Compositions and methods of mRNA-based adjuvants for mRNA vaccines

Incorporating mRNA sequences for peptide antigens and adjuvants in mRNA vaccines, using cleavable linkers and nanoparticles, addresses the lack of effective adjuvants in mRNA vaccines, enhancing immunogenicity and tailoring immune responses for diverse targets.

WO2025260013A1PCT designated stage Publication Date: 2025-12-18YALE UNIVERSITY
View PDF 8 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/033590
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-06-13
Filing Date
2025-06-13
Publication Date
2025-12-18

AI Technical Summary

Technical Problem

Existing mRNA vaccines lack effective adjuvants to enhance immunogenicity and tailor immune responses for diverse targets, particularly in cancer therapeutic vaccines.

Method used

Incorporation of mRNA sequences encoding peptide antigens and adjuvants within the same host cell, utilizing cleavable linkers like P2A and Furin cleavage sites, and encapsulation in nanoparticles for targeted immune response induction.

Benefits of technology

Enhances immunogenicity and tailors immune responses to specific antigens, effectively treating or preventing infections and diseases by stimulating desired immune reactions.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2025033590_18122025_PF_FP_ABST
    Figure US2025033590_18122025_PF_FP_ABST
Patent Text Reader

Abstract

It has been established that the efficacy of mRNA vaccines encoding one or more peptide antigens for expression in a host cell can be enhanced by the addition of one or more mRNA sequences encoding peptide adjuvant(s) for expression of the adjuvant in the same host cell. Compositions of vaccines including mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) are described. The peptide antigen(s) and peptide adjuvant(s) can be encoded on the same or different mRNA molecule. In some forms, the vaccines include a single mRNA molecule encoding an antigen and an adjuvant, for expression in the same host cell. Nanoparticles encapsulating the mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) are provided for administration to a subject in vivo. Methods of vaccinating a subject including administering to the subject a composition including mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) are also described.
Need to check novelty before this filing date? Find Prior Art

Description

[0001]COMPOSITIONS AND METHODS OF MRNA-BASED ADJUVANTS FOR MRNA VACCINES CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of and priority to U.S. Provisional Application No. 63 / 659,790 filed on June 13, 2024, the content of which is incorporated herein in its entirety. REFERENCE TO THE SEQUENCE LISTING The Sequence Listing submitted as an XML file named “YU_8780_PCT_ST26.xml,” created on June 12, 2025, and having a size of 51,446 bytes is hereby incorporated by reference pursuant to 37 C.F.R. § 1.834(c)(1). FIELD OF THE INVENTION The disclosed invention is generally in the field of vaccine design and specifically in the area of enhancing the efficacy and applicability of mRNA vaccines. INTRODUCTION In the context of vaccination, “adjuvant” typically refers to substances that are added for the purpose of increasing the local inflammatory response and thereby increase the immunogenicity of the vaccine and enhance long term protection. This concept originated from observations that the efficacy of early vaccines varied significantly from batch to batch, and that the presence of contaminants often paradoxically increased protection from infection. Several common adjuvants that range from metal salts (e.g. aluminum hydroxide) to attenuated pathogen fragments (e.g., Freund’s complete adjuvant) have been tested and employed as vaccine adjuvants in the traditional context of vaccines of various types. However, strategies to improve cancer therapeutic vaccines, especially mRNA-based vaccines, remain largely unexplored. mRNA vaccines have recently changed the landscape of treatment and prophylaxis in the fields of infectious disease and cancer. However, the best way to adjuvant these vaccines is not known and adjuvant signals may include not just generalized triggers for inflammation, but coordinated combinations of discrete molecular programs designed to enable or suppress particular immune functions and drive specific subsets of immune cells. Therefore, it is an object of the invention to provide enhanced mRNA vaccine reagents that impart enhanced immunogenicity. It is a further object of the invention to provide a readily adaptable platform for production of mRNA vaccines that can be tailored to incorporate a range of different signals for improved immunogenicity against diverse targets. 45738066.1 1 It is a further object of the invention to provide a readily adaptable platform for production of mRNA vaccines that can be tailored to incorporate a range of different biochemical signals that enhance immunological activity against diverse targets. It is yet a further object of the invention to provide vaccine reagents that can be adapted to tailor immune responses in a host. SUMMARY OF THE INVENTION It has been established that the efficacy of mRNA vaccines encoding one or more peptide antigens for expression in a host cell can be enhanced by the addition of one or more mRNA sequences encoding one or more peptide adjuvant(s) for expression of the adjuvant(s) in the same host cell. Compositions of vaccines including mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) are described. The peptide antigen(s) and peptide adjuvant(s) can be encoded on the same or different mRNA molecule. In some forms, the vaccines include a single mRNA molecule encoding one or more antigens and one or more adjuvants, for expression in the same host cell. Nanoparticles encapsulating the mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) or immuno-signaling molecules are provided for administration to a subject in vivo. Methods of vaccinating a subject including administering to the subject a composition including mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) or immuno-signaling molecules are also described. Compositions of synthetic messenger ribonucleic acid (mRNA) molecules, including one or more ribonucleic acid sequences encoding one or more peptide antigens, and one or more ribonucleic acid sequences encoding one or more peptide adjuvant(s) and / or other immuno- modulatory agent(s), are described. Typically, the mRNA is configured to express the peptide antigen(s) and the peptide adjuvant(s) and / or other immuno-modulatory agent(s) as distinct polypeptides within a mammalian cell. In some forms, the mRNA(s) encoding each of the antigen(s) and the mRNA(s) encoding the adjuvant(s) are connected via one or more cleavable linker. Exemplary cleavable linkers include a P2A linker and a Furin cleavage site. In some forms, the Furin cleavage site excludes the linker amino acids. In some forms, the Furin cleavage site and the P2A linker are joined by a linker including the amino acid residues GSG. In some forms, the synthetic mRNA includes one or more of a single 5’ Cap 1 structure, a poly Adenylated 3’ tail structure, a single 5’ untranslated region (5’ UTR), and / or a single 3’ untranslated region (3’ UTR). In some forms, the one or more ribonucleic acid sequences encoding one or more peptide antigen(s) further include a ribonucleic acid sequence encoding a polypeptide targeting motif. An exemplary polypeptide targeting motif enhances binding, uptake or processing of the antigen by an antigen presenting cell (APC). In some forms, one or more ribonucleic acid sequences 455738066.1 2 encoding a peptide antigen(s) is fused with a sequence encoding a polypeptide targeting motif. In an exemplary form, an amino-terminus of a peptide antigen is coupled to a carboxyl terminus of a targeting motif. In some forms, the polypeptide targeting motif includes a Clec9a binding motif. In an exemplary form, the synthetic mRNA includes, from 5’ to 3’: a 5’Cap 1 structure; a 5’ untranslated region (5’UTR); a sequence encoding a first polypeptide; a first Furin cleavage sequence; a first P2A linker sequence; a sequence encoding a second polypeptide; a 3’untranslated region (3’UTR); and a poly Adenylated 3’tail. In some forms, a first polypeptide encodes the peptide antigen and a second polypeptide encodes a peptide adjuvant or other immuno-modulatory agent. In other forms, a first polypeptide encodes the peptide adjuvant or other immuno-modulatory agent and a second polypeptide encodes a peptide antigen. In an exemplary form, the synthetic mRNA includes, from 5’ to 3’: a 5’ Cap 1 structure; a 5’untranslated region (5’ UTR); a sequence encoding a first polypeptide; a first Furin cleavage sequence; a first P2A linker sequence; a sequence encoding a second polypeptide; a second Furin cleavage sequence; a second P2A linker sequence; a sequence encoding a third polypeptide; a 3’untranslated region (3’ UTR); and a poly Adenylated 3’ tail. Typically, the first or the second polypeptide encodes a first peptide antigen, the first or the second polypeptide encodes a first peptide adjuvant or other immuno-modulatory agent, and the third polypeptide encodes a second peptide adjuvant or other immuno-modulatory agent(s) or a second peptide antigen. Compositions of nanoparticles including the described synthetic mRNAs are also provided. Typically, the synthetic mRNA is encapsulated within the nanoparticle. Compositions of cells including the described nanoparticles mRNAs are also provided. Typically, synthetic nanoparticles for delivery of therapeutic and / or prophylactic agents to a subject include the described synthetic ribonucleic acid sequences encoding one or more peptide antigens and one or more ribonucleic acid sequences encoding one or more peptide adjuvants. Typically, the ribonucleic acids are encapsulated within the nanoparticle, and / or the one or more ribonucleic acid sequences encoding the one or more antigens and the one or more adjuvants are included within the same ribonucleic acid. In some forms, the ribonucleic acid sequence(s) includes between approximately 100 and 15,000 bases, inclusive. In some forms, the ribonucleic acid sequence(s) encode two or more species of protein antigens. In some forms, the ribonucleic acid sequence(s) encode two or more species of protein adjuvants. In some forms, one or more peptide antigen(s) is derived from a source selected from the group including an infectious agent, a parasite, a cancer and a peptide allergen. For example, in some forms, one or more peptide antigen(s) is derived from an infectious agent selected from a virus, a fungi, a protozoan and a bacterium. In certain forms, one or more peptide antigen is derived from a virus. In other forms, 455738066.1 3 one or more peptide antigen(s) is derived from a virus selected from a filovirus, an arenavirus, a coronavirus an orthopoxvirus and an orthomyxovirus. Exemplary viruses include Merkel Cell Polyomavirus (MCPyV), Influenza virus, Ebola virus, Zika Virus, and SARS-CoV-2. In other forms, one or more peptide antigen(s) is derived from a fungus, for example, Candida albicans, Aspergillus fumigatus, Candida auris, Cryptococcus neoformans, or Candida glabrata. In other forms, one or more peptide antigen(s) is, or is derived from a cancer antigen, for example, alpha- actinin-4, Alphafetoprotein (AFP), Bcr-Abl fusion protein, Carcinoembryonic antigen (CEA), CA-125, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, epithelial tumor antigen, EF2, ETV6-AML1 fusion protein, LDLR-fucosyltransferaseAS fusion protein, HLA-A2, HLA-A11, hsp70-2, KIAAO205, Mart2, Mum-1, 2, and 3, neo-PAP, myosin class I, OS-9, pml-RARa fusion protein, PTPRK, K-ras, N-ras, Triosephosphate isomeras, Bage-1, Gage 3,4,5,6,7, GnTV, Herv-K-mel, Lage-1, Melanoma-associated antigen (MAGE);Mage- A1,2,3,4,6,10,12, Mage-C2, NA-88, NY-Eso-1 / Lage-2, SP17, SSX-2, and TRP2-Int2, MelanA (MART-I), gp100 (Pmel 17), tyrosinase, TRP-1, TRP-2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, p15(58), CEA, RAGE, NY-ESO (LAGE), SCP-1, Hom / Mel-40, PRAME, p53, H-Ras, HER-2 / neu, BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus (HPV) antigens E6 and E7, TSP-180, MAGE-4, MAGE-5, MAGE-6, p185erbB2, p180erbB-3, c-met, nm-23H1, PSA, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, b-Catenin, CDK4, Mum-1, p16, TAGE, PSMA, PSCA, CT7, telomerase, 43-9F, 5T4, 791Tgp72, a-fetoprotein, 13HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, G250, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7-Ag, MOV18, MUC-1, NB\70K, NY-CO-1, RCAS1, SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated protein), TAAL6, TAG72, TLP, tyrosinase, or TPS. In other forms, one or more peptide antigen(s) is derived from a bacterium, for example, Bacillus Spp, Yersinia Spp, Spirochetes Spp, Rickettsia Spp, Staphylococcus aureus, or Escherichia coli. In other forms, one or more peptide antigen(s) is a tolerogenic antigen, optionally derived from an allergen. In other forms, one or more peptide antigen(s) is derived from a protozoan. Exemplary peptide antigen(s) that may be included in the described compositions include a cytokine, a TLR agonist, a pattern recognition receptor, a chemotactic factor, and a transcriptional regulator. Exemplary cytokines include IL-2, IL-7 and IL-15. Pharmaceutical composition including the described synthetic mRNAs, and / or nanoparticles encapsulating the described synthetic mRNAs, and / or cells including the described mRNAs, together with a pharmaceutically acceptable excipient, are also described. In some forms, the pharmaceutical compositions further include one or more additional active agents. 