Another specific, nonlimiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CAB IOS 4: 11-17, which is herein incorporated by reference in its entirety. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing theALIGN program for comparing amino acid sequences, a PAM 120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used.

[0124] The percent identity between two sequences can be determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.

[0125] Recombinant antibody: The term “recombinant human antibody”, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425- 445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29:128-145; Hoogenboom H., and Chames P. (2000) Immunology Today 21:371-378), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21:364- 370) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. One embodiment of the disclosure provides fully human antibodies capable of binding human FAP which can be generated using techniques well known in the art, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO 2005 / 007699 A2.

[0126] Single-chain variable fragment (scFv): As used herein, the term “Singlechain variable fragment (scFv)”, refers to a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide. A linker refers to a peptide or a short oligopeptide sequence used to join two subunits into a single polypeptide. A linker may have a sequence that is found in natural proteins, or may bean artificial sequence that is not found in any natural protein. A linker may be flexible and lacking in secondary structure or may have a propensity to form a specific three-dimensional structure under physiological conditions. In some embodiments, the linker is a glycine rich linker. In some embodiments, the linker is rich in serine or threonine. In some embodiments, a scFv is a fusion protein in which the N-terminus of the VH is linked with the C-terminus of the VL. In some embodiments, a scFv is a fusion protein in which the N-terminus of the VL is linked with the C-terminus of the VH. A scFv retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of the linker. In some embodiments, a scFv can be created to facilitate phage display. In some embodiments, a scFv can be created directly from subcloned heavy and light chains derived from a hybridoma. ScFvs have many uses, e.g., flow cytometry, immunohistochemistry, and as antigen-binding domains of a chimeric antigen receptor.

[0127] Specifically binds: As used herein, the term “specifically binds” refers to the ability of a molecule to bind to a binding partner with a degree of affinity or avidity that enables the molecule to be used to distinguish the binding partner from an appropriate control in a binding assay or other binding context. With respect to an antibody, the term, “specifically binds”, refers to the ability of the antibody to bind to a specific antigen with a degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, e.g., to an extent that permits preferential targeting to certain cells, e.g., muscle cells, through binding to the antigen, as described herein. In some embodiments, an antibody specifically binds to a target if the antibody has a KD for binding the target of at least about 10'4M, 10'5M, 10'6M, IO’7M, 10'8M, 10'9M, IO40M, 101M, 102M, 1043M, or less. In some embodiments, an antibody specifically binds to FAP.

[0128] Subject: As used herein, the term “subject” refers to a mammal. In some embodiments, a subject is non-human primate, or rodent. In some embodiments, a subject is a human. In some embodiments, a subject is a patient, e.g., a human patient that has or is suspected of having a disease. In some embodiments, the subject is a human patient who has or is suspected of having cancer (e.g., FAP-expressing colorectal cancer) or conditions associated with the cancer (e.g., colorectal cancer liver metastasis).

[0129] Treatment: As used herein, the term “treating” or “treatment” refers to the application or administration of a composition including one or more active agents (e.g., IL- 15 armored anti-FAP CAR iNKT cells) to a subject, who has a target disease or disorder(e.g., cancer such as colorectal cancer), a symptom of the disease / disorder (e.g., tumor growth, tumor metastasis (e.g., colorectal cancer liver metastasis), fatigue, weight changes including unintended loss or gain, pain, fever, sores that don’t heal, persistent cough or hoarseness, unusual bleeding, or anemia), or a predisposition toward the disease / disorder (e.g., cancer), with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder (e.g., cancer), the symptom of the disease (e.g., tumor growth, tumor metastasis, fatigue, weight changes including unintended loss or gain, pain, fever, sores that don’t heal, persistent cough or hoarseness, unusual bleeding, or anemia), or the predisposition toward the disease or disorder. Alleviating a target disease / disorder includes delaying or preventing the development or progression of the disease, or reducing disease severity.

[0130] Tumor microenvironment (TME): As used herein, the term “tumor microenvironment” or “TME” refers to the fluid, molecules, cells, and / or tissues around and / or at the tumor site. The TME can include normal cells, tumor cells, tumor stromal cells (e.g., stromal fibroblasts), blood vessels, blood, immune cells, and the non-cellular components (e.g., extracellular matrix such as collagen, fibronectin, hyaluronan, laminin, and secreted molecules such as cytokines, etc).II. Method of Treating Colorectal Cancer Liver Metastasis using anti-FAP CAR iNKT cells

[0131] Aspects of the present disclosure provides a plurality of genetically modified immune cells (e.g., iNKT cells) expressing anti-fibroblast activation protein (FAP) chimeric antigen receptor for the treatment of cancer (e.g., colorectal cancer) and associated conditions (e.g., colorectal cancer liver metastasis). In some embodiments, the iNKT cell can be engineered to express a chimeric antigen receptor that comprises any of the FAP binding moieties described herein (e.g., the anti-FAP antibody or antigen binding fragment as described in Table 2, and the existing FAP binding moieties as provided in Table 3) as the extracellular ligand-binding domain. In some embodiments, the genetically modified iNKT cells expressing anti-FAP CAR of the present disclosure can be engineered to further express soluble IE- 15. In some embodiments, the present disclosure relates to methods of treating a disease (e.g., cancer) using the genetically modified immune cells (e.g., anti-FAP iNKT cells) described herein. As used herein, "engineered to express" means that the cell expresses or iscapable of expressing the molecule (e.g., immunoregulatory gene product or armor) that it is engineered to express.

[0132] In some embodiments, FAP is associated with cancer. In some embodiments, FAP has been previously described to promote tumor growth via multiple mechanisms, including but limited to: promoting proliferation, invasion, angiogenesis, epithelial-to- mesenchymal transition, stem cell promotion, immunosuppression and / or drug resistance (e.g., Fitzgerald et al., The role of fibroblast activation protein in health and malignancy, Cancer Metastasis Rev. 2020 Sep; 39(3): 783-803). In some embodiments, FAP is highly expressed in stroma cells (e.g., cancer associated fibroblasts (CAFs) in the tumor microenvironment (TME). In some embodiments, FAP plays an immunosuppressive role in the TME. Cancers expressing FAP include but are not limited to: breast cancer, colorectal cancer, pancreatic cancer, gastric cancer, brain cancer, ovarian cancer, myeloma, Melanoma, or sarcoma. In some embodiments, FAP is associated with non-cancer diseases, such as multiple human pathologies including fibrosis, arthritis, atherosclerosis, autoimmune diseases, metabolic diseases and cancer. In some embodiments, FAP is associated with progression and heightened severity of the disease (e.g., progression and heightened severity of cancer and / or non-cancer diseases).

[0133] Therapeutics targeting FAP have previously been described (e.g., Schuberth et al., Treatment of malignant pleural mesothelioma by fibroblast activation protein-specific redirected T cells. J Transl Med (2013) 11:1-11), for example, FAP inhibitors (e.g., Talabostat), anti-FAP antibodies (e.g., sibrotuzumab), FAP vaccines, FAP CAR T Cells (e.g., Bughda et al., Fibroblast Activation Protein (FAP)-Targeted CAR-T Cells: Launching an Attack on Tumor Stroma, ImmunoTargets and Therapy 2021:10 313-323; Wang et al., Targeting Fibroblast Activation Protein in Tumor Stroma with Chimeric Antigen Receptor T Cells Can Inhibit Tumor Growth and Augment Host Immunity without Severe Toxicity, Cancer Immunol Res; 2(2) February 2014). However, the clinical use of FAP CAR T cells were not successful. In some cases, FAP CAR T cells failed to regulate tumor growth, and induced lethal bone toxicity and cachexia, (e.g., through the lysis of multipotent bone marrow stromal cells) (Tran et al., Immune targeting of fibroblast activation protein triggers recognition of multipotent bone marrow stromal cells and cachexia. J Exp Med (2013) 210:1125-35. 10.1084).

[0134] In some embodiments, the genetically modified immune cells (e.g., iNKT cell) described herein (e.g., iNKT cell) express a CAR that combines an antigen recognitiondomains (e.g., an anti-FAP antibody or antigen binding fragment described herein), a transmembrane domain (e.g., a CD8 transmembrane domain), a cytoplasmic domain (e.g., an intracellular domain of CD3-zeta, CD28, 0X40, 4- IBB, or any combinations thereof), and a co-stimulatory domain (e.g., a 4-1BB costimulatory domain). Therefore, in some embodiments, the transduced immune cell (e.g., iNKT cell) can elicit a direct immune response (e.g., CAR-mediated immune response)), and / or indirect immune response (e.g., NK cell response) in a subject. In some embodiments, the present disclosure provides the use of a CAR to redirect the specificity of a primary iNKT cell to a tumor antigen (e.g., FAP). Thus, in some embodiments, the present disclosure also provides a method for stimulating an iNKT cell-mediated immune response to a target cell population or tissue in a subject (e.g., a mammal) comprising the step of administering to the subject a plurality of iNKT cell that expresses a CAR (e.g., an anti-FAP CAR), wherein the CAR comprises a binding moiety that specifically interacts with a predetermined target (e.g., FAP), a transmembrane domain (e.g., CD8 transmembrane domain), a zeta chain portion comprising for example the intracellular domain of human CD3zeta, and a costimulatory signaling region. In some embodiments, the present disclosure includes a type of cellular therapy where iNKT cells are genetically modified (i.e., engineered) to express a CAR (e.g., anti-FAP CAR), and IL-15 (e.g., soluble IL- 15 (sIL- 15)). "Engineered to express" means that the cell expresses or is capable of expressing the molecule (e.g., immunoregulatory gene product or armor). In some embodiments, the present disclosure includes a type of cellular therapy where anti-FAP CAR iNKT cells of the present disclosure are administered (e.g., injected, infused, etc.) to a subject in need thereof. The infused cells are able to kill tumor cells in the recipient. Unlike antibody therapies, CAR iNKT cells are able to replicate in vivo resulting in long-term persistence that can lead to sustained tumor control. In some embodiments, the secretion of sIL-15 by the iNKT cell expressing an anti-FAP CAR enhanced iNKT cell persistence in a subject. Further, previous studies have shown that, iNKT cells numbers are reduced in cancer tissue (e.g., solid tumor such as lung cancer, head and neck cancer, colorectal cancer, renal cancer, etc) compared to normal tissue. In some embodiments, in certain cancers, iNKT cells functions are impaired. Accordingly, administration of the anti-FAP iNKT cells described herein may restore and enhance iNKT function in the subject, thereby leading to better prognosis.

[0135] In some embodiments, the antigen binding domain in the CAR of the present disclosure targets a tumor antigen (e.g., FAP) for the purposes of treating a cancer. In someembodiments, the antigen binding moiety portion of the CAR of the present disclosure is designed to treat a particular cancer (e.g., cancer expressing FAP).

[0136] In some embodiments, the present disclosure provides compositions (e.g., anti-FAP CAR iNKT cells that also express sIL-15) for treating colorectal cancer liver metastasis. In some embodiments, the method comprising administering a subject having colorectal cancer liver metastasis an effective amount of an iNKT cell described herein (e.g., anti-FAP CAR iNKT cells that also express sIL- 15).

[0137] Colorectal cancer (CRC) includes cancers that involve colon and / or rectum cancer. CRC is a disorder that occurs in the colon or rectum. In some cases, CRC is caused by the colon’s aberrant proliferation of glandular epithelial cells. There are three types of CRC: Sporadic, hereditary, and colitis-associated. Both environmental and genetic factors determine the risk of developing CRC. CRC is genetically diverse (i.e., it can develop through various unique mechanisms). CRC develops when epithelial cells acquire a series of genetic or epigenetic changes that enable them to be hyperproliferative. These rapidly developing cells form a benign adenoma, which can advance to cancer and metastasize via several distinct pathways, including micro satellite instability (MSI), chromosomal instability (ON), and serrated neoplasia.