455738066.1 4 Methods of using the described compositions for inducing an immune response to a peptide antigen in a subject are also provided. Typically, the methods include administering to the subject the described pharmaceutical composition(s) in an amount effective to induce or stimulate an immune response in the subject to the peptide antigen(s). Preferably, the immune response to the peptide antigen is effective to treat or prevent an infection and / or disease in the subject caused by the organism or agent from which the antigen is derived. In exemplary methods, the peptide antigen is effective to treat or prevent a tumor, for example, whereby the antigen is an autologous tumor antigen. In other exemplary methods, the peptide antigen is effective to treat or prevent a bacterial infection, for example, whereby the antigen is derived from a pathogenic bacterium. In other exemplary methods, the peptide antigen is effective to treat or prevent a viral infection, for example, whereby the antigen is derived from a pathogenic virus. In further exemplary methods, the peptide antigen is effective to treat or prevent a fungal infection, for example, whereby the antigen is derived from a pathogenic fungus. In yet further exemplary methods, the peptide antigen is effective to treat or prevent a protozoan infection, for example, whereby the antigen is derived from a pathogenic protozoan. Methods of treating a subject having a disease, disorder, or condition, including administering to the subject an effective amount of the described pharmaceutical composition to treat or reduce a symptom of the disease, disorder, or condition in the subject are also provided. In some forms, composition is administered to the patient via intramuscular, intravenous, subcutaneous or intraperitoneal injection. Typically, the subject has a disease or disorder, or has been identified as being at increased risk of getting a disease or disorder. For example, in some forms, the subject has cancer, or has been identified as being at increased risk of getting a cancer. In some forms, the subject has an infectious disease, or has been identified as being at increased risk of getting an infectious disease. Kits, including the described synthetic mRNAs, or the described nanoparticles of any are also provided. In some forms, the kit further includes instructions for performing the described methods. A nucleic acid including the nucleotide sequence set forth in SEQ ID NO:18 is also provided. A nucleic acid including the nucleotide sequence set forth in SEQ ID NO:19 is also provided. BRIEF DESCRIPTION OF THE DRAWINGS Figure 1 is a diagram of a plasmid designed to encode a functional mRNA subunit of human IL-7. The coding sequence for mRNA subunit containing IL-7 gene is present between MluI and XbaI restriction sites and is under the control of a T7 promoter. The T7 promoter sequence is modified to end with an AGG sequence for compatibility with Trilink (San Diego, 455738066.1 5 CA) CleanCap 5’ mRNA capping technology.5’ untranslated region (UTR) contains a synthetic sequence optimized for high efficiency translation. Natural 3’ UTRs from each potential adjuvant are used (first 100 base used for longer 3’ UTR regions), followed by 100 base polyadenylation sequence. Figures 2A-2D are plots showing elevated levels of cytokines in HEK 293T cells after transfection of lipid nanoparticles (LNP) containing mRNA adjuvants. The cytokine output was determined using ELISA. For each cytokine mRNA, there was detection of a significant amount of the matched cytokine XCL1 (Fig.2A), IL-7 (Fig.2B), IL-2 (Fig.2C), IRF3 (Fig.2D) compared to control samples containing no transfection (NS) and lipofectamine (LIPO). Figure 3 is a plot showing evaluation of adjuvant immunomodulatory effects in vivo. In a murine melanoma model, addition of IL-7 adjuvant transcripts to the Large T antigen (LTA) mRNA vaccine resulted in significant tumor growth suppression compared to LTA vaccine alone, and placebo. Figures 4A-4D are plots showing the effects of adjuvant IL-7 on immune memory formation. Spleen of mice treated with LTA alone or LTA + IL-7 were processed and analyzed for immune cells populations using flow cytometry. LTA + IL-7 treatments have increased total T cells as well as an increased proportion of CD8+ T cells that are enriched in memory markers (Fig.4B and Fig.4D) compared to LTA alone (Fig.4A and Fig.4C). Figure 5 is a plasmid diagram designed to encode single functional mRNA subunit containing target antigen (LTA) linked to adjuvant IL-2. A self-cleaving P2A linker with a Furin cleavage site is included that produces full length antigen and functional full-length cytokine as separate end products. The LTA-P2A-IL2 mRNA template Sequence is present between MluI and XbaI restriction sites and is under the control of a T7 promoter. Figure 6 is a plasmid diagram designed to encode single functional mRNA subunit containing target antigen (LTA) linked to adjuvants, IL-7 and IL-2. A self-cleaving P2A linker followed by a self-cleaving T2A linker with a Furin cleavage site is included that produces full length antigen and functional full-length cytokines (IL-7 and IL-2) as separate end products. The LTA-P2A-IL7-T2A-IL2 mRNA template Sequence is present between MluI and XbaI restriction sites and is under the control of a T7 promoter. Figures 7A-7B are a pair of plots showing production of cytokine with linked mRNA constructs. The LTA-P2A-IL7, LTA-P2A-IL2, and LTA-P2A-IL7-T2A-IL2 mRNA were transfected into HEK 293T cells. No transfection (NS), lipofectamine (LIPO), and LTA are used as control samples. The cytokine output was determined using ELISA. High levels of IL-2 (Fig. 7A) and IL-7 (Fig.7B) production are observed with single and double linked constructs compared to other samples. 455738066.1 6 Figures 8A-8B are graphs of the efficacy of the IL-7 + antigen co-encoded vaccine for developing CD8+ T cell memory, showing %Dextramer(+) CD8+ T Cells (Fig.8A) and %Dextramer(+) IL7+CD8+CD3+ (Fig.8B), respectively, for each of placebo, LTA-vaccine (LTA) and LTA+IL-7-containing vaccine (LTA+IL-7) treatment groups, respectively. Figure 9 is a graph of the effect of the IL-2+IL -7+antigen-encoded vaccines on the frequency of antigen-specific T cells, showing CD8+ tetramer+ per mg for each of Ova, IL-7 only, IL-2 only, Ova+IL-7, Ova+IL-2 or Ova+IL-7+IL-2 mRNA encoded immunotherapies, respectively. Figures 10A-10B are graphs of Blue Fluorescent Protein (BFP)+ cell frequency over time (hours) for each of 293T cells (Fig.10A) and MuTuDCs (Fig.10B), respectively, transfected. with either Blue Fluorescent Protein-containing (BFP), signal peptide-BFP- containing (SP-BFP), Clec9a-Binding-Peptide-BFP-containing (CBP-BFP) or SP-CBP-BFP mRNAs, respectively. DETAILED DESCRIPTION OF THE INVENTION The disclosed method and compositions can be understood more readily by reference to the following detailed description of particular forms and the Example included therein and to the Figures and their previous and following description. It is to be understood that the disclosed method and compositions are not limited to specific synthetic methods, specific analytical techniques, or to particular reagents unless otherwise specified, and, as such, can vary. It is also to be understood that the terminology used herein is for the purpose of describing particular forms only and is not intended to be limiting. I. Definitions The term “vector” refers to a nucleic acid molecule or polynucleotide, such as a replicating RNA, plasmid, phage, or cosmid, into which another nucleic acid sequence segment may be inserted so as to bring about the replication of the inserted segment. The described vectors can be expression vectors. The term “expression vector” refers to a vector that includes one or more expression control sequences. The term “gene” or “genes” refers to isolated or modified nucleic acid sequences, including both RNA and DNA, that encode genetic information for the synthesis of a whole RNA, a whole protein, or any portion of such whole RNA or whole protein. Genes that are not naturally part of a particular organism's genome are referred to as “foreign genes”, “heterologous genes” or “exogenous genes” and genes that are naturally a part of a particular organism's genome are referred to as “endogenous genes”. The term “gene” as used with reference to genomic DNA includes intervening, non-coding regions as well as regulatory regions and can include 5’ and 3’ ends. 455738066.1 7 The term “expressed” or “expression” refers to the transcription from DNA to an RNA nucleic acid molecule at least complementary in part to a region of one of the two nucleic acid strands of the gene. The term “expressed” or “expression” also refers to the translation from said RNA nucleic acid molecule to give a protein or polypeptide or a portion thereof. The term “antigen” refers to any substance (e.g., peptide, protein, nuclei acid, lipid, small molecule, such as a moiety expressed by or otherwise associated with a pathogen or cancerous or pre-cancerous cell) that serves as a target for the receptors of an adaptive immune response. The antigen may be a structural component of a pathogen, cancerous or pre-cancerous cell. The term “pathogen” refers to an organism or other entity that causes a disease. For example, pathogens can be prions, viruses, prokaryotes such as bacteria, eukaryotes such as protozoa and fungi. A pathogen can be the source of an antigen to which an adaptive immune response can be generated. The term “polypeptide” includes proteins and fragments thereof. Polypeptides are described as amino acid residue sequences. Those sequences are written left to right in the direction from the amino (N) to the carboxyl (C) terminus. In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V). As used herein, the term “antibody” refers to any immunoglobulin, whether natural or wholly or partially synthetically produced. All derivatives thereof which maintain specific binding ability are also included in the term. The term also covers any protein having a binding domain which is homologous or largely homologous to an immunoglobulin binding domain. Such proteins may be derived from natural sources, or partly or wholly synthetically produced. An antibody may be monoclonal or polyclonal. An antibody may be a member of any immunoglobulin class, including any of the human classes: IgG, IgM, IgA, IgD, and IgE. As used herein, the terms “antibody fragment” or “characteristic portion of an antibody” are used interchangeably and refer to any derivative of an antibody which is less than full-length. An antibody fragment can retain at least a significant portion of the full-length antibody's specific binding ability. Examples of such antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, scFv, Fv, dsFv diabody, and Fd fragments. Antibody fragment also include Fc fragments. An antibody fragment may be produced by any means. For example, an antibody fragment may be enzymatically or chemically produced by fragmentation of an intact antibody 455738066.1 8 and / or it may be recombinantly produced from a gene encoding the partial antibody sequence. Alternatively or additionally, an antibody fragment may be wholly or partially synthetically produced. An antibody fragment may optionally comprise a single chain antibody fragment. Alternatively or additionally, an antibody fragment may include multiple chains which are linked together, for example, by disulfide linkages. An antibody fragment may optionally include a multimolecular complex. A functional antibody fragment will typically include at least about 50 amino acids and more typically will include at least about 200 amino acids. The terms “individual,” “subject,” and “patient” are used interchangeably, and refer to a mammal, including, but not limited to, humans, rodents, such as mice and rats, and other laboratory animals. As used herein, the terms “approximately” or “about” in reference to a number are generally taken to include numbers that fall within a range of 5%, 10%, 15%, or 20% in either direction (greater than or less than) of the number unless otherwise stated or otherwise evident from the context (except where such number would be less than 0% or exceed 100% of a possible value). As used herein, the term “associated with” refers to the state of two or more entities which are linked by a direct or indirect covalent or non-covalent interaction. In some forms, an association is covalent. In some forms, a covalent association is mediated by a linker moiety. In some forms, an association is non-covalent (e.g., charge interactions, affinity interactions, metal coordination, physical adsorption, host-guest interactions, hydrophobic interactions, TT stacking interactions (π-π stacking interactions), hydrogen bonding interactions, van der Waals interactions, magnetic interactions, electrostatic interactions, dipole-dipole interactions, etc.). For example, in some forms, an entity (e.g., immunomodulatory agent, targeting moiety, immunostimulatory agent, nanoparticle, etc.) may be covalently associated with a vaccine nanocarrier. In some forms, an entity (e.g., immunomodulatory agent, targeting moiety, immunostimulatory agent, nanoparticle, etc.) may be non-covalently associated with a vaccine nanocarrier. For example, the entity may be associated with the surface of, encapsulated within, surrounded by, and / or distributed throughout a lipid bilayer, lipid monolayer, polymeric matrix, etc. of an inventive vaccine nanocarrier. As used herein, the term “cell type” refers to a form of cell having a distinct set of morphological, biochemical, and / or functional characteristics that define the cell type. One of skill in the art will recognize that a cell type can be defined with varying levels of specificity. For example, T cells and B cells are distinct cell types, which can be distinguished from one another but share certain features that are characteristic of the broader “lymphocyte” cell type of which both are members. Typically, cells of different types may be distinguished from one 455738066.1 9 another based on their differential expression of a variety of genes which are referred to in the art as “markers” of a particular cell type or types (e.g., cell types of a particular lineage). In some forms, cells of different types may be distinguished from one another based on their differential functions. A “cell type-specific marker” is a gene product or modified version thereof that is expressed at a significantly greater level by one or more cell types than by all or most other cell types and whose expression is characteristic of that cell type. Many cell-type specific markers are recognized as such in the art. As used herein, the term “in vitro” refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, etc., rather than within an organism (e.g., animal, plant, and / or microbe). As used herein, the term “in vivo” refers to events that occur within an organism (e.g., animal, plant, and / or microbe). The terms “immunologic”, “immunological” or “immune” response refer to the development of a beneficial humoral (antibody mediated) and / or a cellular (mediated by antigen- specific T cells or their secretion products) response directed against an immunogen in a recipient patient. Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells. The relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating antibodies and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject. As used herein, the term “immunostimulatory agent” refers to an agent that modulates an immune response to an antigen but is not the antigen or derived from the antigen. “Modulate”, as used herein, refers to inducing, enhancing, suppressing, directing, or redirecting an immune response. Such agents include immunostimulatory agents that stimulate (or boost) an immune response to an antigen but, as defined above, is not the antigen or derived from the antigen. Immunostimulatory agents, therefore, include adjuvants. In some forms, the immunostimulatory agent is on the surface of the nanocarrier and / or is encapsulated within the nanocarrier. In some forms, the immunostimulatory agent on the surface of the nanocarrier is different from the immunostimulatory agent encapsulated within the nanocarrier. In some forms, the nanocarrier includes more than one type of immunostimulatory agent. In some forms, the more than one type of immunostimulatory agent act on different pathways. Examples of immunostimulatory agents include those provided elsewhere herein. As used herein, the term “nucleic acid,” in its broadest sense, refers to any compound and / or substance that is or can be incorporated into an oligonucleotide chain. In some forms, a nucleic acid is a compound and / or substance that is or can be incorporated into an 455738066.1 10 oligonucleotide chain via a phosphodiester linkage. In some forms, “nucleic acid” refers to individual nucleic acid residues (e.g., nucleotides and / or nucleosides). In some forms, “nucleic acid” refers to an oligonucleotide chain including individual nucleic acid residues. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably. In some forms, “nucleic acid” encompasses RNA as well as single and / or double-stranded DNA and / or cDNA, any natural or synthetic linear and sequential arrays of nucleotides and nucleosides, for example, replicating RNA (repRNA), messenger RNA (mRNA), small interfering RNA (siRNA), transfer RNA (tRNA), microRNA (miRNA), guide strand RNA (sgRNA), polynucleotides, oligo-nucleotides, oligo-nucleosides and derivatives thereof. Such nucleic acids may be collectively referred to as “constructs,” or “plasmids.” Furthermore, the terms “nucleic acid”, “DNA”, “RNA”, and / or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone. For example, the so- called “peptide nucleic acids,” which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. The term “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and / or encode the same amino acid sequence. Nucleotide sequences that encode proteins and / or RNA may include introns. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can include nucleoside analogs such as analogs having chemically modified bases or sugars, backbone modifications, etc. A nucleic acid sequence is presented in the 5' to 3' direction unless otherwise indicated. The term “nucleic acid segment” is used herein to refer to a nucleic acid sequence that is a portion of a longer nucleic acid sequence. In many forms, a nucleic acid segment includes at least 3, 4, 5, 6, 7, 8, 9, l 0, or more residues. In some forms, a nucleic acid is or includes natural nucleosides (e.g., adenine (A); cytosine (C); guanine (G); and thymine (T) (uracil (U) for thymine (T) when the polynucleotide is RNA), deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2- thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl-uridine, 2-aminoadenosine, C5-bromouridine, C5- fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynylcytidine, C5-methylcytidine, 2- aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0( 6)- methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2'-fluororibose, ribose, 2' - deoxyribose, arabinose, and hexose); and / or modified phosphate groups (e.g., phosphorothioates and 5'-N- phosphoramidite linkages). In some cases, nucleotide sequences are provided using 455738066.1 11 character representations recommended by the International Union of Pure and Applied Chemistry (IUPAC) or a subset thereof. IUPAC nucleotide codes used herein include, A = Adenine, C = Cytosine, G = Guanine, T = Thymine, U = Uracil, R = A or G, Y = C or T, S = G or C, W = A or T, K = G or T, M = A or C, B = C or G or T, D = A or G or T, H = A or C or T, V = A or C or G, N = any base, “.” or “-“ = gap. In some forms the set of characters is (A, C, G, T, U) for adenosine, cytidine, guanosine, thymidine, and uridine respectively. In some forms the set of characters is (A, C, G, T, U, I, X, Ψ) for adenosine, cytidine, guanosine, thymidine, uridine, inosine, uridine, xanthosine, pseudouridine respectively. In some forms the set of characters is (A, C, G, T, U, I, X, Ψ, R, Y, N) for adenosine, cytidine, guanosine, thymidine, uridine, inosine, uridine, xanthosine, pseudouridine, unspecified purine, unspecified pyrimidine, and unspecified nucleotide respectively. As used herein, a “particle” refers to any entity having a diameter of less than 10 microns (µm). Typically, particles have a longest dimension (e.g., diameter) of 1000 nm or less. In some forms, particles have a diameter of 300 nm or less. Particles include microparticles, nanoparticles, and pico-particles. In some forms, nanoparticles have a diameter of 200 nm or less. In some forms, nanoparticles have a diameter of 100 nm or less. In some forms, nanoparticles have a diameter of 50 nm or less. In some forms, nanoparticles have a diameter of 30 nm or less. In some forms, nanoparticles have a diameter of 20 nm or less. In some forms, nanoparticles have a diameter of 10 nm or less. In some forms, particles can be a matrix of polymers. In some forms, particles can be a non-polymeric particle (e.g., a metal particle, quantum dot, ceramic, inorganic material, bone, etc.). Particles may also be liposomes and / or micelles. As used herein, the term “nanoparticle” refers to any particle having a diameter of less than 1000 run. The nanocarriers of the compositions provided herein, in some forms, have a mean geometric diameter that is less than 500 nm. In some forms, the nanocarriers have mean geometric diameter that is greater than 50 nm but less than 500 nm. In some forms, the mean geometric diameter of a population of nanocarriers is about 60 nm, 75 nm, 100 nm, 125 nm, 150 nm, 175 nm, 200 nm, 225 run, 250 nm, 275 nm, 300 nm, 325 nm, 350 run, 375 nm, 400 nm, 425 nm, 450 nm, or 475 nm. In some forms, the mean geometric diameter is between 100-400 nm, 100-300 nm, 100-250 nm, or 100-200 run. In some forms, the mean geometric diameter is between 60-400 nm, 60-350 run, 60-300 nm, 60-250 nm, or 60-200 nm. In some forms, the mean geometric diameter is between 75-250 nm. In some forms, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the nanocarriers of a population of nanocarriers have a diameter that is less than 500 nM. In some forms, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the nanocarriers of a population of nanocarriers have a diameter that is greater than 50 nm but less than 500 nm. In some forms, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of 455738066.1 12 the nanocarriers of a population of nanocarriers have a diameter of about 60 nm, 75 nm, 100 nm, 125 nm, 150 nm, 175 nm, 200 nm, 225 nm, 250 nm, 275 nm, 300 nm, 325 nm, 350 nm, 375 nm, 400 nm, 425 nm, 450 nm, or 475 nm. In some forms, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the nanocarriers of a population of nanocarriers have a diameter that is between 100-400 nm, 100-300 nm, 100-250 nm, or 100- 200 nm. In some forms, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more of the nanocarriers of a population of nanocarriers have a diameter that is between 60-400 nm, 60-350 nm, 60-300 nm, 60-250 nm, or 60-200 nm. As used herein, the term “poorly immunogenic antigen” refers to an antigen that does not trigger any or a sufficient level of a desired immune response. “Sufficient”, as used herein, refers to the ability to elicit a detectable or protective immune response when administered in a composition that does not employ a nanocarrier described herein, e.g., as free antigen mixed with adjuvant in the absence of a nanocarrier. In some forms, the desired immune response is to treat or prevent a disease or