[0138] Metastasis is the major cause of death in patients with colorectal carcinoma (CRC). In some cases, some of most common sites of metastasis is the liver. The occurrence and development of CRC liver metastasis (CRC liver mets) is especially complex and involves many molecular mechanisms, including non-coding RNAs (ncRNAs), Notch pathway, TGFP signaling, Tyrosine kinase c-MET signaling, phosphatase of regenerating liver (PRL3), tumor-associated calcium signal transducer 2(Trop-2), LI cell adhesion molecule (L1CAM), S100 family proteins S100A4 and S100A8 and other pathways. Further, development of CRC liver mets is also closely related to the tumor microenvironment (TME), which involves various factors and cells surrounding the cancer cells (e.g., immune cells such as macrophages, T cells, B cell, cytokines, chemokines and / or exsomes). The interaction of internal and external environment jointly initiates and drives the occurrence of CRC liver mets.

[0139] Tumor microenvironment plays a pivotal role in CRC liver mets. The liver is an important immune organ of the human body. In some embodiments, a subject having CRC has weakened immune response in the liver, which can promote the survival and growth of CRC metastases. In some embodiments, a suppressive immunologic microenvironment (e.g., tumor-associated- macrophages (TAMs) and regulatory T cells (Treg)) plays tumorpromoting role of CRC liver mets. In some embodiments, TAMs maintain the immunosuppressive environment by expressing immune suppressive mediators (e.g., checkpoint ligand programmed death ligand 1 (PDL1), PDL2 etc..). In some embodiments, TAMs maintain the immunosuppressive environment by activating Treg cells via secreting IL-10 and TGFp. In some embodiments, TAMs also release a plethora of ECM remodeling factors (plasminogen activation system, matrix metalloproteinases (MMPs), and kallikrein- related peptidases) and a diverse array of proteolytic enzymes such as MMPs that degrades the ECM proteins. These factors, in turn, enhance migration of CRC tumor cells into the liver (see, e.g., Zhou et al., Colorectal liver metastasis: molecular mechanism and interventional therapy, Signal Transduction and Targeted Therapy volume 7, Article number: 70 (2022). In some embodiments, the chemokine CXCL12 (also known as stromal-cell-derived factor 1 of the bone marrow (SDF-1)), plays a role in CRC liver mets. The interaction of CXCL12 with its receptor CXCR4 and / or CCR7 are associated with CRC liver mets. In some embodiments, activation of CXCL12 / CCR4 axis in CRC increases pre-metastatic signaling. In some embodiments, CCR4 / CCR7 are overexpressed in CRC cancer cells which indicates cancer progression and metastasis. In some embodiments, activation of the CXCR4 / CXCL12 axis activates the TGF-P pathway to promote invasion, angiogenesis, and promotion of distant metastasis (e.g., by promoting differentiation of hepatic stellate cells into CAFs (see, e.g., Tan et al. CXCR4 / TGF-B 1 Mediated Hepatic Stellate Cells Differentiation into Carcinoma- Associated Fibroblasts and Promoted Fiver Metastasis of Colon Cancer. Cancer Biol. 2020;21:258-268).

[0140] In some embodiments, a subject having CRC liver mets is a subject having Microsatellite-Stable (MSS) Colorectal Cancer. MSS colorectal cancer carries characteristics of chromosomal instability, in which aberration occurs at the larger scale of the genomic structure, with lower tumor mutation burden and neoantigen generation. In some cases, MSS colorectal cancer has a “immune cold” biology and is immunotherapy resistance. In some embodiments, the composition (e.g., anti-FAP CAR iNKT cells that expresses sIE-15) and methods described herein are effective in treating MSS colorectal cancer. The tumor microenvironment of MSS CRC plays a role in its resistance to immunotherapies (e.g., immune checkpoint inhibitor therapy). In some embodiments, the MSS colorectal cancer tumor microenvironment hosts more tumor-associated macrophages contributes to the immuno-suppressive nature of the TME.

[0141] In some embodiments, the composition (e.g., anti-FAP CAR iNKT cells that expresses sIL-15) and methods described herein are effective in treating MSS colorectal cancer. In some embodiments, the composition (e.g., anti-FAP CAR iNKT cells that expresses sIL-15) and methods described herein are effective in treating MSS colorectal cancer liver met. In some embodiments, the composition (e.g., anti-FAP CAR iNKT cells that expresses sIL-15) and methods described herein enhances the efficacy of other immunotherapies (e.g., checkpoint inhibitor therapy, CART therapy) in MSS colorectal cancer. In some embodiments, the composition (e.g., anti-FAP CAR iNKT cells that expresses sIL-15) and methods described herein enhances the efficacy of other immunotherapies (e.g., checkpoint inhibitor therapy, CART therapy) in MSS colorectal cancer liver mets. Treatment efficacy can be measured using any suitable method, e.g., tumor size, metastasis sites, diagnostic and / or prognostic markers, general well-being of the subjects, etc.). In some embodiments, anti-FAP CAR iNKT cells of the present disclosure kill FAP expressing stroma cells in the TME (e.g., CAFs derived from hepatic satellite cells). In some embodiments, anti-FAP CAR iNKT cells of the present disclosure do not kill normal cells expressing lower level of FAP compared to stroma cells in cancer. In some embodiments, FAP expression is high in cancers cells, including but not limited to breast cancer, lung cancer, colorectal cancer, prostate cancer, stomach cancer, pancreatic cancer, prostate cancer, thyroid cancer, cervical cancer, urothelial cancers, or sarcoma compared to FAP expression in normal tissues. In some embodiments, FAP expression is high in CRC cancer cells. In some embodiments, FAP expression is high in stromal cells (e.g., CAFs) in TME of CRC cancer liver mets. FAP expression level can be measured by any suitable methods known in the art, e.g., by flow cytometry, immunoblot, RT-PCR, etc.

[0142] Expression of FAP is an important characteristic of CAFs (Garin-Chesa et al., Cell surface glycoprotein of reactive stromal fibroblasts as a potential antibody target in human epithelial cancers. Proc Natl Acad. Sci USA. 1990;87(18):7235— 7239). FAP activity impacts the secreted CAF proteome, leading to reduced levels of anti- angiogenic factors (e.g., PEDF, angiopoietin-1, VEGFC), and regulates matrix processing enzymes (e.g., Koczorowska et al., Fibroblast activation protein- alpha, a stromal cell surface protease, shapes key features of cancer associated fibroblasts through proteome and degradome alterations. Mol Oncol. 2016; 10( l):40— 58). Further, FAP remodels the ECM through the endopeptidase activity by cleaving the collagen and modifying bioactive signaling peptides in cancer (Kelly et al., Fibroblast activation protein-alpha and dipeptidyl peptidase IV (CD26):cell-surface proteases that activate cell signaling and are potential targets for cancer therapy. Drug Resist Updat. 2005;8(l-2):51-58). FAP expression in cancer is thought to be associated with poor prognosis. In some embodiments, high level expression of FAP in the TME plays an immunosuppressive role (Kraman et al., Suppression of antitumor immunity by stromal cells expressing fibroblast activation protein-alpha. Science. 2010;330(6005):827-830). Not wishing to be bound to any particular theory, FAP drives the CAFs towards mediating tumor immunosuppression by recruiting myeloid-derived suppressor cells (MDSCs) in the TME (e.g., Yang et al., FAP promotes immunosuppression by cancer-associated fibroblasts in the tumor microenvironment via STAT3-CCL2 signaling. Cancer Res. 2016;76(14):4124-4135).

[0143] FAP-targeting CAR-T cells have been engineered to target CAFs in various solid cancers, such as mesothelioma, lung and pancreatic cancers (e.g., Bughda et al., Fibroblast Activation Protein (FAP)-Targeted CAR-T Cells: Launching an Attack on Tumor Stroma, ImmunoTargets and Therapy 2021:10 313-323; Wang et al., Targeting Fibroblast Activation Protein in Tumor Stroma with Chimeric Antigen Receptor T Cells Can Inhibit Tumor Growth and Augment Host Immunity without Severe Toxicity, Cancer Immunol Res; 2(2) February 2014; Rodriguez-Garcia A, Palazon A, Noguera-Ortega E, Powell DJ, Guedan S. CAR-T cells hit the tumor microenvironment: strategies to overcome tumor escape. Front Immunol. 2020; 11). However, on-target off-tumor toxicity was observed in these studies because while FAP is highly expressed in these cancers, it is also found to express at low level in normal cells (e.g., skeletal muscle, adipose tissue, and pancreas, etc.).

[0144] In some embodiments, the present disclosure provides anti-FAP CAR iNKT cells engineered to kill high FAP expressing stroma cells (e.g., CAFs derived from hepatic satellite cells in the TME of colorectal cancer liver mets). In some embodiments, anti-FAP CAR iNKT cells described herein show reduced or lack on-target off-tumor toxicity. In some embodiments, anti-FAP CAR iNKT cells kill FAP-expressing tumor cells and / or FAP expressing CAFs. In some embodiments, depletion of FAP expressing stroma cells (e.g., CAFs derived from hepatic satellite cells in the TME of colorectal cancer liver mets) by anti- FAP CAR iNKT cells described herein reduces immunosuppression in the TME. In some embodiments, depletion of FAP expressing stroma cells (e.g., CAFs derived from hepatic satellite cells in the TME of colorectal cancer liver mets) by anti-FAP CAR iNKT cells described herein lead to more immune cell infiltration into the tumor (e.g., CRC or CRC liver mets). In some embodiments, anti-FAP CAR iNKT cells described herein are armored (e.g., secreting IL- 15) to prolong persistence of CAR iNKT cells in the TME. In someembodiments, anti-FAP CAR iNKT cells described herein are armored (e.g., secreting IL- 15) to enhance certain properties of the anti-FAP CAR iNKT cells (e.g., enhanced killing efficiency, prolonged persistence in the subject, and / or potentiated tumor killing by an additional cancer therapy (e.g., CAR T cells targeting a tumor antigen) relative to the iNKT cells without the armoring molecule).

[0145] The CAR-modified iNKT cells of the present disclosure may also serve as a type of vaccine for ex vivo immunization and / or in vivo therapy in a mammal. Preferably, the mammal is a human.

[0146] In some embodiments, the iNKT cells as described herein may be utilized in the treatment and prevention of diseases (e.g., CRC and / or CRC liver mets) that arise in individuals who are immunocompromised. In particular, the iNKT cells expressing the anti- FAP CAR of the present disclosure are used in the treatment of cancer, such as FAP positive CRC or CRC liver mets. In certain embodiments, the iNKT cells expressing the anti-FAP CAR of the present disclosure are used in the treatment of patients at risk for developing cancer such as FAP positive cancer (e.g., CRC liver mets). In some embodiments, the cancer is a primary cancer such as CRC. In some embodiments, the cancer is a metastatic cancer such as CRC liver mets.

[0147] In some embodiments, administration of an anti-FAP iNKT cell described herein reduces primary CRC tumor burden by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or 100% relative to CRC primary tumor burden prior to administration. In some embodiments, administration of an anti-FAP iNKT cell described herein reduces primary CRC tumor burden by the range of l%-100%, l%-90%, 1 %-80%, l%-70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%-90%, 5%-80%, 5%-70%, 5%-60%, 55%- 50%, 5%-40%, 5%-30%, 5%-20%, 5%-10%, 5%-8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%-30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%-40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%-40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%-90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%-100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, or 90%-100% relative to CRC primary tumor burden prior to administration.