condition. In certain forms, the desired immune response is to alleviate one or more symptoms of a disease or condition. Poorly immunogenic antigens include, but are not limited to, self antigens, small molecules, and carbohydrates. As used herein, the term “self antigen” refers to a normal substance in the body of an animal that when an immune response against the antigen within the animal is triggered, autoimmunity (e.g., an autoimmune disease) can result. A self antigen can be a protein or peptide, lipoprotein, lipid, carbohydrate, or a nucleic acid. The nucleic acid can be a DNA or RNA. Self antigens include, but are not limited to enzymes, structural proteins, secreted proteins, cell surface receptors, and cytokines. In some forms, the self antigen is a cytokine, and the cytokine is TNF, IL-1, or IL-6. In some forms, the self antigen is cholesteryl ester transfer protein (CETP), a serum protein responsible for cholesterol transfer from high-density lipoprotein (HDL) to low-density lipoprotein cholesterol (LDL), the AP protein associated with Alzheimer's, a proteolytic enzyme that processes the pathological form of the AP protein, LDL associated with atherosclerosis, or a coreceptor for HIV-1. In some forms, the proteolytic enzyme that processes the pathological form of the AP protein is beta-secretase. In some forms, the LDL associated with atherosclerosis is oxidized or minimally modified. In some forms, the coreceptor for HIV-1 is CCR5. In general, a “small molecule” is understood in the art to be an organic molecule that is less than about 2000 g / mol in size. In some forms, the small molecule is less than about 1500 g / mol or less than about 1000 g / mol. In some forms, the small molecule is less than about 800 g / mol or less than about 500 g / mol. In some forms, small molecules are non-polymeric and / or non-oligomeric. In some forms, small molecules are not proteins, peptides, or amino acids. In 455738066.1 13 some forms, small molecules are not nucleic acids or nucleotides. In some forms, small molecules are not saccharides or polysaccharides. As used herein, the term “T cell antigen” refers to any antigen that is recognized by and triggers an immune response in a T cell (e.g., an antigen that is specifically recognized by a T cell receptor on a T cell via presentation of the antigen or portion thereof bound to a major histocompatibility complex molecule (MHC). In some forms, an antigen that is a T cell antigen is also a B cell antigen. In other forms, the T cell antigen is not also a B cell antigen. T cells antigens generally are proteins or peptides. T cell antigens may be an antigen that stimulates a CD8+ T cell response, a CD4+ T cell response, or both. The nanocarriers, therefore, in some forms can effectively stimulate both types of responses. As used herein, the term “target” or “marker” refers to any entity that is capable of specifically binding to a particular targeting moiety. In some forms, targets are specifically associated with one or more particular tissue types. In some forms, targets are specifically associated with one or more particular cell types. For example, a cell type specific marker is typically expressed at levels at least 2 fold greater in that cell type than in a reference population of cells. In some forms, the cell type specific marker is present at levels at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 50 fold, at least 100 fold, or at least 1000 fold greater than its average expression in a reference population. Detection or measurement of a cell type specific marker may make it possible to distinguish the cell type or types of interest from cells of many, most, or all other types. In some forms, a target can include a protein, a carbohydrate, a lipid, and / or a nucleic acid, as described herein. A substance is considered to be “targeted” for the purposes described herein if it specifically binds to a target. In some forms, a targeting moiety specifically binds to a target under stringent conditions. An inventive nanocarrier, such as a vaccine nanocarrier, including a targeting moiety is considered to be “targeted” if the targeting moiety specifically binds to a target, thereby delivering the entire nanocarrier to a specific organ, tissue, cell, and / or subcellular locale. As used herein, the term “targeting moiety” refers to any moiety that binds to a component of a cell. In some forms, the targeting moiety specifically binds to a component of a cell. Such a component is referred to as a “target” or a “marker.” A targeting moiety may be a polypeptide, glycoprotein, nucleic acid, small molecule, carbohydrate, lipid, etc. In some forms, a targeting moiety is an antibody or characteristic portion thereof. In some forms, a targeting moiety is a receptor or characteristic portion thereof. In some forms, a targeting moiety is a ligand or characteristic portion thereof. In some forms, a targeting moiety is a nucleic acid targeting moiety (e.g., an aptamer) that binds to a cell type specific marker. In some forms, a 455738066.1 14 targeting moiety is a small molecule. The targeting moiety in some forms is on the surface of the nanocarrier. In other forms, the targeting moiety is encapsulated within the nanocarrier. In still other forms, the targeting moiety is associated with the nanocarrier. In some forms, the targeting moiety is covalently associated with the nanocarrier. In other forms, the targeting moiety is non-covalently associated with the nanocarrier. In yet other forms, the targeting moiety binds a receptor expressed on the surface of a cell. The targeting moiety, in some forms, binds a soluble receptor. In some forms, the soluble receptor is a complement protein or a pre-existing antibody. In further forms, the targeting moiety is for delivery of the nanocarrier to antigen presenting cells, T cells, or B cells. In some forms, the antigen presenting cells are macrophages. In other forms, the macrophages are subcapsular sinus macrophages. In still other forms, the antigen presenting cells are dendritic cells. In some forms, the antigen presenting cells are follicular dendritic cells. Specific non-limiting examples of targeting moieties include molecules that bind to CD11b (Mac-1), CD169, mannose receptor, DEC-205, CD11c, CD21 / CD35, CX3CR1, or a Fc receptor. In some forms, the molecule that binds any of the foregoing is an antibody or antigen-binding fragment thereof (e.g., an anti-CD169 antibody). In some forms, the molecule that binds a Fc receptor is one that includes the Fc portion of an immunoglobulin (e.g., IgG). In other forms, the Fc portion of an immunoglobulin is a human Fc portion. In some forms, the molecule that binds CX3CR1 is CX3CL1 (fractalkine). Targeting moieties that bind CD169 include anti-CD169 antibodies and ligands of CD169, e.g., sialylated CD227, CD43, CD206, or portions of these ligands that retain binding function, e.g., soluble portions. As used herein, the term “therapeutically effective amount” means an amount of a therapeutic, prophylactic, and / or diagnostic agent (e.g., inventive vaccine nanocarrier) that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and / or condition, to treat, alleviate, ameliorate, relieve, alleviate symptoms of, prevent, delay onset of, inhibit progression of, reduce severity of, and / or reduce incidence of the disease, disorder, and / or condition. The term is also intended to refer to an amount of nanocarrier or composition thereof provided herein that modulates an immune response in a subject. As used herein, the term “therapeutic agent” refers to any agent that, when administered to a subject, has a therapeutic, prophylactic, and / or diagnostic effect and / or elicits a desired biological and / or pharmacological effect. As used herein, the term “treating” refers to partially or completely alleviating, ameliorating, relieving, delaying onset of, inhibiting progression of, reducing severity of, and / or reducing incidence of one or more symptoms or features of a particular disease, disorder, and / or condition. For example, “treating” a microbial infection may refer to inhibiting survival, growth, and / or spread of the microbe. Treatment may be administered to a subject who does not exhibit 455738066.1 15 signs of a disease, disorder, and / or condition and / or to a subject who exhibits only early signs of a disease, disorder, and / or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and / or condition. In some forms, treatment includes delivery of an inventive vaccine nanocarrier to a subject. As used herein, the term “vaccine nanocarrier” refers to an entity including at least one immunomodulatory agent or immunostimulatory agent. In certain forms, a vaccine nanocarrier includes at least two types of immunomodulatory agents. In some forms, the immunomodulatory agents are antigens, and the vaccine nanocarrier includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens. The different antigens can be or be derived from completely different antigenic molecules, or the different antigens can be different epitopes from the same antigenic molecule. In other forms, the vaccine nanocarrier includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more different epitopes from the same antigenic molecule. A vaccine nanocarrier may be any form of particle. A vaccine nanocarrier, in some forms, is capable of stimulating an immune response in T cells and / or B cells. In other forms, the vaccine nanocarrier is capable of enhancing, suppressing, directing, or redirecting an immune response. In some forms, any assay available in the art may be used to determine whether T cells and / or B cells have been stimulated. In some forms, T cell stimulation may be assayed by monitoring antigen- induced production of cytokines, antigen- induced proliferation of T cells, and / or antigen- induced changes in protein expression. In some forms, B cell stimulation may be assayed by monitoring antibody titers, antibody affinities, antibody performance in neutralization assays, class-switch recombination, affinity maturation of antigen-specific antibodies, development of memory B cells, development of long-lived plasma cells that can produce large amounts of high-affinity antibodies for extended periods of time, germinal center reactions, and / or antibody performance in neutralization assays. In some forms, a vaccine nanocarrier further includes at least one targeting moiety that can help deliver the vaccine nanocarrier to a particular target (e.g., organ, tissue, cell, and / or subcellular locale) within a subject. In some forms, a vaccine nanocarrier further includes at least one immunostimulatory agent that can help stimulate an immune response in T cells and / or B cells. In some forms, a vaccine nanocarrier further includes at least one nanoparticle that allows for tunable membrane rigidity and controllable liposome stability. In some forms, vaccine nanocarriers include lipids, amphiphilic compounds, polymers, sugars, polymeric matrices, and / or non-polymeric particles. The term “biocompatible” refers to one or more materials that are neither themselves toxic to the host (e.g., an animal or human), nor degrade (if the polymer degrades) at a rate that produces monomeric or oligomeric subunits or other byproducts at toxic concentrations in the host. 455738066.1 16 The term “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the therapeutic compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions. The terms “synthetic messenger ribonucleic acid”, or “synthetic mRNA” as used herein refer to a non-naturally occurring messenger ribonucleic acid sequence, for example, including two or more open reading frames encoding two or more distinct polypeptides within a single mRNA molecule. The described synthetic mRNAs may include natural nucleotides, synthetic nucleotides (such as nucleotide analogs), or mixtures thereof. Exemplary synthetic mRNAs include a peptide antigen and a peptide adjuvant co-encoded on the same mRNA molecule, configured for co-expression of both the peptide antigen and the peptide adjuvant as distinct peptides within a host cell. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate value is incorporated into the specification as if it were individually recited herein. Use of the term “about” is intended to describe values either above or below the stated value in a range of approx. + / - 10%; in other forms the values may range in value either above or below the stated value in a range of approx. + / - 5%; in other forms the values may range in value either above or below the stated value in a range of approx. + / - 2%; in other forms the values may range in value either above or below the stated value in a range of approx. + / - 1%. The preceding ranges are intended to be made clear by context, and no further limitation is implied. Every compound disclosed herein is intended to be and should be considered to be specifically disclosed herein. Further, every subgroup that can be identified within this disclosure is intended to be and should be considered to be specifically disclosed herein. As a result, it is specifically contemplated that any compound, or subgroup of compounds can be either specifically included for or excluded from use or included in or excluded from a list of compounds. Disclosed are the components to be used to prepare the disclosed compositions as well as the compositions themselves to be used within the methods disclosed herein. These and other materials are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these materials are disclosed that while specific reference of each various individual and collective combinations and permutation of these compounds may not be 455738066.1 17 explicitly disclosed, each is specifically contemplated and described herein. For example, if a particular polypeptide is disclosed and discussed and a number of modifications that can be made to a number of polypeptides are discussed, specifically contemplated is each and every combination and permutation of polypeptides and the modifications that are possible unless specifically indicated to the contrary. Thus, if a class of molecules A, B, and C are disclosed as well as a class of molecules D, E, and F and an example of a combination molecule, A-D is disclosed, then even if each is not individually recited each is individually and collectively contemplated meaning combinations, A-E, A-F, B-D, B-E, B-F, C-D, C-E, and C-F are considered disclosed. Likewise, any subset or combination of these is also disclosed. Thus, for example, the sub-group of A-E, B-F, and C-E would be considered disclosed. This concept applies to all aspects of this application including, but not limited to, steps in methods of making and using the disclosed compositions. Thus, if there are a variety of additional steps that can be performed it is understood that each of these additional steps can be performed with any specific form or combination of forms of the disclosed methods. II. Compositions Compositions of synthetic messenger ribonucleic acid (mRNA) including one or more ribonucleic acid sequences encoding one or more peptide antigens, and / or one or more ribonucleic acid sequences encoding one or more peptide adjuvants, and / or one or more other immune-modulatory agent peptide(s) for the expression of peptide antigen and peptide adjuvant, and optionally one or more other immuno-modulatory peptides in the same host cell are described. Typically, the ribonucleic acid is configured to express the peptide antigen(s) and the peptide adjuvant(s) and optionally other immuno-modulatory peptides as distinct polypeptides within a mammalian cell. In some forms, the synthetic mRNA includes one or more ribonucleic acid sequences encoding one or more antigens and one or more ribonucleic acid sequences encoding one or more adjuvants and optionally one or more ribonucleic acid sequences encoding one or more other immuno-modulatory peptides within the same ribonucleic acid molecule. It has been established that inclusion of specific immunologically active molecules that provide signals of expansion, activation, and polarization in particular combinations can improve the efficacy of mRNA vaccines. The described compositions include mRNA adjuvants co- encapsulated with mRNA antigens, or mRNA adjuvants and optionally other immuno- modulatory peptides, co-encoded on the same mRNA strand as mRNA encoding a vaccine antigen. The efficacy of delivery of molecules, such as nucleic acids, to the interior of cells is strongly correlated with overcoming barriers such as uptake by antigen-presenting cells, phagosomal / lysosomal escape, nucleic acid un-packaging, intracellular translocation, etc. In the 455738066.1 18 case of genetic material, sustained gene expression is also a consideration. To effectively persist in the blood stream and facilitate uptake by a target cell, the delivery vehicles should exhibit minimal immunogenicity. To be clinically important, delivery vehicles should exert minimal cytotoxicity. Therefore, delivery vehicles, including synthetic nanoparticles that encompass and / or encapsulate the synthetic RNAs are also provided. A. Synthetic mRNA sequences It has been established that the efficacy of mRNA vaccines encoding one or more peptide antigens for expression in a host cell can be enhanced by the addition of one or more mRNA sequences encoding peptide adjuvant(s) for expression of the adjuvant in the same host cell. Compositions of synthetic mRNA sequences encoding peptide antigen(s) and peptide adjuvant(s) are described. The peptide antigen(s) and peptide adjuvant(s) can be encoded on the same or different mRNA molecules. In exemplary forms, a synthetic messenger ribonucleic acid (mRNA) includes (a) one or more ribonucleic acid sequences encoding one or more peptide antigens; and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvants, whereby the ribonucleic acid is configured to express the peptide antigen(s) and the peptide adjuvant(s) as distinct polypeptides within a mammalian cell. In some forms, the ribonucleic acid sequence(s) encoding each of the antigen(s) and each of the ribonucleic acid sequence(s) encoding the adjuvant(s) are connected via one or more cleavable linker(s). Exemplary linker(s) include a P2A linker and a Furin cleavage site, for example, whereby the Furin cleavage site excludes the linker amino acids. In some forms, the Furin cleavage site and the P2A linker are joined by a linker including amino acid residues GSG. In some forms, a synthetic mRNA includes a single 5’ Cap 1 structure, and a poly Adenylated 3’ tail structure. Typically, the synthetic mRNA includes a single 5’ untranslated region (5’ UTR), and a single 3’untranslated region (3’ UTR). 1. Peptide Adjuvants and Immuno-Signaling Agents The compositions of synthetic messenger ribonucleic acid (mRNA) include one or more ribonucleic acid sequences encoding one or more peptide adjuvants and / or Immuno-signaling agents. As used herein, the term “adjuvant” encompasses an immune-stimulatory molecule that is not an antigen per se. For example, the “adjuvant” may be any molecule that provides a co- stimulatory affect in a subject in addition to an antigen-specific immune response in the same subject. 455738066.1 19 As used herein, the term “immuno-signaling agent(s)” encompasses one or more molecules that provide one or more biological signals to provide specific immune functions or effects. In some forms, a multiplicity of immuno-signaling agents are combined to program specific immune functions or effect. For example, in some forms, a multiplicity of signals are combined together in a desired combination to provide one or more desired specific immune functions or effects. In some forms, where a multiplicity of immuno-signaling agents are combined, the multiplicity includes a peptide adjuvant as one of the immuno-signaling agents. The described peptide adjuvants can act via components of the innate and / or adaptive immune systems. For example, in some forms, the adjuvants act directly or indirectly to direct, stimulate, increase, reduce, prevent minimize and / or otherwise impact one or more of the biological functions of an immune effector cell, such as a dendritic cell, a macrophage cell, a glial cell, a CD4+ helper T cell, a CD8+ cytotoxic T cell, or other immune cells or processes. Exemplary peptide “adjuvant” molecules include cytokines, pattern recognition receptors, chemotactic factors, transcriptional regulators, and Toll-Like Receptors (TLRs). In some forms, adjuvants can include mutant versions of genes or de novo genetic sequences, as long as these sequences directly or through coding for peptide sequences induce specific immune functions or effects. i. Cytokines In some forms, the peptide adjuvant molecule is a cytokine molecule. Exemplary cytokine molecules include interleukins and tumor necrosis factors. a. Interleukin-2 (IL-2) In some forms, the peptide adjuvant molecule(s) is or includes Interleukin-2 (IL-2). IL-2 is a key cytokine involved in the activation and expansion of T cells, cells particularly cytotoxic T cells (CD8+ T cells) and natural killer (NK) cells (Berraondo et al., British Journal of cancer, 10:6-15, 2019). The T cells and NK cells play a central role in recognizing and killing cancer cells. By promoting the proliferation and activation of T cells, IL-2 enhances the immune response against cancer. IL-2 is an approximately 15.5 kDa glycoprotein, which includes 4 antiparallel amphipathic alpha helices. IL-2 is predominantly produced by antigen-activated Th1 CD4 T cells and to a lesser extent by CD8 T cells, natural killer (NK) cells, and NK T cells (Conlon et al., Journal of interferon & cytokine research, 39:1, 2019). An exemplary nucleic acid Coding Sequence for IL-2 is as follows: ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGTGCAC CTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGATTTACAGAT GATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATGCTCACATTTAAGTTT 455738066.1 20 TACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTGGAAGAAGAACTCAAACCTC TGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTAAGACCCAGGGACTTAATCAG CAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAAACAACATTCATGTGTGAATATGCT GATGAGACAGCAACCATTGTAGAATTTCTGAACAGATGGATTACCTTTTGTCAAAGCATCATCT CAACACTGACTTGA (SEQ ID NO:1). NOTE: Region in BOLD was changed from XBAI to codon optimized leucine sequence (CTA - > CTG). An exemplary amino acid sequence for IL-2 is as follows: MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKF YMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYA DETATIVEFLNRWITFCQSIISTLT (SEQ ID NO:2) b. Interleukin-7 (IL-7) In some forms, the peptide adjuvant molecule(s) is or includes Interleukin-7. IL-7 is another common gamma chain cytokine, produced by nonhematopoietic stromal and epithelial cells: bone marrow stromal cells, MHC II+ thymic epithelial cells, liver and intestinal epithelial cells, keratinocytes, follicular DCs, smooth muscle cells, and sometimes by DCs and macrophages (Conlon, et al., Journal of interferon & cytokine research, 39:1, 2019). An exemplary nucleic acid sequence for IL-7: ATGTTCCATGTTTCTTTTAGGTATATCTTTGGACTTCCTCCCCTGATCCTTGTTCTGTTGCCAG TAGCATCATCTGATTGTGATATTGAAGGTAAAGATGGCAAACAATATGAGAGTGTTCTAATGGT CAGCATCGATCAATTATTGGACAGCATGAAAGAAATTGGTAGCAATTGCCTGAATAATGAATTT AACTTTTTTAAAAGACATATCTGTGATGCTAATAAGGAAGGTATGTTTTTATTCCGTGCTGCTC GCAAGTTGAGGCAATTTCTTAAAATGAATAGCACTGGTGATTTTGATCTCCACTTATTAAAAGT TTCAGAAGGCACAACAATACTGTTGAACTGCACTGGCCAGGTTAAAGGAAGAAAACCAGCTGCC CTGGGTGAAGCCCAACCAACAAAGAGTTTGGAAGAAAATAAATCTTTAAAGGAACAGAAAAAAC TGAATGACTTGTGTTTCCTAAAGAGACTATTACAAGAGATAAAAACTTGTTGGAATAAAATTTT GATGGGCACTAAAGAACACTGA (SEQ ID NO:3) An exemplary amino acid sequence for IL-7: MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEF NFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAA LGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH (SEQ ID NO:4) c. Interleukin-15 (IL-15) In some forms, the peptide adjuvant molecule(s) is or includes Interleukin-15. IL-15 is a 14-to-15 kDa member of the 4-alpha-helix bundle family of cytokines. IL-15 is controlled at the level of transcription, but especially at the level of translation, so that although IL-15 message is 455738066.1 21 widely distributed, it is produced predominantly by DCs, epithelial cells, and monocytes (Conlon et al., Journal of interferon & cytokine research, 39:1, 2019). An exemplary nucleic acid sequence for IL-15: ATGAGAATTTCGAAACCACATTTGAGAAGTATTTCCATCCAGTGCTACTTGTGTTTACTTCTAA ACAGTCATTTTCTAACTGAAGCTGGCATTCATGTCTTCATTTTGGGCTGTTTCAGTGCAGGGCT TCCTAAAACAGAAGCCAACTGGGTGAATGTAATAAGTGATTTGAAAAAAATTGAAGATCTTATT CAATCTATGCATATTGATGCTACTTTATATACGGAAAGTGATGTTCACCCCAGTTGCAAAGTAA CAGCAATGAAGTGCTTTCTCTTGGAGTTACAAGTTATTTCACTTGAGTCCGGAGATGCAAGTAT TCATGATACAGTAGAAAATCTGATCATCCTAGCAAACAACAGTTTGTCTTCTAATGGGAATGTA ACAGAATCTGGATGCAAAGAATGTGAGGAACTGGAGGAAAAAAATATTAAAGAATTTTTGCAGA