[0148] In some embodiments, administration of an anti-FAP iNKT cell described herein reduces CRC liver mets tumor burden by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or 100% relative to CRC liver mets tumor burden prior to administration. In some embodiments, administration of an anti-FAP iNKT cell described herein reduces CRC liver mets tumor burden by the range of l%-100%, l%-90%, 1 %-80%, l%-70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%-90%, 5%-80%, 5%-70%, 5%-60%, 55%- 50%, 5%-40%, 5%-30%, 5%-20%, 5%-10%, 5%-8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%-30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%-40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%-40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%-90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%-100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, or 90%-100% relative to CRC liver mets tumor burden prior to administration.

[0149] In some embodiments, administration of an anti-FAP iNKT cell described herein reduces FAP expressing CAFs in CRC or CRC liver mets by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or 100% relative to FAP expressing CAF level prior to administration. In some embodiments, administration of an anti-FAP iNKT cell described herein reduces FAP expressing CAFs in CRC or CRC liver mets by the range of l%-100%, l%-90%, l%-80%, l%-70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%- 90%, 5%-80%, 5%-70%, 5%-60%, 55%-50%, 5%-40%, 5%-30%, 5%-20%, 5%-10%, 5%- 8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%- 30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%- 40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%- 40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%- 90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%- 100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, or 90%-100% relative to FAP expressing CAF level prior to administration.

[0150] In some embodiments, administration of an anti-FAP iNKT cell described herein reduces CXCL12 expression level and / or activity in CRC liver mets by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or 100% relative to CXCL12 level and / or activity prior to administration. In some embodiments, administration of an anti- FAP iNKT cell described herein reduces CXCL12 expression level and / or activity in CRC liver mets by the range of l%-100%, l%-90%, l%-80%, l%-70%, l%-60%, l%-70%, 1%- 60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%-90%, 5%-80%, 5%-70%, 5%-60%, 55%-50%, 5%-40%, 5%-30%, 5%-20%, 5%-10%, 5%-8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%- 40%, 10%-30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%- 50%, 20%-40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%- 50%, 30%-40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%- 100%, 50%-90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%- 70%, 70%-100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, or 90%-100% relative to CXCL12 level and / or activity prior to administration.

[0151] In some embodiments, administration of an anti-FAP iNKT cell described herein increases T cell (e.g., CD8+ T cell) infiltration in CRC liver mets by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 100%, at least 2 folds, at least 5 folds, at least 10 folds, at least 20 folds, at least 25 folds, at least 50 folds, at least 75 folds, at least 100 folds, at least 200 folds, at least 300 folds, at least 500 folds, at least 750 folds, at least 1000 folds, or more relative to the infiltrated T cell level prior to administration. In some embodiments, administration of an anti-FAP iNKT cell described herein increases T cell (e.g., CD8+ T cell) infiltration in CRC liver mets by the range of 1%- 100%, l%-90%, l%-80%, l%-70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, 1%- 30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%-90%, 5%-80%, 5%-70%, 5%-60%, 55%-50%, 5%-40%, 5%-30%, 5%-20%, 5%-10%, 5%-8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%-30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%-40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%-40%, 40%-100%,40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%-90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%-100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, 90%-100%, 1-1000 folds, 1-750 folds, 1-500 folds, 1-100 folds, 1-50 folds, 1-25 folds, 1-20 folds, 1-10 folds, 1-5 folds, 1-4 folds, 1-3 folds, 1-2 folds, 2-1000 folds, 2-750 folds, 2-500 folds, 2-100 folds, 2-50 folds, 2-25 folds, 2-20 folds, 2-10 folds, 2-5 folds, 5-1000 folds, 5-750 folds, 5-500 folds, 5-100 folds, 5-50 folds, 5-25 folds, 5- 20 folds, 5-15 folds, 5-10 folds, 5-8 folds, 5-6 folds, 10-1000 folds, 10-750 folds, 10-500 folds, 10-100 folds, 10-50 folds, 10-25 folds, 10-20 folds, 10-15 folds, 20-1000 folds, 20-750 folds, 20-500 folds, 20-100 folds, 20-50 folds, 20-25 folds, 50-1000 folds, 50-750 folds, SO- SOO folds, 50-100 folds, 50-75 folds, 100-1000 folds, 100-750 folds, 100-500 folds, or 100- 250 folds relative to the infiltrated T cell level prior to administration.

[0152] In some embodiments, administration of an anti-FAP iNKT cell described herein increases proinflammatory cytokines (e.g., CX3CL1, CXCL9, CCL3, IL-8, CD40L, CD137, IFNy, GZMB, and / or FasL) in CRC liver mets by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 100%, at least 2 folds, at least 5 folds, at least 10 folds, at least 20 folds, at least 25 folds, at least 50 folds, at least 75 folds, at least 100 folds, at least 200 folds, at least 300 folds, at least 500 folds, at least 750 folds, at least 1000 folds, or more relative to the proinflammatory cytokine levels prior to administration. In some embodiments, administration of an anti-FAP iNKT cell described herein increases proinflammatory cytokines (e.g., CX3CL1, CXCL9, CCL3, IL-8, CD40L, CD137, IFNy, GZMB, and / or FasL) in CRC liver mets by the range of l%-100%, l%-90%, 1 %-80%, 1%- 70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%-90%, 5%-80%, 5%-70%, 5%-60%, 55%-50%, 5%- 40%, 5%-30%, 5%-20%, 5%-10%, 5%-8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%-30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%-40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%-40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%-90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%-100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, 90%-100%, 1-1000 folds, 1-750 folds, 1-500 folds, 1-100 folds, 1-50 folds, 1-25 folds, 1-20 folds, 1-10 folds, 1-5 folds, 1-4 folds, 1-3 folds, 1-2 folds, 2-1000 folds, 2-750 folds, 2-500folds, 2-100 folds, 2-50 folds, 2-25 folds, 2-20 folds, 2-10 folds, 2-5 folds, 5-1000 folds, 5- 750 folds, 5-500 folds, 5-100 folds, 5-50 folds, 5-25 folds, 5-20 folds, 5-15 folds, 5-10 folds, 5-8 folds, 5-6 folds, 10-1000 folds, 10-750 folds, 10-500 folds, 10-100 folds, 10-50 folds, 10- 25 folds, 10-20 folds, 10-15 folds, 20-1000 folds, 20-750 folds, 20-500 folds, 20-100 folds, 20-50 folds, 20-25 folds, 50-1000 folds, 50-750 folds, 50-500 folds, 50-100 folds, 50-75 folds, 100-1000 folds, 100-750 folds, 100-500 folds, or 100-250 folds relative to the proinflammatory cytokine levels prior to administration.

[0153] In certain embodiments, the subject does not undergo lymphodepletion prior to, or concurrent with, treatment with an anti-FAP CAR iNKT cell or pharmaceutical composition as disclosed herein. Lymphodepletion is frequently performed prior to immunotherapies, such as adoptive cell therapy such as CAR T therapies. In some instances, subject receiving adoptive cell therapy receive a course of chemotherapy to deplete the T cells from the subject, for instance, to debulk a tumor, alter tumor phenotype, modify the tumor microenvironment, remove cytokine sinks (e.g., make IL-2, IL-7, and IL-15 more available) and suppress the host immune system. In some instances, lymphodepletion can effectively prolong the persistence of infused cells and increase the effectiveness of treatment. However, lymphodepletion has multiple negative effects including, neutropenia, anemia, thrombocytopenia, and immunosuppression, and toxicities associated with lymphodepletion agents such as fludarabine and cyclophosphamide. In some embodiments, subject receiving iNKT cell therapy (e.g., anti-FAP CAR iNKT cell therapy) does not need lymphodepletion therapy. In certain embodiments, the subject does not receive treatment with, fludarabine, or cyclophosphamide prior to, or concurrent with, administration of the anti-FAP CAR iNKT cells or a pharmaceutical composition as disclosed herein. In some embodiments, iNKT cell therapy (e.g., anti-FAP CAR iNKT cell therapy or a composition thereof) without lymphodepletion are effective in reducing tumor burden and / or improve survival. In some embodiments, iNKT cell therapy (e.g., anti-FAP CAR iNKT cell therapy or a composition thereof) without lymphodepletion exhibit long term efficacy in killing cancer cells. In some embodiments, iNKT cell therapy (e.g., anti-FAP CAR iNKT cell therapy or a composition thereof) without lymphodepletion does not induce graft-versus-host disease (GVHD).

[0154] In some embodiments, the iNKT cells expressing the anti-FAP CAR of the present disclosure, or a composition comprising such cells, may be used, or may be administered to a subject in need thereof, to provide anti-tumor immunity; to treat or preventcancer; to reduce immunosuppression in the TME; and / or to increase therapeutic efficacy of other therapeutic agents (e.g., CAR-T cells or immune check point inhibitors). In some embodiments, the cancer is a FAP-expressing cancer. In some embodiments, the cancer is breast cancer, lung cancer, head and neck cancer, colorectal cancer, prostate cancer, stomach cancer, pancreatic cancer, prostate cancer, thyroid cancer, cervical cancer, renal cancer, urothelial cancers, or sarcoma.

[0155] In some embodiments, the iNKT cells expressing the anti-FAP CAR of the present disclosure may be administered either alone, or as a composition (e.g., a pharmaceutical composition) in combination with diluents and / or with other components such as IE-2 or other cytokines or cell populations. Briefly, pharmaceutical compositions of the present disclosure may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.

[0156] Pharmaceutical compositions of the present disclosure may be administered in a manner appropriate to the disease to be treated (or prevented). The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials. In some embodiments, compositions of the present disclosure are formulated for intravenous administration.

[0157] When “an immunologically effective amount”, “an anti-tumor effective amount”, “a tumor-inhibiting effective amount”, or “therapeutic amount” is indicated, the precise amount of the compositions of the present disclosure to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the CAR-modified immune cells (e.g., iNKT cells expressing anti-FAP CAR) described herein may be administered at a dosage of 104to 109cells / kg body weight, 105to 106cells / kg body weight, including all integer values within those ranges. iNKT cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniquesthat are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988).

[0158] The administration of the subject compositions may be carried out in any convenient manner, including infusion, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumor ally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In some embodiments, the immune cell (e.g., iNKT cell) compositions of the present disclosure are administered to a patient by intradermal or subcutaneous injection. In some embodiments, the immune cell (e.g., iNKT cell) compositions of the present disclosure are preferably administered by i.v. injection. The compositions of immune cells (e.g., iNKT cells) may also be injected directly into a tumor, lymph node, or site of disease.

[0159] In some embodiments, iNKT cells (e.g., anti-FAP CAR iNKT cell) activated and expanded using the methods described herein, or other methods known in the art, are expanded to therapeutic levels, are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizumab treatment for MS patients or efalizumab treatment for psoriasis patients or other treatments for PML patients. In some embodiments, the iNKT cells of the present disclosure may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludaribine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, and irradiation. In some embodiments, the cell compositions of the present disclosure are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH. In some embodiments, the cell compositions of the present disclosure are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan. For example, in some embodiments, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In some embodiments, following the transplant, subjects receive an infusion of the expanded immune cells (e.g.,iNKT cell) of the present disclosure. In an additional embodiment, iNKT cells are administered before or following surgery.