GTTTTGTACATATTGTCCAAATGTTCATCAACACTTCTTGA (SEQ ID NO:5). An exemplary amino acid sequence for IL-15: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLI QSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNV TESGCKECEELEEKNIKEFLQSFVHIVQMFINTS (SEQ ID NO:6). d. Interleukin-21 (IL-21) In some forms, the peptide adjuvant molecule(s) is or includes Interleukin-21. IL-21 is composed of 4-alpha-helical bundles (Spolski and Leonard, 2008). IL-21 has a major role in B cell differentiation into plasma cells, in the development of T follicular helper (Tfh) cells, promotes the development of Th17 cells, and enhances the survival, antiviral activity, and antitumor activity of CD8+ T cells. e. Interferon-alpha In some forms, the peptide adjuvant molecule(s) is or includes Interferon-alpha. This family of cytokines has been used for the treatment of several hematological malignancies and solid tumors at high doses to exploit their direct pro-apoptotic / antiproliferative activity on tumor cells. These high doses of IFN-α also exert anti-tumor activity due to effects on the tumor vasculature as IFN-α displays a potent antiangiogenic activity (Berraondo, et al., British Journal of cancer, 10:6-15, 2019). f. Interlekin-10 In some forms, the peptide adjuvant molecule(s) is or includes Interlekin-10. IL-10 is released by innate and adaptive immune cells to fine-tune the activity of pro-inflammatory cytokines. IL-10 is considered to be an immunosuppressive cytokine as it can decrease the antigen presenting activity of DCs and inhibit the cytotoxic and cytokine release functions performed by T and NK lymphocytes. However, recent reports point to a context-dependent outcome of IL-10 activity. In chronic infections and cancer, autocrine IL-10 activity on CD8+ T 455738066.1 22 lymphocytes has been shown to be crucial for inhibiting antigen-induced CD8+ T cell apoptosis, thereby prolonging the effector activity of these cytotoxic lymphocytes. g. Tumor Necrosis Factor-alpha (TNF-α) In some forms, the peptide adjuvant molecule(s) is or includes TNF-α. TNF-α is a pro- inflammatory cytokine produced mainly by myeloid-derived cells such as monocytes, macrophages and DCs, although many other cells such as T lymphocytes, endothelial cells, adipocytes and fibroblasts can also produce this cytokine under stressful conditions. In cancer immunotherapy, TNF-α is mainly considered as a mediator of anti-tumor immune responses, and several immunotherapies have shown depleted anti-tumor efficacy when co-administered with TNF-α antagonists. ii. Pattern Recognition Receptors In some forms, the peptide adjuvant molecule(s) is or includes a Pattern recognition receptor (PRR) PRRs are a class of receptors that play a crucial role in the innate immune system by recognizing specific patterns associated with pathogens or cellular damage. While PRRs are traditionally associated with host defense against pathogens, their role in cancer treatment has gained increasing attention due to their ability to recognize and respond to tumor-derived molecules or stressed / damaged cells. Activation of these receptors in cancer cells can lead to the production of type I interferons and pro-inflammatory cytokines, which can enhance anti-tumor immune responses. Some of the PRRs and their relevance in cancer treatment include Toll-like receptors (TLRs), NOD-like receptors (NLRs), RIG-I-like receptors (RLRs), C-type lectin receptors (CLRs), and AIM2-like receptors (ALRs). a. MDA5 In some forms, the peptide adjuvant molecule(s) is or includes MDA5. MDA5, also known as melanoma differentiation-associated protein 5, is a pattern recognition receptor (PRR) belonging to the RIG-I-like receptor (RLR) family (Dias Junior et al., Trends in Microbiology, 27:1, P75-85, 2019). These receptors are a group of cytoplasmic RNA helicases that play an important role in detecting viral RNA and initiating innate immune responses against viral infections. MDA5 specifically recognizes viral RNA molecules that contain double-stranded RNA (dsRNA) structures, which are characteristic of many viruses, including picornaviruses, flaviviruses, and coronaviruses. Activation of MDA5 triggers a signaling cascade that leads to the production of type I interferons (IFNs) and other pro-inflammatory cytokines, as well as the induction of antiviral genes that help to restrict viral replication and spread. MDA5 is widely expressed in various cell types, including immune cells such as dendritic cells, macrophages, and T cells, as well as non-immune cells such as epithelial cells and fibroblasts. 455738066.1 23 An exemplary nucleic acid sequence for MDA5: ATGTCGAATGGGTATTCCACAGACGAGAATTTCCGCTATCTCATCTCGTGCTTCAGGGCCAGGG TGAAAATGTACATCCAGGTGGAGCCTGTGCTGGACTACCTGACCTTTCTGCCTGCAGAGGTGAA GGAGCAGATTCAGAGGACAGTCGCCACCTCCGGGAACATGCAGGCAGTTGAACTGCTGCTGAGC ACCTTGGAGAAGGGAGTCTGGCACCTTGGTTGGACTCGGGAATTCGTGGAGGCCCTCCGGAGAA CCGGCAGCCCTCTGGCCGCCCGCTACATGAACCCTGAGCTCACGGACTTGCCCTCTCCATCGTT TGAGAACGCTCATGATGAATATCTCCAACTGCTGAACCTCCTTCAGCCCACTCTGGTGGACAAG CTTCTAGTTAGAGACGTCTTGGATAAGTGCATGGAGGAGGAACTGTTGACAATTGAAGACAGAA ACCGGATTGCTGCTGCAGAAAACAATGGAAATGAATCAGGTGTAAGAGAGCTACTAAAAAGGAT TGTGCAGAAAGAAAACTGGTTCTCTGCATTTCTGAATGTTCTTCGTCAAACAGGAAACAATGAA CTTGTCCAAGAGTTAACAGGCTCTGATTGCTCAGAAAGCAATGCAGAGATTGAGAATTTATCAC AAGTTGATGGTCCTCAAGTGGAAGAGCAACTTCTTTCAACCACAGTTCAGCCAAATCTGGAGAA GGAGGTCTGGGGCATGGAGAATAACTCATCAGAATCATCTTTTGCAGATTCTTCTGTAGTTTCA GAATCAGACACAAGTTTGGCAGAAGGAAGTGTCAGCTGCTTAGATGAAAGTCTTGGACATAACA GCAACATGGGCAGTGATTCAGGCACCATGGGAAGTGATTCAGATGAAGAGAATGTGGCAGCAAG AGCATCCCCGGAGCCAGAACTCCAGCTCAGGCCTTACCAAATGGAAGTTGCCCAGCCAGCCTTG GAAGGGAAGAATATCATCATCTGCCTCCCTACAGGGAGTGGAAAAACCAGAGTGGCTGTTTACA TTGCCAAGGATCACTTAGACAAGAAGAAAAAAGCATCTGAGCCTGGAAAAGTTATAGTTCTTGT CAATAAGGTACTGCTAGTTGAACAGCTCTTCCGCAAGGAGTTCCAACCATTTTTGAAGAAATGG TATCGTGTTATTGGATTAAGTGGTGATACCCAACTGAAAATATCATTTCCAGAAGTTGTCAAGT CCTGTGATATTATTATCAGTACAGCTCAAATCCTTGAAAACTCCCTCTTAAACTTGGAAAATGG AGAAGATGCTGGTGTTCAATTGTCAGACTTTTCCCTCATTATCATTGATGAATGTCATCACACC AACAAAGAAGCAGTGTATAATAACATCATGAGGCATTATTTGATGCAGAAGTTGAAAAACAATA GACTCAAGAAAGAAAACAAACCAGTGATTCCCCTTCCTCAGATACTGGGACTAACAGCTTCACC TGGTGTTGGAGGGGCCACGAAGCAAGCCAAAGCTGAAGAACACATTTTAAAACTATGTGCCAAT CTTGATGCATTTACTATTAAAACTGTTAAAGAAAACCTTGATCAACTGAAAAACCAAATACAGG AGCCATGCAAGAAGTTTGCCATTGCAGATGCAACCAGAGAAGATCCATTTAAAGAGAAACTTCT GGAAATAATGACAAGGATTCAAACTTATTGTCAAATGAGTCCAATGTCAGATTTTGGAACTCAA CCCTATGAACAATGGGCCATTCAAATGGAAAAAAAAGCTGCAAAAGAAGGAAATCGCAAAGAAC GTGTTTGTGCAGAACATTTGAGGAAGTACAATGAGGCCCTACAAATTAATGACACAATTCGAAT GATAGATGCGTATACTCATCTTGAAACTTTCTATAATGAAGAGAAAGATAAGAAGTTTGCAGTC ATAGAAGATGATAGTGATGAGGGTGGTGATGATGAGTATTGTGATGGTGATGAAGATGAGGATG ATTTAAAGAAACCTTTGAAACTGGATGAAACAGATAGATTTCTCATGACTTTATTTTTTGAAAA CAATAAAATGTTGAAAAGGCTGGCTGAAAACCCAGAATATGAAAATGAAAAGCTGACCAAATTA AGAAATACCATAATGGAGCAATATACTAGGACTGAGGAATCAGCACGAGGAATAATCTTTACAA 455738066.1 24 AAACACGACAGAGTGCATATGCGCTTTCCCAGTGGATTACTGAAAATGAAAAATTTGCTGAAGT AGGAGTCAAAGCCCACCATCTGATTGGAGCTGGACACAGCAGTGAGTTCAAACCCATGACACAG AATGAACAAAAAGAAGTCATTAGTAAATTTCGCACTGGAAAAATAAATCTGCTTATCGCTACCA CAGTGGCAGAAGAAGGTCTGGATATTAAAGAATGTAACATTGTTATCCGTTATGGTCTCGTCAC CAATGAAATAGCCATGGTCCAGGCCCGTGGTCGAGCCAGAGCTGATGAGAGCACCTACGTCCTG GTTGCTCACAGTGGTTCAGGAGTTATCGAACATGAGACAGTTAATGATTTCCGAGAGAAGATGA TGTATAAAGCTATACATTGTGTTCAAAATATGAAACCAGAGGAGTATGCTCATAAGATTTTGGA ATTACAGATGCAAAGTATAATGGAAAAGAAAATGAAAACCAAGAGAAATATTGCCAAGCATTAC AAGAATAACCCATCACTAATAACTTTCCTTTGCAAAAACTGCAGTGTGCTAGCCTGTTCTGGGG AAGATATCCATGTAATTGAGAAAATGCATCACGTCAATATGACCCCAGAATTCAAGGAACTTTA CATTGTAAGAGAAAACAAAGCACTGCAAAAGAAGTGTGCCGACTATCAAATAAATGGTGAAATC ATCTGCAAATGTGGCCAGGCTTGGGGAACAATGATGGTGCACAAAGGCTTAGATTTGCCTTGTC TCAAAATAAGGAATTTTGTAGTGGTTTTCAAAAATAATTCAACAAAGAAACAATACAAAAAGTG GGTAGAATTACCTATCACATTTCCCAATCTTGACTATTCAGAATGCTGTTTATTTAGTGATGAG GATTAG (SEQ ID NO:13). NOTE: Region in BOLD was changed from XBAI to codon optimized leucine sequence (CTA -> CTG). An exemplary amino acid sequence for MDA5: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLS TLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDK LLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNE LVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVS ESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPAL EGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKW YRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHT NKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGGATKQAKAEEHILKLCAN LDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQ PYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAV IEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKL RNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQ NEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVL VAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHY KNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDE D (SEQ ID NO:14). 455738066.1 25 iii. Chemotactic Factors In some forms, the peptide adjuvant molecule molecule(s) is or includes a Chemotactic Factor. A chemotactic factor, also known as a chemotaxin or chemoattractant, is a substance that induces the movement of cells, typically immune cells, towards a higher concentration of the substance. These factors play a crucial role in directing the migration of immune cells to sites of infection, inflammation, or tissue damage. Chemotactic factors are often small molecules, peptides, or proteins that are released by cells in response to various stimuli, such as microbial products, pro-inflammatory cytokines, or tissue injury. Once released, these factors bind to specific receptors on the surface of target cells, triggering signaling pathways that lead to cytoskeletal rearrangements and cell movement towards the source of the chemotactic factor. In the context of cancer, chemotactic factors can also contribute to the recruitment of immune cells to the tumor microenvironment. This recruitment can have both pro-tumor and anti-tumor effects, depending on the specific immune cell types involved and the local context within the tumor. a. XCL1 In some forms, the peptide adjuvant molecule(s) is or includes XCL1. XCL1 is a chemotactic factor secreted by activated NK cells, activated Th1-polarized CD4+ T cells, and activated CD8+ T cells, and co-secreted with IFN-γ, MIP-1α, MIP-1β, and RANTES and is thus part of the Th1 immune defense (Kroczek, et al., Front Immunol.2018; 9: 2806). The primary function of XCL1 is to attract and activate immune cells, directing their migration to specific sites within the body. XCL1 binds to its receptor, XCR1 (X-C motif chemokine receptor 1), which is primarily expressed on dendritic cells and a subset of activated T cells. Upon binding, XCL1 induces chemotaxis of XCR1-expressing cells towards the source of XCL1. In addition to its chemotactic properties, XCL1 has been implicated in various immune responses, including the regulation of T cell and NK cell function, dendritic cell migration and activation, and the generation of adaptive immune responses. It plays a role in the communication between different immune cell types and contributes to the coordination of immune responses against pathogens, tumors, and other threats. An exemplary nucleic acid sequence for XCL1: ATGAGACTTCTCATCCTGGCCCTCCTTGGCATCTGCTCTCTCACTGCATACATTGTGGAAGGTG TAGGGAGTGAAGTCTCAGATAAGAGGACCTGTGTGAGCCTCACTACCCAGCGACTGCCGGTTAG CAGAATCAAGACCTACACCATCACGGAAGGCTCCTTGAGAGCAGTAATTTTTATTACCAAACGT GGCCTAAAAGTCTGTGCTGATCCACAAGCCACATGGGTGAGAGACGTGGTCAGGAGCATGGACA GGAAATCCAACACCAGAAATAACATGATCCAGACCAAGCCAACAGGAACCCAGCAATCGACCAA TACAGCTGTGACTCTGACTGGCTAG (SEQ ID NO:7). 