[0160] In some embodiments, the present disclosure also contemplates treating cancer using the anti-FAP CAR iNKT cells in combination with one or more additional therapeutic agents. In some embodiments, the additional therapeutic agent is a T cell targeting a tumor antigen (e.g., T cell or a CAR T cell), including but not limited to: ErbB2 (HER2 / neu), carcinoembryonic antigen (CEA), epithelial cell adhesion molecule (EpCAM), epidermal growth factor receptor (EGFR), EGFR variant III (EGFRvIII), vascular endothelial growth factor receptor 2 (VEGFR2), IL13R, GD3, c-type lectin-like molecule 1 (CLL1), cholecy to skinin B receptor (CCKBR), gonadotropin releasing hormone receptor (GnRHR), somatostatin receptor 2 (SSRT2), gastrin-releasing peptide receptor (GRPR), neurokinin 1 receptor (NK1R), CD19, CD20, CD30, CD40, disialoganglioside GD2, ductal-epithelial mucine, folate receptor, gp36, TAG-72, glyco sphingolipids, glioma-associated antigen, B - human chorionic gonadotropin, alphafetoprotein (AFP), neurotensin receptor 1 (NTSR1), lectin-reactive AFP, thyroglobulin, RAGE-1, MN-CA IX, human telomerase reverse transcriptase, RU1, RU2 (AS), intestinal carboxyl esterase, mut hsp70-2, M-CSF, prostase, prostate specific antigen (PSA), PAP, NY-ESO-1, LAGA-la, p53, prostein, PSMA, surviving and telomerase, prostate-carcinoma tumor antigen- 1 (PCTA-1), MAGE, ELF2M, neutrophil elastase, ephrin B2, CD22, insulin growth factor (IGFl)-l, IGF- II, IGFI receptor, mesothelin, a major histocompatibility complex (MHC) molecule presenting a tumor- specific peptide epitope, melanocortin 1 receptor (MC1R), 5T4, ROR1, Nkp30, NKG2D, tumor stromal antigens, the extra domain A (EDA) and extra domain B (EDB) of fibronectin and the Al domain of tenascin-C (TnC Al), lineage- specific or tissue specific antigen such as CD3, CD4, CD8, CD24, CD25, CD33, CD34, CD133, CD138, CTLA-4, B7- 1 (CD80), B7-2 (CD86), endoglin, a major histocompatibility complex (MHC) molecule, FAP (CD269, TNFRSF 17), CS 1, or a virus-specific surface antigen such as an HIV-specific antigen (such as HIV gpl20); an EBV-specific antigen, a CMV-specific antigen, a HPV-specific antigen such as the E6 or E7 oncoproteins, a Lasse Virus-specific antigen, an Influenza Virus - specific antigen, as well as any derivate or variant of these surface markers. In some embodiments, treatment using the anti-FAP CAR iNKT cells described herein reduces the immunosuppression in the TME, increases CAR T cell infiltration into the tumor, thereby increasing the CAR T cell efficacy. In some embodiments, the anti-FAP CAR iNKT cells secrets IL- 15, which potentiates the cytotoxic activity of CAR T cells.

[0161] In some embodiments, administration of an anti-FAP iNKT cell described herein in combination with a CAR T cell increases tumor killing efficacy of the CAR T cell in CRC liver mets by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 100%, at least 2 folds, at least 5 folds, at least 10 folds, at least 20 folds, at least 25 folds, at least 50 folds, at least 75 folds, at least 100 folds, at least 200 folds, at least 300 folds, at least 500 folds, at least 750 folds, at least 1000 folds, or more relative to administration of the CAR T cell alone. In some embodiments, administration of an anti-FAP iNKT cell described herein in combination with a CAR T cell increases tumor killing efficacy of the CAR T cell increases tumor killing efficacy of the CAR T cell in CRC liver mets by the range of 1%- 100%, l%-90%, l%-80%, l%-70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%- 90%, 5%-80%, 5%-70%, 5%-60%, 55%-50%, 5%-40%, 5%-30%, 5%-20%, 5%-10%, 5%- 8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%- 30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%- 40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%- 40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%- 90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%- 100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, 90%-100%, 1-1000 folds, 1-750 folds,1-500 folds, 1-100 folds, 1-50 folds, 1-25 folds, 1-20 folds, 1-10 folds, 1-5 folds, 1-4 folds, 1- 3 folds, 1-2 folds, 2-1000 folds, 2-750 folds, 2-500 folds, 2-100 folds, 2-50 folds, 2-25 folds,2-20 folds, 2-10 folds, 2-5 folds, 5-1000 folds, 5-750 folds, 5-500 folds, 5-100 folds, 5-50 folds, 5-25 folds, 5-20 folds, 5-15 folds, 5-10 folds, 5-8 folds, 5-6 folds, 10-1000 folds, 10- 750 folds, 10-500 folds, 10-100 folds, 10-50 folds, 10-25 folds, 10-20 folds, 10-15 folds, 20- 1000 folds, 20-750 folds, 20-500 folds, 20-100 folds, 20-50 folds, 20-25 folds, 50-1000 folds, 50-750 folds, 50-500 folds, 50-100 folds, 50-75 folds, 100-1000 folds, 100-750 folds, 100- 500 folds, or 100-250 folds relative to administration of the CAR T cell alone.

[0162] In some embodiments, the additional therapeutic agent is an immune checkpoint inhibitor, such as PD1 / PD-L1 inhibitor or CTLA-4 inhibitor. Any suitable known immune check point inhibitors can be combined with the anti-FAP CAR iNKT cells described herein.

[0163] In some embodiments, administration of an anti-FAP iNKT cell described herein in combination with a immune check point inhibitor (e.g., PD1 / PD-L1 inhibitor or CTLA-4 inhibitor) increases immune response to CRC liver mets cells by at least 1%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 100%, at least 2 folds, at least 5 folds, at least 10 folds, at least 20 folds, at least 25 folds, at least 50 folds, at least 75 folds, at least 100 folds, at least 200 folds, at least 300 folds, at least 500 folds, at least 750 folds, at least 1000 folds, or more relative to the proinflammatory cytokine levels prior to administration relative to administration of the immune checkpoint inhibitor alone. In some embodiments, administration of an anti-FAP iNKT cell described herein in combination with a immune check point inhibitor (e.g., PD1 / PD-L1 inhibitor or CTLA-4 inhibitor) increases immune response to CRC liver mets cells by the range of l%-100%, l%-90%, 1 %-80%, 1%- 70%, l%-60%, l%-70%, l%-60%, l%-50%, l%-40%, l%-30%, l%-20%, l%-10%, l%-8%, l%-5%, l%-3%, l%-2%, 5%-100%, 5%-90%, 5%-80%, 5%-70%, 5%-60%, 55%-50%, 5%- 40%, 5%-30%, 5%-20%, 5%-10%, 5%-8%, 10%-100%, 10%-90%, 10%-80%, 10%-70%, 10%-60%, 10%-50%, 10%-40%, 10%-30%, 10%-20%, 20%-100%, 20%-90%, 20%-80%, 20%-70%, 20%-60%, 20%-50%, 20%-40%, 20%-30%, 30%-100%, 30%-90%, 30%-80%, 30%-70%, 30%-60%, 30%-50%, 30%-40%, 40%-100%, 40%-90%, 40%-80%, 40%-70%, 40%-60%, 40%-50%, 50%-100%, 50%-90%, 50%-80%, 50%-70%, 50%-60%, 60%-100%, 60%-90%, 60%-80%, 60%-70%, 70%-100%, 70%-90%, 70%-80%, 80%-100%, 80%-90%, 90%-100%, 1-1000 folds, 1-750 folds, 1-500 folds, 1-100 folds, 1-50 folds, 1-25 folds, 1-20 folds, 1-10 folds, 1-5 folds, 1-4 folds, 1-3 folds, 1-2 folds, 2-1000 folds, 2-750 folds, 2-500 folds, 2-100 folds, 2-50 folds, 2-25 folds, 2-20 folds, 2-10 folds, 2-5 folds, 5-1000 folds, 5- 750 folds, 5-500 folds, 5-100 folds, 5-50 folds, 5-25 folds, 5-20 folds, 5-15 folds, 5-10 folds, 5-8 folds, 5-6 folds, 10-1000 folds, 10-750 folds, 10-500 folds, 10-100 folds, 10-50 folds, 10- 25 folds, 10-20 folds, 10-15 folds, 20-1000 folds, 20-750 folds, 20-500 folds, 20-100 folds, 20-50 folds, 20-25 folds, 50-1000 folds, 50-750 folds, 50-500 folds, 50-100 folds, 50-75 folds, 100-1000 folds, 100-750 folds, 100-500 folds, or 100-250 folds relative to administration of the immune checkpoint inhibitor alone.

[0164] The scaling of dosages for human administration can be performed according to art-accepted practices. The dose for CAMPATH, for example, will generally be in the range 1 to about 100 mg for an adult patient, usually administered daily for a period between1 and 30 days. The preferred daily dose is 1 to 10 mg per day although in some instances larger doses of up to 40 mg per day may be used (described in U.S. Patent No. 6,120,766). Strategies for CAR T cell dosing and scheduling have been discussed (Ertl et al., 2011, Cancer Res, 71:3175-81; Junghans, 2010, Journal of Translational Medicine, 8:55).III. FAP Binding Moieties as Chimeric Antigen Receptor

[0165] The present disclosure provides FAP binding moieties (e.g., antibodies or antigen binding fragments specific for fibroblast activation protein (FAP), FAP-binding peptides) that can be engineered to be an extracellular ligand-binding domain of a chimeric antigen receptor (CAR) expressed by a genetically modified cell (e.g., iNKT cell).

[0166] In some embodiments, the present disclosure provides anti-FAP antibodies or antigen binding fragments thereof as FAP binding moieties. In some embodiments, anti-FAP antibodies or antigen binding fragments thereof provided herein are antibodies that bind to FAP with high specificity and affinity. In some embodiments, the anti-FAP antibody antigen binding fragments thereof described herein specifically binds to an extracellular epitope of FAP or an epitope that becomes exposed to an antibody. In some embodiments, anti-FAP antibodies antigen binding fragments thereof provided herein bind specifically to FAP from human, non-human primates, mouse, rat, etc. In some embodiments, anti-FAP antibodies or antigen binding fragments thereof provided herein bind specifically to human FAP and mouse FAP. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein specifically binds to an epitope on human FAP and / or mouse FAP. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein may bind to a fragment of a human FAP and / or a mouse FAP. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein may bind to a fragment of FAP (e.g., human FAP and / or mouse FAP, e.g., SEQ ID NOs: 35-38) between about 5 and about 200 amino acids, between about 10 and about 200 amino acids, between about 20 and about 200 amino acids, between about 30 and about 150 amino acids, between about 30 and about 120 amino acids, between about 30 and about 100 amino acids, between about 30 and about 90 amino acids, between about 30 and about 80 amino acids, between about 30 and about 60 amino acids, between about 30 and about 50 amino acids, between about 40 and about 80 amino acids, or between about 40 and about 60 amino acids in length. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof may bind to a FAP fragment e.g., human FAP and / or mouse FAP, e.g., SEQ ID NOs: 35-38) comprisinga contiguous number of amino acids from human FAP protein and / or mouse FAP protein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein may bind to a fragment comprising at least 5, at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, at least 170, or at least 180 contiguous amino acids of human FAP protein and / or mouse FAP protein. In some embodiments, an anti-FAP antibody described herein binds to one or more amino acids in amino acid fragment 141-290 of a human FAP (e.g., human FAP as set forth in SEQ ID NO: 35). In some embodiments, an anti-FAP antibody described herein binds one or more contiguous amino acids within amino acid fragment 141-290 of a human FAP (e.g., human FAP as set forth in SEQ ID NO: 35). In some embodiments, an anti-FAP antibody described herein binds one or more non-contiguous amino acids within amino acid fragment 141-290 of a human FAP (e.g., human FAP as set forth in SEQ ID NO: 35). In some embodiments, an anti-FAP antibody described herein binds one or more contiguous and non-contiguous amino acids within amino acid fragment 141-290 of a human FAP (e.g., human FAP as set forth in SEQ ID NO: 35). In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein may bind to a fragment having an amino acid sequence having up to five amino acids, up to four amino acids, up to three amino acids, up to two amino acids, or up to one amino acid different from a fragment of human FAP protein and / or mouse FAP protein. Exemplary human FAP amino acid sequences are set forth in Accession Number AAB49652.1 (SEQ ID NO: 35). Accession Numbers AAB44837.1, AAE30605.1, AAX04090.1, ADL88098.1, AQN54508.1, ATK13500.1, ATK18094.1, AWT87270.1, AYI13559.1, QBE27403.1, QFN60450.1, QNB70086.1, and QYQ07220.1 also describe the same FAP amino acid sequence of SEQ ID NO: 35.

[0167] An exemplary human FAP amino acid sequence is set forth in SEQ ID NO: 35 (amino acid fragment 141-290 bolded and underlined): MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWI SGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRY S YTAT Y Y I YD L SNGEF VRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFN GRENKIFNGIPDWVYEEEMLPTKYALWWSPNGKFLAYAEFNDKDIPVIAYSYYGDEQYPRTI NIPYPKAGAKNPWRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVTDERVCLQWLK RVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSRPVFSYDAISYYKIFSDKD GYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPGRRNIYRISIGSYPP SKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIP ISTLHDGRTDQEIKILEENKELEN ALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWI SYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAI WGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD

[0168] Exemplary mouse FAP amino acid sequences are set forth in AccessionNumber CAA71116.1 (SEQ ID NO: 36), AND76664.1 (SEQ ID NO: 37), and AAH19190.1(SEQ ID NO: 38).

[0169] An exemplary mouse FAP amino acid sequence is set forth in SEQ ID NO:36:MKTWLKTVFGVTTLAALALWICIVLRPSRVYKPEGNTKRALTLKDILNGTFSYKTYFPNWI SEQEYLHQSEDDNIVFYNIETRESYIILSNSTMKSVNATDYGLSPDRQFVYLESDYSKLWRY SYTATYYIYDLQNGEFVRGYELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITYT GRENRIFNGIPDWVYEEEMLATKYALWWSPDGKFLAYVEFNDSDIPIIAYSYYGDGQYPRTI NIPYPKAGAKNPWRVFIVDTTYPHHVGPMEVPVPEMIASSDYYFSWLTWVSSERVCLQWLK RVQNVSVLSICDFREDWHAWECPKNQEHVEESRTGWAGGFFVSTPAFSQDATSYYKIFSDKD GYKHIHYIKDTVENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGYPGRRNIYRISIGNSPP SKKCVTCHLRKERCQYYTASFSYKAKYYALVCYGPGLPISTLHDGRTDQEIQVLEENKELEN SLRNIQLPKVEIKKLKDGGLTFWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVKSVFAVNWI TYLASKEGIVIALVDGRGTAFQGDKFLHAVYRKLGVYEVEDQLTAVRKFIEMGFIDEERIAI WGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASIYSERFMGLPTKDDNLEHYKNSTV MARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGISSGRSQNH LYTHMTHFLKQCFSLSD

[0170] An exemplary mouse FAP amino acid sequence is set forth in SEQ ID NO:37:LRPSRVYKPEGNTKRALTLKDILNGTFSYKTYFPNWISEQEYLHQSEDDNIVFYNIETRESY IILSNSTMKSVNATDYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLQNGEFVRGYELPRP IQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITYTGRENRIFNGIPDWVYEEEMLATKYA LWWSPDGKFLAYVEFNDSDIPIIAYSYYGDGQYPRTINIPYPKAGAKNPWRVFIVDTTYPH HVGPMEVPVPEMIASSDYYFSWLTWVSSERVCLQWLKRVQNVSVLSICDFREDWHAWECPKN QEHVEESRTGWAGGFFVSTPAFSQDATSYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEA IYIFRVTQDSLFYSSNEFEGYPGRRNIYRISIGNSPPSKKCVTCHLRKERCQYYTASFSYKA KYYALVCYGPGLPISTLHDGRTDQEIQVLEENKELENSLRNIQLPKVEIKKLKDGGLTFWYK MILPPQFDRSKKYPLLIQVYGGPCSQSVKSVFAVNWITYLASKEGIVIALVDGRGTAFQGDK FLHAVYRKLGVYEVEDQLTAVRKFIEMGFIDEERIAIWGWSYGGYVSSLALASGTGLFKCGI AVAPVSSWEYYASIYSERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHF QNSAQIAKALVNAQVDFQAMWYSDQNHGISSGRSQNHLYTHMTHFLKQCFSLSD

[0171] An exemplary mouse FAP amino acid sequence is set forth in SEQ ID NO:38:MKTWLKTVFGVTTLAALALWICIVLRPSRVYKPEGNTKRALTLKDILNGTFSYKTYFPNWI SEQEYLHQSEDDNIVFYNIETRESYIILSNSTMKSVNATDYGLSPDRQFVYLESDYSKLWRY SYTATYYIYDLQNGEFVRGYELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITYT GRENRIFNGIPDWVYEEEMLATKYALWWSPDGKFLAYVEFNDSDIPIIAYSYYGDGQYPRTI NIPYPKAGAKNPWRVFIVDTTYPHHVGPMEVPVPEMIASSDYYFSWLTWVSSERVCLQWLK RVQNVSVLSICDFREDWHAWECPKNQEHVEESRTGWAGGFFVSTPAFSQDATSYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAIYIFRVTQDSLFYSSNEFEGYPGRRNIYRISIGNSPP SKKCVTCHLRKERCQYYTASFSYKAKYYALVCYGPGLP ISTLHDGRTDQEIQVLEENKELEN SLRNIQLPKVEIKKLKDGGLTFWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVKSVFAVNWI TYLASKEGIVIALVDGRGTAFQGDKFLHAVYRKLGVYEVEDQLTAVRKFIEMGFIDEERIAI WGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASIYSERFMGLPTKDDNLEHYKNSTV MARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGILSGRSQNH LYTHMTHFLKQCFSLSD

[0172] In some embodiments, an anti FAP antibody or antigen binding fragment thereof specifically binds FAP (e.g., any one of human and / or mouse FAP as set forth to any one of SEQ ID NOs: 35-38) with binding affinity (e.g., as indicated by KD) of at least about 10'4M, 10'5M, 10'6M, 10'7M, 10'8M, 10'9M, IO’10M, 10'11M, 10'12M, 10’13M, or less. For example, an anti FAP antibody or antigen binding fragment thereof of the present disclosure can bind to a FAP protein (e.g., human and / or mouse FAP as set forth to any one of SEQ ID NOs: 35-38) with an affinity between 5 pM and 500 nM, between 10 pM and 450 nM, between 20 pM and 400 nM, between 30 pM and 350 nM, between 40 pM and 300 nM, between 50 pM and 250 nM, between 60 pM and 200 nM, between 70 pM and 150 nM, between 80 pM and 100 nM, between 80 pM and 90 nM, between 90 pM and 80 nM, between 100 pM and 70 nM, between 200 pM and 60 nM, between 300 pM and 50 nM, between 400 pM and 40 nM, between 500 pM and 30 nM, between 600 pM and 20 nM, between 700 pM and 10 nM, between 800 pM and 5 nM, or between 900 pM and 2 nM, between 30 nM and 700 nM, between 50 nM and 500 nM, between 100 nM and 500 nM, between 100 nM and 200 nM, or between 150 nM and 200nM.

[0173] In some embodiments, the present disclosure made the discovery that iNKT cells expressing a FAP CAR comprising an anti-FAP antibody having a binding affinity to FAP (e.g., human FAP or mouse FAP) in the range of 0.1 nM to 100 nM (e.g., 0.1 nM to 80 nM, 0.1 nM to 50 nM, 0.1 nM to 25 nM, 0.1 nM to 10 nM, 0.1 nM to 5 nM, 0.1 nM to 1 nM, 0.1 nM to 0.5 nM, 0.2 nM to 0.4 nM, 0.3 nM to 0.4 nM, 10 nM to 80 nM, 10 nM to 70 nM, 10 nM to 60 nM, 10 nM to 50 nM, 10 nM to 40 nM, 10 nM to 30 nM, 10 nM to 20 nM, 20 nM to 80 nM, 20 nM to 70 nM, 20 nM to 60 nM, 20 nM to 50 nM, 20 nM to 40 nM, 20 nM to 30 nM, 10 nM to 15 nM, 30 nM to 80 nM, 30 nM to 70 nM, 30 nM to 60 nM, 30 nM to 50 nM, 30 nM to 40 nM, 40 nM to 80 nM, 40 nM to 70 nM, 40 nM to 60 nM, 40 nM to 50 nM, 50 nM to 80 nM, 50 nM to 70 nM, 50 nM to 60 nM, 60 nM to 80 nM, 60 nM to 70 nM, or 70 nM to 80 nM) perform better in killing tumor cells expressing FAP (e.g., human or mouse FAP) as compared to iNKT cells expressing a FAP CAR comprising an anti-FAP antibody having higher binding affinities.

[0174] The disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a FAP protein (e.g., human and / or mouse FAP protein as set forth to any one of SEQ ID NOs: 35-38) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of the anti-FAP antibodies or antigen binding fragment thereof can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, the anti-FAP antibodies or antigen binding fragments thereof bind to FAP with a KD of sub-nanomolar range.

[0175] Non-limiting examples of anti-FAP antibodies are provided in Table 2. Table 2. Exemplary anti-FAP antibodies (CDRs according to the Kabat definition)

[0176] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof of the present disclosure comprises one or more of the heavy chain CDRs (e.g., CDRH1, CDRH2, or CDRH3) amino acid sequences from any one of the anti-FAP antibodies selected from Table 2. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof of the present disclosure comprise the CDRH1, CDRH2, and CDRH3 as provided for any one of the antibodies elected from Table 2. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof of the present disclosure comprises one or more of the light chain CDRs (e.g., CDRL1, CDRL2, or CDRL3) amino acid sequences from any one of the anti-FAP antibodies selected from Table 2. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof of the present disclosure comprise the CDRL1, CDRL2, and CDRL3 as provided for any one of the anti-FAP antibodies selected from Table 2.

[0177] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 as provided for any one of the anti-FAP antibodies selected from Table 2. In some embodiments,antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for an antigen. Accordingly, an anti-FAP antibody or antigen binding fragment thereof may include at least the heavy and / or light chain CDR3s of any one of the anti-FAP antibodies selected from Table 2.

[0178] Also within the scope of the present disclosure are functional variants of any of the exemplary anti-FAP antibody or antigen binding fragment thereof as disclosed herein. A functional variant may contain one or more amino acid residue variations in the VH and / or VL, or in one or more of the heavy chain CDRs and / or one or more of the light chain CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody.

[0179] In some embodiments, any of the anti-FAP antibody or antigen binding fragment thereof of the disclosure have one or more CDRs (e.g., heavy chain CDR or light chain CDR) sequences substantially similar to any of the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 sequences from one of the anti-FAP antibodies selected from Table 2. In some embodiments, the position of one or more CDRs along the VH (e.g., CDRH1, CDRH2, or CDRH3) and / or VL (e.g., CDRL1, CDRL2, or CDRL3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). For example, in some embodiments, the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and / or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). In another embodiment, the length of one or more CDRs along the VH (e.g., CDRH1, CDRH2, or CDRH3) and / or VL (e.g., CDRL1, CDRL2, or CDRL3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immuno specific binding to FAP (e.g. , human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).

[0180] Accordingly, in some embodiments, a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 of an anti-FAP antibody or antigen binding fragment thereof may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 of an anti-FAP antibody or antigen binding fragment thereof may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 of an anti-FAP antibody or antigen binding fragment thereof can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 of an anti-FAP antibody or antigen binding fragment thereof can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 of an anti-FAP antibody or antigen binding fragment thereof can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRsfrom any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 of an anti-FAP antibody or antigen binding fragment thereof can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). Any method can be used to ascertain whether immuno specific binding to FAP (e.g., human FAP) is maintained, for example, using binding assays and conditions described in the art.