455738066.1 26 An exemplary amino acid sequence XCL1: MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKR GLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG (SEQ ID NO:8). In other forms, the encoded XCL1 molecule is a truncated variant of XCL1, for example, that lacks one or more amino acid residues of SEQ ID NO:8. For example, in some forms, the encoded XCL1 molecule is a truncated variant of XCL1 that lacks 1, 2, 3, 4, 5, 6, 7, 8, 9,10, or more than 10, such as 11, 12, 13, 14, 15, 16 up to 20 contiguous residues from the amino (NH-), or carboxyl (CO-) terminus, or both the (NH-) and carboxyl (CO-) terminus of the sequence set forth in SEQ ID NO:8. In some forms, the truncated form of XCL1 peptide has an increased function relative to the full-length sequence of SEQ ID NO:8. iv. Transcriptional Regulators In some forms, the peptide adjuvant molecule is a transcriptional regulator peptide. For many genes, basal transcription apparatus will not bind to the promoter without a transcriptional regulator peptide. Transcriptional regulator proteins recruit RNA polymerases. The transcriptional regulator proteins keep the apparatus from being degraded by enzymes. a. IRF3 In some forms, the peptide adjuvant molecule molecule(s) is or includes the transcriptional regulator peptide interferon regulator factor 3 (IRF3). IRF3 is a well- characterized signaling mediator / transcription factor that is important for innate antiviral response. Upon detection of viral RNA or other viral components, IRF-3 is activated and translocates to the nucleus, where it induces the expression of type I interferons (IFNs) and other antiviral genes. Type I IFNs, in turn, stimulate the expression of numerous genes involved in antiviral defense mechanisms. IRF-3 also exerts tumor-suppressive effects in certain contexts. IRF-3-mediated activation of type I IFN signaling can promote antitumor immune responses by enhancing the recognition and elimination of cancer cells by immune cells. IRF-3 can contribute to immune surveillance mechanisms that detect and eliminate cancerous cells. Activation of IRF- 3 in response to cellular stress or oncogenic signaling pathways can lead to the production of pro-inflammatory cytokines and chemokines that recruit immune cells to the tumor microenvironment, where they can exert antitumor effects. An exemplary nucleic acid sequence IRF3: ATGGGAACCCCAAAGCCACGGATCCTGCCCTGGCTGGTGTCGCAGCTGGACCTGGGGCAACTGG AGGGCGTGGCCTGGGTGAACAAGAGCCGCACGCGCTTCCGCATCCCTTGGAAGCACGGCCTACG GCAGGATGCACAGCAGGAGGATTTCGGAATCTTCCAGGCCTGGGCCGAGGCCACTGGTGCATAT GTTCCCGGGAGGGATAAGCCAGACCTGCCAACCTGGAAGAGGAATTTCCGCTCTGCCCTCAACC GCAAAGAAGGGTTGCGTTTAGCAGAGGACCGGAGCAAGGACCCTCACGACCCACATAAAATCTA 455738066.1 27 CGAGTTTGTGAACTCAGGAGTTGGGGACTTTTCCCAGCCAGACACCTCTCCGGACACCAATGGt ggaggcagtacttctgatacccagGAAGACATTCTGGATGAGTTACTGGGTAACATGGTGTTGG CCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGCCCCT GCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTG AAGCGGCTGTTGGTGCCGGGGGAAGAGTGGGAGTTCGAGGTGACAGCCTTCTACCGGGGCCGCC AAGTCTTCCAGCAGACCATCTCCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGGGAGA CAGGACGCTGCCTGGATGGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGA GTGATGAGCTACGTGAGGCATGTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCG GGCAGTGGCTCTGGGCCCAGCGGCTGGGGCACTGCCACACATACTGGGCAGTGAGCGAGGAGCT GCTCCCCAACAGCGGGCATGGGCCTGATGGCGAGGTCCCCAAGGACAAGGAAGGAGGCGTGTTT GACCTGGGGCCCTTCATTGTAGATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCT ATGCCCTCTGGTTCTGTGTGGGGGAGTCATGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGT GATGGTCAAGGTTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCCGGGTAGGGGGTGCC TCCTCCCTGGAGAATACTGTGGACCTGCACATTTCCAACAGCCACCCACTCTCCCTCACCTCCG ACCAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAGAG CTGA (SEQ ID NO:9). An exemplary amino acid sequence for IRF3: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAY VPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNG GGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPL KRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRG VMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVF DLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGA SSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES (SEQ ID NO:10) An exemplary nucleic acid sequence for IRF3-5D: ATGGGAACCCCAAAGCCACGGATCCTGCCCTGGCTGGTGTCGCAGCTGGACCTGGGGCAACTGG AGGGCGTGGCCTGGGTGAACAAGAGCCGCACGCGCTTCCGCATCCCTTGGAAGCACGGCCTACG GCAGGATGCACAGCAGGAGGATTTCGGAATCTTCCAGGCCTGGGCCGAGGCCACTGGTGCATAT GTTCCCGGGAGGGATAAGCCAGACCTGCCAACCTGGAAGAGGAATTTCCGCTCTGCCCTCAACC GCAAAGAAGGGTTGCGTTTAGCAGAGGACCGGAGCAAGGACCCTCACGACCCACATAAAATCTA CGAGTTTGTGAACTCAGGAGTTGGGGACTTTTCCCAGCCAGACACCTCTCCGGACACCAATGGt ggaggcagtacttctgatacccagGAAGACATTCTGGATGAGTTACTGGGTAACATGGTGTTGG CCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGCCCCT GCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTG AAGCGGCTGTTGGTGCCGGGGGAAGAGTGGGAGTTCGAGGTGACAGCCTTCTACCGGGGCCGCC 455738066.1 28 AAGTCTTCCAGCAGACCATCTCCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGGGAGA CAGGACGCTGCCTGGATGGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGA GTGATGAGCTACGTGAGGCATGTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCG GGCAGTGGCTCTGGGCCCAGCGGCTGGGGCACTGCCACACATACTGGGCAGTGAGCGAGGAGCT GCTCCCCAACAGCGGGCATGGGCCTGATGGCGAGGTCCCCAAGGACAAGGAAGGAGGCGTGTTT GACCTGGGGCCCTTCATTGTAGATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCT ATGCCCTCTGGTTCTGTGTGGGGGAGTCATGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGT GATGGTCAAGGTTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCCGGGTAGGGGGTGCC TCCTCCCTGGAGAATACTGTGGACCTGCACATTGACAACGACCACCCACTCGACCTCGACGACG ACCAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAGAG CTGA (SEQ ID NO:11). An exemplary amino acid sequence for IRF3-5D : MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAY VPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNG GGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPL KRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRG VMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVF DLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGA SSLENTVDLHIDNDHPLDLDDDQYKAYLQDLVEGMDFQGPGES (SEQ ID NO:12). v. TLR Agonists In some forms, the peptide adjuvant molecule(s) is or includes a Toll-Like Receptor Agonist (TLR). TLRs play a vital role in activating immune responses. TLRs recognize conserved pathogen-associated molecular patterns (PAMPs) expressed on a wide array of microbes, as well as endogenous DAMPs released from stressed or dying cells. The engagement of specific TLRs on cancer cells can impact tumor growth by various mechanisms, including inducing apoptosis and potentiating the effects of chemotherapy (Kaczanowska, et al., J Leukoc Biol.2013 Jun; 93(6): 847–863). By activating TLRs, agonists can enhance innate and adaptive immune responses, leading to improved immune surveillance and the elimination of infected or cancerous cells. Additionally, TLR agonists can be used as adjuvants in vaccines to enhance their efficacy by promoting the activation of antigen-presenting cells and the induction of robust immune responses. vi. Other Immunomodulatory Peptides The compositions of synthetic messenger ribonucleic acid (mRNA) include one or more ribonucleic acid sequences encoding one or more other immunomodulatory peptides. 455738066.1 29 In some forms, the exogenous nucleic acid sequence encodes a peptide having an immunomodulatory function in vivo. In exemplary forms, the compositions of mRNAs include two or more immunomodulatory or co-signaling agents, such as signaling pairs. In some forms, the described compositions include two or more mRNA sequences encoding two peptide molecules that act as ligand-binding pairs. The ligand-binding pairs can be immuno-receptors and ligands thereof, or they can be receptors and co-receptors. In some forms, when the mRNAs encode cell-surface bound molecules, the mRNAs can encode an entire mature protein, for example, an intracellular component, trans-membrane component and an extracellular component of a given protein or receptor. In other forms, the mRNAs encode only a part of the mature protein, such as only the transmembrane and / or extracellular or intracellular component or only the extracellular component. Multiple peptides function as immunomodulating agents, by either blocking the immune response or stimulating the immune response to generate tolerance. Knowledge of B- or T-cell epitopes along with conformational constraints is important in the design of peptide-based immunomodulating agents. In some forms, immunomodulating agents are biological agents targeting TNF-α; IL-1; and / or co-stimulation blockers. In some forms, modulation or blocking of adhesion and costimulatory molecules reduces the inflammatory cell accumulation and modifies the process of inflammation. Co-stimulatory molecules and / or cell adhesion molecules play a pivotal role in the recruitment of T cells to inflammatory sites. Molecular pairs such as ICAM-1- LFA-1, CD2-LFA3 (CD58) and CD28 / CD152-CD80 / CD86 bring the T cell and the APC into contact and help in the immunological synapse, which results in signaling for inflammatory cytokines. Therefore, in some forms, one or more immune-modulatory agent(s) is all or part of ICAM-1, LFA-1, CD2, LFA3(CD58), CD28, CD152-CD80 or CD86, which reduces the inflammatory cell accumulation and modifies the process of inflammation. In some forms, one immune-modulatory agent is a non-adjuvant immune-stimulatory agent. For example, in some forms, one agent is all or part of a major histocompatibility complex (MHC) molecule, such as a class I MHC or a class II MHC. An exemplary pair or group of antigen and immuno-stimulatory agents can include, for example, an mRNA encoding all or part of an MHC peptide, and an mRNA encoding a cognate MHC antigenic peptide, for example, that binds to within the cognate binding groove of the MHC. In other forms, one immune-modulatory agent is all or part of a cognate antigen of an MHC molecule, such as a 7-12 amino acid polypeptide that can be recognized and bound to a class I major histocompatibility complex (MHCI) molecule, or a larger polypeptide that can be recognized by class II major histocompatibility complex (MHCII) molecule. In some forms, one immune-modulatory agent is 455738066.1 30 a peptide that inhibits or otherwise moderates the interaction between one immune receptor and another, such as a costimulatory molecule or cell adhesion molecule pair. For example, in some forms, one immune-modulatory agent is a peptide that inhibits or blocks the CD80-CD28 / CD152 interaction. For example, in some forms, the immune- modulatory agent is a polyproline peptide that inhibits or blocks the CD80-CD28 / CD152 interaction. In some forms, one immune-modulatory agent is a peptide that inhibits or blocks the ICAM-1-LFA-1 interaction. In some forms, one immune-modulatory agent is a peptide that inhibits or blocks the CD2-LFA3 (CD58) interaction. In some forms, one immune-modulatory agent is a peptide that inhibits or blocks the CD28 / CD152-CD80 / CD86 interaction. In some forms, one immune- modulatory agent is a peptide that inhibits or blocks the CD80-CD28 / CD152 interaction. In some forms, the ligand-binding pairs include CD40 and CD40L for DC activation and antibody production. In some forms, the ligand-binding pairs include Flt3L-Flt3 for DC activation. In some forms, the ligand-binding pairs include OX40-OX40L. In some forms, one immune-modulatory agent is a peptide GITR. In some forms, one immune-modulatory agent is a peptide CD137. In some forms, one immune-modulatory agent is a peptide Fc- receptor version or nano body blocker of all of the inhibitory signals (PD1, TIGIT, TIM3, LAG3, etc.). In some forms, one immune-modulatory agent is a Nano body agonist. a. Targeting Agents In some forms, an immune-modulatory agent peptide is or includes a peptide that targets and / or selectively binds to a desired target cell or receptor, for example, to initiate an immune response. Exemplary targeting agents include MHC molecules that target and bind to T cell receptors (TCRs) at the surface of T cells to initiate antigen-specific immune responses, and other molecules that enhance and / or initiate immune responses in vivo. (i) CLec9 Targeting Molecules In some forms, the peptide adjuvant molecule(s) is or includes a peptide that targets and / or selectively binds to CLec9A. CLec9A is a group V C-type lectin-like receptor located in the “Dectin-1 cluster” of related receptors, which are encoded within the natural killer (NK)-gene complex. CLEC9A Is a Novel Activation C-type Lectin-like Receptor Expressed on BDCA3+ Dendritic Cells and a Subset of Monocytes. In some forms, a CLec9A binding agent is a peptide having at least one targeting moiety that specifically binds Clec9A. In various forms, these Clec9A binding agents bind to, but do not functionally modulate (e.g. partially or fully neutralize) Clec9A. Therefore, in various embodiments, the present Clec9A binding agents have use in, for instance, directly or indirectly recruiting a Clec9A-expressing cell to a site of interest while still allowing the 455738066.1 31 Clec9A-expressing cell to signal via Clec9A (e.g., the binding of the Clec9A binding agent does not reduce or eliminate Clec9A signaling at the site of interest). These ligands can be used to target therapeutic agents or detectable labels to Clec9A expressing cells, such as dendritic cells. Exemplary Clec9A binding agents are described in WO / 2017 / 134305, the contents of which are incorporated herein in their entirety. 