[0181] In some examples, an anti-FAP antibody or antigen binding fragment thereof comprises one or more CDR (e.g., heavy chain CDRs or light chain CDR) sequences substantially similar to any one of the anti-FAP antibodies selected from Table 2. For example, the antibodies may include one or more CDR sequence(s) from any of the anti-FAP antibodies selected from Table 2 containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, any of the amino acid variations in any of the CDRs provided herein may be conservative variations. Conservative variations can be introduced into the CDRs at positions where the residues are not likely to be involved in interacting with a FAP protein (e.g., human FAP), for example, as determined based on a crystal structure.

[0182] Some aspects of the disclosure provide anti-FAP antibodies that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the heavy chain CDR sequences (e.g., CDRH1, CDRH2, and CDRH3) provided herein, for example, any of the heavy chain CDR sequences provided in any one of the anti-FAP antibodies selected from Table 2. In some embodiments, any of the VL domains providedherein include one or more of the CDR-L sequences (e.g., CDRL1, CDRL2, and CDRL3) provided herein, for example, any of the light chain CDR sequences provided in any one of the anti-FAP antibodies selected from Table 2.

[0183] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof includes any antibody that comprises a heavy chain variable domain and / or a light chain variable domain of any one of the anti-FAP antibodies selected from Table 2, and variants thereof. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof includes any antibody that comprises the heavy chain variable and light chain variable pairs of any anti-FAP antibodies selected from Table 2.

[0184] Aspects of the disclosure provide anti-FAP antibodies or antigen binding fragments thereof comprising a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH or a VL that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH and / or any VL of any one of the anti-FAP antibodies selected from Table 2. In some embodiments, the homologous VH and / or a VL amino acid sequences do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH and / or a VL sequence excluding any of the CDR sequences provided herein. In some embodiments, any of the anti- FAP antibodies or antigen binding fragments thereof provided herein comprise a VH sequence and a VL sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-FAP antibodies selected from Table 2. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-FAP antibodies listed in Table 2. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-FAP antibodies listed in Table 2.

[0185] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Table 2). In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3 that are the same as the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 shown in Table 2, and comprises a humanized VH and / or a humanized VL. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Table 2, and / or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Table 2.

[0186] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 8.

[0187] In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 3. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, and a CDRH3 having the amino acid sequence of SEQ ID NO: 3. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, a CDRH3 having the amino acid sequence of SEQ ID NO: 3, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0188] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 1, CDRH2 having the amino acid sequence of SEQ ID NO: 2, and CDRH3 having the amino acidsequence of SEQ ID NO: 3. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0189] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 1, CDRH2 having the amino acid sequence of SEQ ID NO: 2, and CDRH3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0190] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 1; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 2; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 havingno more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0191] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 7 and a VL comprising the amino acid sequence of SEQ ID NO: 8.

[0192] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8.

[0193] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 8.

[0194] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within aVH of SEQ ID NO: 7 and / or a VL of SEQ ID NO: 8 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 7, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 8.

[0195] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 8. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 7, and / or a VL of SEQ ID NO: 8 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 7, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 8.

[0196] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 14. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2 and aCDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ IDNO: 15.

[0197] In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 12. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, and a CDRH3 having the amino acid sequence of SEQ ID NO: 12. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 12, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0198] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 12. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0199] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 12. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0200] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 11; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 12. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0201] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 14.Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 15. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising the amino acid sequence of SEQ ID NO: 15.

[0202] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 15.

[0203] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80 (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 15.

[0204] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 15. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 14 and / or a VL of SEQ ID NO: 15 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 14, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 15.

[0205] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, atleast 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 15. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 14, and / or a VL of SEQ ID NO: 15 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 14, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 15.

[0206] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 44. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 45.

[0207] In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, and a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0208] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 40, CDRH2 having the amino acid sequence of SEQ ID NO: 41, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0209] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 40, CDRH2 having the amino acid sequence of SEQ ID NO: 41, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0210] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 40; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 41; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared withthe CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0211] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 44.Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 45. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45.

[0212] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 45.

[0213] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 45.

[0214] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 45. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 44 and / or a VL of SEQ ID NO: 45 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 44, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 45.

[0215] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 45. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 44, and / or a VL of SEQ ID NO: 45 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 44, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 45.

[0216] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 47. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 48.

[0217] In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, and a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0218] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0219] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to theCDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0220] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 11; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0221] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 47.Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 48. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48.

[0222] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) ascompared with the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 48.

[0223] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 48.

[0224] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 48. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 47 and / or a VL of SEQ ID NO: 48 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 47, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 48.

[0225] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 48. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 47, and / or a VL of SEQ ID NO: 48 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 47, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 48.

[0226] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 52.

[0227] In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 50, and a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 50, a CDRH3having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0228] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO:5, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0229] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 50, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0230] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 50; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0231] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 51.Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 52. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 51 and a VL comprising the amino acid sequence of SEQ ID NO: 52.

[0232] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52.

[0233] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52.

[0234] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 51 and / or a VL of SEQ ID NO: 52 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 51, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 52.

[0235] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 51, and / or a VL of SEQ ID NO: 52 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 51, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 52.

[0236] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 56. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 57.

[0237] In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 54. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, and a CDRH3 having the amino acid sequence of SEQ ID NO: 54. In some embodiments, according to the Kabat definition system, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 54, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0238] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 54. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0239] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 54. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0240] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 11; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 54. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0241] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 51.Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of SEQ ID NO: 52. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VHcomprising the amino acid sequence of SEQ ID NO: 51 and a VL comprising the amino acid sequence of SEQ ID NO: 52.

[0242] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52.

[0243] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52.

[0244] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti- FAP antibody or antigen binding fragment thereof comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 51 and / or a VL of SEQ ID NO: 52 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 51, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 52.

[0245] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP antibody or antigen binding fragment thereof comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 51, and / or a VL of SEQ ID NO: 51 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 51, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 52.

[0246] An anti-FAP antibody or antigen binding fragment thereof described herein can be in any antibody form, including, but not limited to, intact (i.e., full-length) antibodies, antigen-binding fragments thereof (such as Fab, F(ab'), F(ab')2, Fv), single chain antibodies (e.g., scFv), bi-specific antibodies, or nanobodies. In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein is a single-chain variable fragment (scFv). In some embodiments, an anti-FAP antibody or antigen binding fragment thereof described herein is a scFv-Fab (e.g., scFv fused to a portion of a constant region).

[0247] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof comprises a VL domain and / or VH domain of any one of the anti-FAP antibodies selected from Table 2, and comprises a constant region comprising the amino acid sequencesof the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule. Non-limiting examples of human constant regions are described in the art, e.g., see Kabat E A et al., (1991) supra. Other antibody heavy and light chain constant regions are well known in the art, e.g., those provided in the IMGT database (imgt.org) or at vbase2.org / vbstat.php., both of which are incorporated by reference herein.

[0248] In some embodiments, an anti-FAP antibody or antigen binding fragment thereof is a single-chain variable fragment (scFv). In some embodiments, an anti-FAP scFv comprises a VH and a VE of any one of the anti-FAP antibodies selected from Table 2. In some embodiments, the VH and the VE of an anti-FAP scFv are joined together by a linker. In some embodiments, a linker may have a length of about 2 to 10 amino acids, 5 to 20 amino acids, 10 to 30 amino acids, 20-50 amino acids, 40 to 60 amino acids, 60 to 80 amino acids, or more than 80 amino acids. In some embodiment, a linker may include a sequence that substantially comprises glycine and serine. An exemplary linker sequence is GGGGSGGGGSGGGAS (SEQ ID NO: 29). In some embodiments, a linker may include, without limitation, any of those encompassed by U.S. Patent Nos. 8,445,251 and 9,434,931. In some embodiments, an anti-FAP comprises a linker between the VH and the VE, and the linker comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 92%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 29.

[0249] In some embodiments, an anti-FAP scFv comprises a VH and a VL, and the C-terminus of the VH is joined with the N terminus of the VL via a linker (e.g., the linker as set forth in SEQ ID NO: 29). In some embodiments, an anti-FAP scFv comprises a VH and a VL, and the C-terminus of the VL is joined with the N terminus of the VH via a linker (e.g., the linker as set forth in SEQ ID NO: 29).

[0250] In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-FAP antibodies listed in Table 2. Alternatively or in addition, an anti-FAP scFv comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-FAP antibodies listed in Table 2. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% ((e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%,at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of any of the anti-FAP antibodies listed in Table 2. Alternatively, or in addition, an anti-FAP scFv comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of any of the anti-FAP antibodies listed in Table 2.

[0251] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the any of the anti-FAP scFv listed in Table 2. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to any of the anti-FAP scFv listed in Table 2.

[0252] In some embodiments, an anti-FAP scFv comprises a VH comprising the amino acid sequence of SEQ ID NO: 7, and / or a VL comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7, and / or a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 7, and / or a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 8.

[0253] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the scFv amino acid sequence as set forth in SEQ ID NO: 9. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, atleast 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the scFv amino acid sequence as set forth in SEQ ID NO: 9. In some embodiments, an anti-FAP scFv comprises an amino acid sequence of SEQ ID NO: 9.

[0254] In some embodiments, an anti-FAP scFv comprises a VH comprising the amino acid sequence of SEQ ID NO: 14, and / or a VL comprising the amino acid sequence of SEQ ID NO: 15. In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 14, and / or a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 15. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 14, and / or a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 15.

[0255] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the scFv amino acid sequence as set forth in SEQ ID NO: 16. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the scFv amino acid sequence as set forth in SEQ ID NO: 16. In some embodiments, an anti-FAP scFv comprises an amino acid sequence of SEQ ID NO: 16.

[0256] In some embodiments, an anti-FAP scFv comprises a VH comprising the amino acid sequence of SEQ ID NO: 44, and / or a VL comprising the amino acid sequence of SEQ ID NO: 45. In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth inSEQ ID NO: 44, and / or a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 45. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 44, and / or a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 55.

[0257] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the scFv amino acid sequence as set forth in SEQ ID NO: 46. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the scFv amino acid sequence as set forth in SEQ ID NO: 46. In some embodiments, an anti-FAP scFv comprises an amino acid sequence of SEQ ID NO: 46.

[0258] In some embodiments, an anti-FAP scFv comprises a VH comprising the amino acid sequence of SEQ ID NO: 47, and / or a VL comprising the amino acid sequence of SEQ ID NO: 48. In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 47, and / or a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 48. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 47, and / or a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 48.

[0259] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the scFv amino acid sequence as set forth in SEQ ID NO: 49. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the scFv amino acid sequence as set forth in SEQ ID NO: 49. In some embodiments, an anti-FAP scFv comprises an amino acid sequence of SEQ ID NO: 49.

[0260] In some embodiments, an anti-FAP scFv comprises a VH comprising the amino acid sequence of SEQ ID NO: 51, and / or a VL comprising the amino acid sequence of SEQ ID NO: 52. In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51, and / or a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51, and / or a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52.

[0261] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the scFv amino acid sequence as set forth in SEQ ID NO: 53. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the scFv amino acid sequence asset forth in SEQ ID NO: 53. In some embodiments, an anti-FAP scFv comprises an amino acid sequence of SEQ ID NO: 53.

[0262] In some embodiments, an anti-FAP scFv comprises a VH comprising the amino acid sequence of SEQ ID NO: 56, and / or a VL comprising the amino acid sequence of SEQ ID NO: 57. In some embodiments, an anti-FAP scFv comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 56, and / or a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 57. In some embodiments, an anti-FAP scFv comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 56, and / or a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 57.

[0263] In some embodiments, an anti-FAP scFv comprises an amino acid sequence containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the scFv amino acid sequence as set forth in SEQ ID NO: 58. In some embodiments, an anti-FAP scFv comprises an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the scFv amino acid sequence as set forth in SEQ ID NO: 16. In some embodiments, an anti-FAP scFv comprises an amino acid sequence of SEQ ID NO: 58.

[0264] In some embodiments, any of the anti-FAP antibody or antigen binding fragment described herein is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, the anti-FAP antibody or antigen binding fragment is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C- glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In someembodiments, the one or more sugar or carbohydrate molecules are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, an N- acetylgalactosamine unit, a galactose unit, a fucose unit, or a phospholipid unit. In some embodiments, there are about 1-10, about 1-5, about 5-10, about 1-4, about 1-3, or about 2 sugar molecules. In some embodiments, a glycosylated antibody is fully or partially glycosylated. In some embodiments, an antibody is glycosylated by chemical reactions or by enzymatic means. In some embodiments, an antibody is glycosylated in vitro or inside a cell, which may optionally be deficient in an enzyme in the N- or O- glycosylation pathway, e.g. a glycosyltransferase. In some embodiments, an antibody is functionalized with sugar or carbohydrate molecules as described in International Patent Application Publication WO2014065661, published on May 1, 2014, entitled, “Modified antibody, antibody-conjugate and process for the preparation thereof ’ .

[0265] In some embodiments, conservative mutations can be introduced into antibody sequences (e.g., CDRs or framework sequences) at positions where the residues are not likely to be involved in interacting with a target antigen (e.g., FAP), for example, as determined based on a crystal structure.

[0266] In some embodiments, any one of the anti-FAP antibody or antigen binding fragment described herein may comprise a signal peptide in the heavy and / or light chain sequence (e.g., a N-terminal signal peptide). In some embodiments, the anti-FAP antibody or antigen binding fragment described herein comprises any one of the VH and VL sequences, any one of the IgG heavy chain and light chain sequences, or any one of the scFv sequences described herein, and further comprises a signal peptide (e.g., a N-terminal signal peptide).

[0267] In some embodiments, the present disclosure also contemplates engineering any of the FAP binding moieties known in the art to be an extracellular ligand-binding domain of a CAR expressed by the genetically modified immune cells (e.g., iNKT cells) described herein. Non-limiting examples of FAP binding moieties are set forth in Table 3. Table 3. Listing of Known FAP Binding Moieties

[0268] Aspects of the present disclosure also provides chimeric antigen receptors (CARs) comprising an extracellular ligand-binding domain. In some embodiments, the choice of ligand-binding domain depends upon the type and number of ligands that define the surface of a target cell. For example, the ligand-binding domain may be chosen to recognize one or more ligands that act as a cell surface marker on target cells associated with a particular disease state. Thus, examples of cell surface markers that may act as ligands for the ligand-binding domain in the CAR of the present disclosure can include those associated with viral, bacterial and parasitic infections, autoimmune disease, and, more preferably, cancer cells. In some embodiments, a CAR of the present disclosure is engineered to target one or more tumor antigens of interest by way of engineering a desired ligand-binding moiety that specifically binds to one or more antigens on a tumor cell. In the context of the present disclosure, “tumor antigen” refers to an antigen that is common to or characterizes specific hyperproliferative disorders such as cancer. Generally, a CAR (e.g., anti-FAP CAR) of the present disclosure will comprise at least an extracellular domain and an intracellular domain. In some embodiments, the extracellular domain comprises a target- specific binding element (e.g., a scFv that specifically binds to FAP (e.g., FAP protein set forth in SEQ ID NOs: 35- 38)) otherwise referred to herein as a ligand-binding domain (also referred to herein as an antigen-binding domain). In some embodiments, the extracellular domain is an antigenbinding domain or a portion thereof. In some embodiments, the extracellular ligand-binding domain is a Fab. In some embodiments, the extracellular ligand-binding domain is a scFv. In some embodiments, an extracellular ligand-binding domain of a CAR described herein comprises an antigen binding fragment that specifically binds to FAP (e.g., human FAP). In some embodiments, an extracellular ligand-binding domain of a CAR described herein comprises any one of the FAP antibodies or antigen binding fragments thereof (e.g., anti-FAP scFv).

[0269] In some embodiments, an anti-FAP CAR of the present disclosure comprises an extracellular ligand-binding domain specifically binds FAP with binding affinity (e.g., asindicated by KD) of at least about 10'4M, 10'5M, 10'6M, 10'7M, IO'8M, IO'9M, IO'10M, W11M, IO2M, IO’13M, or less. For example, an anti-FAP CAR of the present disclosure can bind to a FAP protein (e.g., human FAP protein and / or mouse FAP protein as set forth in SEQ ID NOs: 35-38) with an affinity between 5 pM and 500 nM, between 10 pM and 450 nM, between 20 pM and 400 nM, between 30 pM and 350 nM, between 40 pM and 300 nM, between 50 pM and 250 nM, between 60 pM and 200 nM, between 70 pM and 150 nM, between 80 pM and 100 nM, between 80 pM and 90 nM, between 90 pM and 80 nM, between 100 pM and 70 nM, between 200 pM and 60 nM, between 300 pM and 50 nM, between 400 pM and 40 nM, between 500 pM and 30 nM, between 600 pM and 20 nM, between 700 pM and 10 nM, between 800 pM and 5 nM, or between 900 pM and 2 nM.

[0270] The disclosure also includes CARs that compete with any of the CARs described herein for binding to a FAP protein (e.g. , human FAP protein and / or mouse FAP protein as set forth in SEQ ID NOs: 35-38) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of the anti-FAP CARs can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, the anti-FAP CARs described herein binds to FAP with a KD of sub-nanomolar range.

[0271] In some embodiments, an anti-FAP CAR of the present disclosure comprises one or more of the heavy chain CDRs (e.g., CDRH1, CDRH2, or CDRH3) amino acid sequences from any one of the anti-FAP antibodies selected from Table 2. In some embodiments, an anti-FAP CAR of the present disclosure comprise the CDRH1, CDRH2, and CDRH3 as provided for any one of the antibodies elected from Table 2. In some embodiments, an anti-FAP CAR of the present disclosure comprises one or more of the light chain CDRs (e.g., CDRL1, CDRL2, or CDRL3) amino acid sequences from any one of the anti-FAP antibodies selected from Table 2. In some embodiments, an anti-FAP CAR of the present disclosure comprise the CDRL1, CDRL2, and CDRL3 as provided for any one of the anti-FAP antibodies selected from Table 2.

[0272] In some embodiments, an anti-FAP CAR comprises the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 as provided for any one of the anti-FAP antibodies selected from Table 2. In some embodiments, antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for anantigen. Accordingly, an anti-FAP CAR may include at least the heavy and / or light chain CDR3s of any one of the anti-FAP antibodies selected from Table 2.

[0273] In some embodiments, any of the anti-FAP CAR of the disclosure have one or more CDRs (e.g., heavy chain CDR or light chain CDR) sequences substantially similar to any of the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and / or CDRL3 sequences from one of the anti-FAP antibodies selected from Table 2. In some embodiments, the position of one or more CDRs along the VH (e.g., CDRH1, CDRH2, or CDRH3) and / or VL (e.g., CDRL1, CDRL2, or CDRL3) region of a chimeric antigen receptor described herein can vary by one, two, three, four, five, or six amino acid positions so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).

[0274] In some examples, an anti-FAP CAR comprises one or more CDR (e.g., heavy chain CDRs or light chain CDR) sequences substantially similar to any one of the anti-FAP antibodies selected from Table 2. For example, the anti-FAP CAR may include one or more CDR sequence(s) from any of the anti-FAP antibodies selected from Table 2 containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-FAP antibodies selected from Table 2) so long as immuno specific binding to FAP (e.g., human FAP) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived).

[0275] Some aspects of the disclosure provide anti-FAP CARs that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the heavy chain CDR sequences (e.g., CDRH1, CDRH2, and CDRH3) provided herein, for example, any of the heavy chain CDR sequences provided in any one of the anti-FAP antibodies selected from Table 2. In some embodiments, any of the VL domains provided herein include one or more of the CDR-L sequences (e.g., CDRL1, CDRL2, and CDRL3) provided herein, for example, any of the light chain CDR sequences provided in any one of the anti-FAP antibodies selected from Table 2.

[0276] In some embodiments, an anti-FAP CAR comprises a heavy chain variable domain and / or a light chain variable domain of any one of the anti-FAP antibodies selectedfrom Table 2, and variants thereof. In some embodiments, an anti-FAP CAR comprises the heavy chain variable and light chain variable pairs of any anti-FAP antibodies selected from Table 2.

[0277] Aspects of the disclosure provide anti-FAP CAR comprising a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein. In some embodiments, an anti-FAP CAR comprises a VH or a VL that is at least 75% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the VH and / or any VL of any one of the anti-FAP antibodies selected from Table 2. In some embodiments, the homologous VH and / or a VL amino acid sequences of the anti-FAP CAR do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) may occur within a VH and / or a VL sequence of an anti-FAP CAR excluding any of the CDR sequences provided herein. In some embodiments, any of the anti-FAP CAR provided herein comprise a VH sequence and a VL sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-FAP antibodies selected from Table 2. In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-FAP antibodies listed in Table 2. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-FAP antibodies listed in Table 2.

[0278] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, a CDRH3, a CDRL1, a CDRL2, and a CDRL3 that are the same as the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, and CDRL3 shown in Table 2, and comprises a humanized VH and / or a humanized VL. In some embodiments, an anti-FAP CAR is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Table 2, and / or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Table 2.

[0279] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2 and aCDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ IDNO: 8.

[0280] In some embodiments, an anti-FAP CAR comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 3. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, and a CDRH3 having the amino acid sequence of SEQ ID NO: 3. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, a CDRH3 having the amino acid sequence of SEQ ID NO: 3, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0281] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 1, CDRH2 having the amino acid sequence of SEQ ID NO: 2, and CDRH3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0282] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 1, CDRH2 having the amino acid sequence of SEQ ID NO: 2, and CDRH3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0283] In some embodiments, an anti-FAP CAR comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 1; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 2; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, an anti-FAP CAR comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 6.

[0284] In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 7. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising the amino acid sequence of SEQ ID NO: 8. In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 7 and a VL comprising the amino acid sequence of SEQ ID NO: 8.

[0285] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8.

[0286] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 7.Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, atleast 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 8.

[0287] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 8. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19,18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 7 and / or a VL of SEQ ID NO: 8 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20,19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 7, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 8.

[0288] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 7. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 8. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 7, and / or a VL of SEQ ID NO: 8 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the frameworksequence of a VH of SEQ ID NO: 7, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 8.

[0289] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 14. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 15.

[0290] In some embodiments, an anti-FAP CAR comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 12. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, and a CDRH3 having the amino acid sequence of SEQ ID NO: 12. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 12, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0291] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 12. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0292] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence ofSEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 12. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0293] In some embodiments, an anti-FAP CAR comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 11; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 12. Alternatively or in addition, an anti-FAP CAR comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 13.

[0294] In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 14. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising the amino acid sequence of SEQ ID NO: 15. In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising the amino acid sequence of SEQ ID NO: 15.

[0295] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8,7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 15.

[0296] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 15.

[0297] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 15. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 14 and / or a VL of SEQ ID NO: 15 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 14, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 15.

[0298] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, atleast 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 15. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 14, and / or a VL of SEQ ID NO: 15 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 14, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 15.

[0299] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 44. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 45.

[0300] In some embodiments, an anti-FAP CAR comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, and a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0301] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 40, CDRH2 having the amino acid sequence of SEQ ID NO: 41, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3, whichcollectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0302] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 40, CDRH2 having the amino acid sequence of SEQ ID NO: 41, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0303] In some embodiments, an anti-FAP CAR comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 40; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 41; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0304] In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 44. Alternatively or in addition, an anti-FAP CARcomprises a VL comprising the amino acid sequence of SEQ ID NO: 45. In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45.

[0305] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8,7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 45.

[0306] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 5.

[0307] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9,8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 45. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 44 and / or a VL of SEQ ID NO: 45 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 44, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14,13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 45.

[0308] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 44. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 45. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 44, and / or a VL of SEQ ID NO: 45 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 44, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 45.

[0309] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 47. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 48.

[0310] In some embodiments, an anti-FAP CAR comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, and a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, aCDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0311] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0312] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0313] In some embodiments, an anti-FAP CAR comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 11; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises: a CDRL1 having nomore than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0314] In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 47. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising the amino acid sequence of SEQ ID NO: 48. In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48.

[0315] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8,7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 48.

[0316] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 48.

[0317] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9,8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8,7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 48. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 47 and / or a VL of SEQ ID NO: 48 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 47, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 48.

[0318] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 47. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 48. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 47, and / or a VL of SEQ ID NO: 48 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 47, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 48.

[0319] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ IDNO: 51. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 52.

[0320] In some embodiments, an anti-FAP CAR comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 50, and a CDRH3 having the amino acid sequence of SEQ ID NO: 42. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 50, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0321] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 50, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0322] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 50, and CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the aminoIl lacid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ IDNO: 43.

[0323] In some embodiments, an anti-FAP CAR comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 50; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, an anti-FAP CAR comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 43.

[0324] In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising the amino acid sequence of SEQ ID NO: 52. In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 51 and a VL comprising the amino acid sequence of SEQ ID NO: 52.

[0325] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52.

[0326] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, atleast 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52.

[0327] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP CAR comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 52. In some embodiments, the number of amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) may occur within a VH of SEQ ID NO: 51 and / or a VL of SEQ ID NO: 52 excluding any of the CDR sequences therein. In some embodiments, an anti-FAP CAR comprises a heavy chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VH of SEQ ID NO: 51, and / or a light chain variable sequence that comprises a framework sequence that that contains no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation to the framework sequence of a VL of SEQ ID NO: 52.

[0328] In some embodiments, an anti-FAP CAR comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 52. In some embodiments, the degree of sequence variation (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) may occur within a VH of SEQ ID NO: 51, and / or a VL of SEQ ID NO: 52 excluding any of the CDR sequences therein. In some embodiments, ananti-FAP CAR comprises a heavy chain variable sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VH of SEQ ID NO: 51, and / or a light chain variable sequence that comprises a framework sequence that at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the framework sequence of a VL of SEQ ID NO: 52.

[0329] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2 and a CDRH3 of a heavy chain variable domain (VH) having the amino acid sequence of SEQ ID NO: 56. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2 and a CDRL3 of a light chain variable domain (VL) having the amino acid sequence of SEQ ID NO: 57.

[0330] In some embodiments, an anti-FAP CAR comprises a CDRH3 having the amino acid sequence of SEQ ID NO: 54. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, and a CDRH3 having the amino acid sequence of SEQ ID NO: 54. In some embodiments, an anti-FAP CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 54, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0331] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 54. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0332] In some embodiments, an anti-FAP CAR comprises a CDRH1, a CDRH2, and a CDRH3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the CDRH1 having the amino acid sequence of SEQ ID NO: 10, CDRH2 having the amino acid sequence of SEQ ID NO: 11, and CDRH3 having the amino acid sequence of SEQ ID NO: 54. Alternatively or in addition, an anti-FAP CAR comprises a CDRL1, a CDRL2, and a CDRL3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the CDRL1 having the amino acid sequence of SEQ ID NO: 4, CDRL2 having the amino acid sequence of SEQ ID NO: 5, and CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0333] In some embodiments, an anti-FAP CAR comprises: a CDRH1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH1 having the amino acid sequence of SEQ ID NO: 10; a CDRH2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH2 having the amino acid sequence of SEQ ID NO: 11; and / or a CDRH3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRH3 having the amino acid sequence of SEQ ID NO: 54. Alternatively or in addition, an anti-FAP CAR comprises: a CDRL1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL1 having the amino acid sequence of SEQ ID NO: 4; a CDRL2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL2 having the amino acid sequence of SEQ ID NO: 5; and / or a CDRL3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the CDRL3 having the amino acid sequence of SEQ ID NO: 55.

[0334] In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 56. Alternatively or in addition, an anti-FAP CAR comprises a VL comprising the amino acid sequence of SEQ ID NO: 57. In some embodiments, an anti-FAP CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 56 and a VL comprising the amino acid sequence of SEQ ID NO: 57.

[0335] In some embodiments, an anti-FAP CAR comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with...

Claims

CLAIMSWhat is claimed is:

1. A method for treating colorectal cancer liver metastasis in a subject, the method comprising administering the subject an invariant natural killer T (iNKT) cell comprising a chimeric antigen receptor (CAR) that specifically binds fibroblast activation protein (FAP), wherein the chimeric antigen receptor comprises:(a) a CDRH1 having the amino acid sequence of SEQ ID NO: 1, a CDRH2 having the amino acid sequence of SEQ ID NO: 2, a CDRH3 having the amino acid sequence of SEQ ID NO: 3, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 6;(b) a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 12, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 13;(c) a CDRH1 having the amino acid sequence of SEQ ID NO: 40, a CDRH2 having the amino acid sequence of SEQ ID NO: 41, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43;(d) a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43; or(e) a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 54, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 55.

2. The method of claim 1, wherein the CAR comprises a CDRH1 having the amino acid sequence of SEQ ID NO: 10, a CDRH2 having the amino acid sequence of SEQ ID NO: 11, a CDRH3 having the amino acid sequence of SEQ ID NO: 42, a CDRL1 having the amino acid sequence of SEQ ID NO: 4, a CDRL2 having the amino acid sequence of SEQ ID NO: 5, and a CDRL3 having the amino acid sequence of SEQ ID NO: 43.

3. The method of claim 1 or 2, wherein the CAR comprises:(a) a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 8;(b) a VH comprising the amino acid sequence of SEQ ID NO: 14 and a VL comprising the amino acid sequence of SEQ ID NO: 15;(c) a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45;(d) a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48; or(e) a VH comprising the amino acid sequence of SEQ ID NO: 56 and a VL comprising the amino acid sequence of SEQ ID NO: 57.

4. The method of any one of claims 1-3, wherein the CAR comprises a VH comprising the amino acid sequence of SEQ ID NO: 47 and a VL comprising the amino acid sequence of SEQ ID NO: 48.

5. The method of any one of claims 1-4, wherein the CAR comprises:(a) a scFv comprising the amino acid sequence of SEQ ID NO: 9;(b) a scFv comprising the amino acid sequence of SEQ ID NO: 16;(c) a scFv comprising the amino acid sequence of SEQ ID NO: 46;(d) a scFv comprising the amino acid sequence of SEQ ID NO: 49; or(e) a scFv comprising the amino acid sequence of SEQ ID NO: 58.

6. The method of any one of claims 1-5, wherein the CAR comprises a scFv comprising the amino acid sequence of SEQ ID NO: 49.

7. The method of any one of claims 1-6, wherein the CAR further comprises a hinge region.

8. The method of claim 7, wherein the hinge region comprises an amino acid sequence at least 80% identical to SEQ ID NO: 30.

9. The method of any one of claims 1-8, wherein the CAR further comprises a transmembrane domain.

10. The method of claim 9, wherein the transmembrane domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 31.

11. The method of any one of claims 1-7, wherein the CAR comprises a hinge / transmembrane domain comprising the amino acid sequence of any one of SEQ ID NOs: 83, 85, or 87.

12. The method of any one of claims 1-11, wherein the CAR further comprises one or more cytoplasmic domain.

13. The method of claim 12 wherein the one or more cytoplasmic domain comprises the amino acid sequence of any one of SEQ ID NO: 32, 33, 39, 90, 92, 94, 96, 98, 100, 102, or 105.

14. The method of claim 12 or 13, wherein the cytoplasmic domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 32.

15. The method of any one of claims 1-14, wherein the CAR further comprises a intracellular co-stimulatory domain.

16. The method of claim 15, wherein the co-stimulatory domain comprises an amino acid sequence at least 80% identical to SEQ ID NO: 33.

17. The method of any one of claims 1-16, wherein the CAR comprises the amino acid sequence of any one of SEQ ID NOs: 17, 18, 59, 60, or 62.

18. The method of any one of claims 1-17, wherein the CAR comprises the amino acid sequence of SEQ ID NO: 60.

19. The method of any one of claims 1-18, wherein the iNKT cell is engineered to express one or more immunoregulatory gene products.

20. The method of claim 19, wherein the one or more immunoregulatory gene products comprises IL-15, IL-12, CD40L, or 4-1BB, IL-18, or IL-21.

21. The method of claim 19 or 20, wherein the immunoregulatory gene product is a soluble IL-15 (sIL-15).

22. The method of any one of claims 1-21, wherein the CAR binds to LAP with a KD in the range of IE- 10 M to 10E-7 M.

23. The method of any one of claims 1-22, wherein the CAR binds to LAP with a KD in the range of IE-8 M to3E-8 M, or 3E-8 M to 4E-7 M.

24. The method of any one of claims 1-23, wherein the subject has microsatellite-stable (MSS) colorectal cancer.

25. The method of any one of claims 1-24, wherein the cell in the tumor microenvironment (TME) of the CRC liver mets express LAP.

26. The method of claim 25, wherein the administration reduces PAP expressing cells in the TME.

27. The method of claim 25 or 26, wherein the PAP expressing cells are cancer associated fibroblasts.

28. The method of any one of claims 1-27, wherein the administration is via injection,29. The method of claim 29, wherein the injection is intraperitoneal injection, intravenous injection, or intratumoral injection.

30. The method of any one of claims 1-29, wherein the iNKT cell is administered in combination with a therapeutic agent.

31. The method of claim 30, wherein the therapeutic agent is a CAR T cell specific for a tumor antigen.

32. The method of any one of claims 1-30, wherein the therapeutic agent is an immune checkpoint inhibitor or agonist.

33. The method of any one of claims 26-32, wherein the killing of cancer-associated fibroblasts results in reduced immunosuppression in the TME relative to immunosuppression in the subject prior to the administration.

34. The method of any one of claims 26-33, wherein the killing of cancer-associated fibroblasts results in increased immune cell infiltration in the TME relative to immune cell infiltration in the subject prior to the administration.

35. The method of any one of claims 1-34, wherein the administration of the anti-FAP CAR iNKT cells leads to reduced tumor burden relative to tumor burden in the subject prior to the administration.

36. The method of any one of claims 1-35, wherein the administration of the anti-FAP CAR iNKT cells leads to resistance to T cell exhaustion, enhancement of tissue homing of anti-FAP iNKT cells, selective cytotoxicity towards M2 macrophages, and / or stimulation of dendritic cell maturation.

37. The method of any one of claims 1-36, wherein the anti-FAP CAR iNKT cells retain response to CD Id and / or NK receptor ligand.

38. The method of any one of claims 1-37, wherein the administration of the anti-FAP CAR iNKT cells reduces CXCL12 expression and / or activity in CRC liver mets cells.

39. The method of any one of claims 1-38, wherein the administration of the anti-FAP CAR iNKT cells increases proinflammatory cytokines in CRC liver mets cells.

40. The method of claim 39, wherein the cytokine is CX3CL1, CXCL19, CCL3, IL-8, CD40L, CD137, IFNy, GZMB, or FASL.

Citation Information

Patent Citations

  • Anti-surrogate light chain antibodies

    US20180265594A1

  • Stem cell-engineered INKT cell-based off-the-shelf cellular therapy

    US20210123022A1

  • Nucleic acid expression using subcutaneous administration

    US20230212610A1

  • Fibroblast activation protein (FAP) car-invariant natural killer t cells and uses thereof

    WO2024077104A2