2. Antigens The compositions of synthetic messenger ribonucleic acid (mRNA) include one or more ribonucleic acid sequences encoding one or more peptide antigens. In some forms, the exogenous nucleic acid sequence encodes a vaccine antigen. An antigen can include any protein or peptide that is foreign to the subject organism. Preferred antigens can be presented at the surface of antigen presenting cells (APC) of a subject for surveillance by immune effector cells, such as leucocytes expressing the CD4 receptor (CD4 T cells) and Natural Killer (NK) cells. Typically, the antigen is of viral, bacterial, protozoan, fungal, or animal origin. In some forms, the antigen is a cancer antigen. Cancer antigens can be antigens expressed only on tumor cells and / or required for tumor cell survival. Certain antigens are recognized by those skilled in the art as immuno-stimulatory (i.e., stimulate effective immune recognition) and provide effective immunity to the organism or molecule from which they derive. B cell antigens can be peptides, proteins, polysaccharides, saccharides, lipids, nucleic acids, small molecules (alone or with a hapten) or combinations thereof. T cell antigens are proteins or peptides. The antigen can be derived from a virus, bacterium, parasite, plant, protozoan, fungus, tissue or transformed cell such as a cancer or leukemic cell and can be a whole cell or immunogenic component thereof, e.g., cell wall components or molecular components thereof. Suitable antigens are known in the art and are available from commercial government and scientific sources. The antigens may be purified or partially purified polypeptides derived from tumors or viral or bacterial sources. The antigens can be recombinant polypeptides produced by expressing DNA encoding the polypeptide antigen in a heterologous expression system. All or part of an antigenic protein can be encoded by a DNA or RNA molecule for delivery. Antigens may be provided as single antigens or may be provided in combination. Antigens may also be provided as complex mixtures of polypeptides or nucleic acids. i. Tumor Antigens In some forms, the antigen(s) is or includes a tumor antigen. There are many classes of tumor antigens, including, but not limited to, oncogene expression products, alternatively spliced expression products, mutated gene products, over-expressed gene products, aberrantly expressed 455738066.1 32 gene products, antigens produced by an oncogenic viruses, oncofetal antigens, as well as proteins with altered cell surface glycolipids, and proteins having altered glycosylation profiles. Exemplary tumor antigens included or encoded by Compositions including one or more mRNA antigens and one or more mRNA adjuvants include tumor-associated or tumor-specific antigens, such as, but not limited to, alpha-actinin-4, Alphafetoprotein (AFP), Bcr-Abl fusion protein, Carcinoembryonic antigen (CEA), CA-125, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, epithelial tumor antigen, EF2, ETV6-AML1 fusion protein, LDLR-fucosyl transferase AS fusion protein, HLA-A2, HLA-A11, hsp70-2, KIAAO205, Mart2, Mum-1, 2, and 3, neo-PAP, myosin class I, OS-9, pml-RARa fusion protein, PTPRK, K-ras, N- ras, Triosephosphate isomerase, Bage-1, Gage 3,4,5,6,7, GnTV, Herv-K-mel, Lage-1, Melanoma-associated antigen (MAGE);Mage-A1,2,3,4,6,10,12, Mage-C2, NA-88, NY-Eso- 1 / Lage-2, SP17, SSX-2, and TRP2-Int2, MelanA (MART-I), gp100 (Pmel 17), tyrosinase, TRP- 1, TRP-2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, p15(58), CEA, RAGE, NY-ESO (LAGE), SCP-1, Hom / Mel-40, PRAME, p53, H-Ras, HER-2 / neu, BCR-ABL, E2A-PRL, H4- RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus (HPV) antigens E6 and E7, TSP-180, MAGE-4, MAGE-5, MAGE-6, p185erbB2, p180erbB-3, c-met, nm-23H1, PSA, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, b-Catenin, CDK4, Mum-1, p16, TAGE, PSMA, PSCA, CT7, telomerase, 43-9F, 5T4, 791Tgp72, a-fetoprotein, 13HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, G250, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7-Ag, MOV18, MUC-1, NB\70K, NY-CO-1, RCAS1, SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated protein), TAAL6, TAG72, TLP, tyrosinase, and TPS. An exemplary tumor antigen is the model melanoma tumor antigen Trp1. In certain forms, the tumor antigen is the gene product of a gene that is normally expressed during embryogenesis, and whose expression in normal adult tissues is limited, such as an “oncofetal” protein, or an alternatively-spliced variant of a normal protein. Oncofetal antigens are proteins which are typically present only during fetal development but are found in adults with certain kinds of cancer. These proteins are often measurable in the blood of individuals with cancer and may be used to both diagnose and follow treatment of the tumors. Therefore, in some forms, the compositions including one or more mRNA antigens and one or more mRNA adjuvants include or encode one or more oncofetal proteins. An exemplary oncofetal protein is the Hmga2 protein. In certain forms, the tumor antigen is the gene product of a gene that is normally expressed or not expressed by cells, but whose sequence has been altered by mutation, genetic recombination, altered splicing or another process leading to a distinct protein coding sequence 455738066.1 33 or post-translational modification of a coding sequence and a consequently distinct peptide- MHC complex presented on the surface of a tumor compared with non-tumor cells of the same tissue of origin, here termed a ‘neoantigen’. In some forms, a neoantigen is specific to a subject. ii. Viral Antigens In some forms, the antigen(s) is or includes a viral antigen. A viral antigen can be isolated from any virus including, but not limited to, a virus from any of the following viral families: Arenaviridae, Arterivirus, Astroviridae, Baculoviridae, Badnavirus, Barnaviridae, Birnaviridae, Bromoviridae, Bunyaviridae, Caliciviridae, Capillovirus, Carlavirus, Caulimovirus, Circoviridae, Closterovirus, Comoviridae, Coronaviridae (e.g., Coronavirus, such as severe acute respiratory syndrome (SARS) virus such as SARS-CoV-1 and SARS-CoV- 2), Corticoviridae, Cystoviridae, Deltavirus, Dianthovirus, Enamovirus, Filoviridae (e.g., Marburg virus and Ebola virus (EBOV) (e.g., Zaire, Reston, Ivory Coast, or Sudan strain)), Flaviviridae, (e.g., Hepatitis C virus, Dengue virus 1, Dengue virus 2, Dengue virus 3, and Dengue virus 4), Hepadnaviridae, Herpesviridae (e.g., Human herpesvirus 1, 3, 4, 5, and 6, and Cytomegalovirus), Hypoviridae, Iridoviridae, Leviviridae, Lipothrixviridae, Microviridae, Orthomyxoviridae (e.g., Influenza virus A, such as H1N1 strain, and B and C), Papovaviridae, Paramyxoviridae (e.g., measles, mumps, and human respiratory syncytial virus), Parvoviridae, Picornaviridae (e.g., poliovirus, rhinovirus, hepatovirus, and aphthovirus), Poxviridae (e.g., vaccinia and smallpox virus), Reoviridae (e.g., rotavirus), Retroviridae (e.g., lentivirus, such as human immunodeficiency virus (HIV) 1 and HIV 2), Rhabdoviridae (for example, rabies virus, measles virus, respiratory syncytial virus, etc.), Togaviridae (for example, rubella virus, dengue virus, etc.), and Totiviridae. Suitable viral antigens also include all or part of Dengue protein M, Dengue protein E, Dengue D1NS1, Dengue D1NS2, and Dengue D1NS3. Viral antigens may be derived from a particular strain such as a papilloma virus, a herpes virus, i.e. herpes simplex 1 and 2; a hepatitis virus, for example, hepatitis A virus (HAV), hepatitis B virus (HBV), hepatitis C virus (HCV), the delta hepatitis D virus (HDV), hepatitis E virus (HEV) and hepatitis G virus (HGV), the tick-borne encephalitis viruses; parainfluenza, varicella-zoster, cytomeglavirus, Epstein-Barr, rotavirus, rhinovirus, adenovirus, coxsackieviruses, equine encephalitis, Japanese encephalitis, yellow fever, Rift Valley fever, and lymphocytic choriomeningitis. In some forms, the viral antigen is derived from one or more viruses from the Orthomyxovirus family, for example, the Influenza virus A, Influenza virus B, Influenza virus C, Isavirus, Thogotovirus and Quaranjavirus. Exemplary influenza A virus subtypes include H1N1, H1N2, H3N2, H3N1, H5N1, H2N2, and H7N7. Exemplary influenza virus antigens include one or more proteins or glycoproteins such as hemagglutinin, such as HA1 and HA2 subunits, neurominidase, viral RNA polymerase, such as one or more of PB1, PB2 PA and PB1-F2, 455738066.1 34 reverse transcriptase, capsid protein, non-structured proteins, such as NS1 and NEP, nucleoprotein, matrix proteins, such as M1 and M2 and pore proteins. In some forms, Influenza A virus antigens include one or more of the Hemagglutinin (HA) or Neuraminidase (NA) glycoproteins or fragments of the HA or NA, including the antigenic sites of the Hemagglutinin HA1 glycoprotein. In an exemplary form, Compositions including one or more mRNA antigens and one or more mRNA adjuvants include RNA encoding the influenza A / WSN / 33 HA protein. In some forms, the viral antigen in derived from one or more viruses from the genus Ebolavirus, for example, the Zaire ebolavirus (EBOV), Sudan ebolavirus (SUDV), Taï Forest ebolavirus (TAFV), Reston ebolavirus (RESTV), and Bundibugyo ebolavirus (BDBV). In an exemplary form, Compositions including one or more mRNA antigens and one or more mRNA adjuvants include RNA, such as repRNA, encoding the Zaire ebolavirus glycoprotein (GP), or one or more fragments of the Zaire ebolavirus glycoprotein (GP). In some forms, the viral antigen in derived from one or more viruses from the genus Flavivirus, for example, the Zika virus (ZIKV). In a particular embodiment, the antigen is an MCPyV antigen. Such antigens are vaccines formed therefrom are disclosed in PCT / US2023 / 084086, which is specifically incorporated by references herein in its entirety. MCPyV is a non-enveloped, double-stranded DNA virus that is a part of the normal microbiome for a majority of individuals in endemic areas (Kervarrec T, et al., Front Oncol. 2019 Jun 10;9:451). Recent investigation has shown that a coding region for a truncated form of the viral Large T Antigen (LTA) and its isoform the Small T Antigen (STA) are integrated into the genome of MCPyV associated MCC and causes malignant transformation through mechanisms including an interaction between LTA and the Retinoblastoma Protein (RB1). Furthermore, expression of the T antigens in MCPyV associated MCC is required to maintain proliferation of the cancer (Hesbacher S et al., Oncotarget.2016 May 31;7(22):32956-68). In preferred embodiments, the viral antigen is viral LTA derived from MCPyV. In preferred embodiments, the viral antigen derived from LTA of MCPyV includes the amino acid sequence of SEQ ID NO:21, MDLVLNRKEREALCKLLEIAPNCYGNIPLMKAAFKRSCLKHHPDKGGNPVIMMELNTLWSKFQQ NIHKLRSDFSMFDEVDEAPIYGTTKFKEWWRSGGFSFGKAYEYGPNPHGTNSRSRKPSSNASRG APSGSSPPHSQSSSSGYGSFSASQASDSQSRGPDIPPEHHEEPTSSSGSSSREETTNSGRESST PNGTSVPRNSSRTDGTWEDLFCDESLSSPEPPSSSEEPEEPPSSRSSPRQPPSSSAEEASSSQF TD (SEQ ID NO:21), or a fragment or variant thereof with e.g., at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, or 95% sequence identity thereto. 455738066.1 35 In some embodiments, the viral antigen is STA derived from MCPyV, or an antigenic fragment thereof. In preferred embodiments, the viral antigen derived from STA of MCPyV includes the amino acid sequence of SEQ ID NO:22: MDLVLNRKEREALCKLLEIAPNCYGNIPLMKAAFKRSCLKHHPDKGGNPVIMMELNTLWSKFQQ NIHKLRSDFSMFDEVSTKFPWEEYGTLKDYMQSGYNARFCRGPGCMLKQLRDSKCACISCKLSR QHCSLKTLKQKNCLTWGECFCYQCFILWFGFPPTWESFDWWQKTLEETDYCLLHLHLF (SEQ ID NO:22), or a fragment or variant thereof with e.g., at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, or 95% sequence identity thereto. iii. Endogenous Retroelement Antigens In some forms, the antigen(s) is or includes an endogenous retroelement antigen. Endogenous retroelement-derived nucleic acids activate innate immune pathways and contribute to pathologies such as systemic lupus erythematosus and Aicardi–Goutières syndrome. It also enhances responses to poorly immunogenic antigens, such as T cell-independent type 2 antigens or tumors. Endogenous retroelement antigens can originate from any endogenous retroelement that is native to the human genome including, but not limited to, Endogenous Retrovirsues (ERVs), Long Interspersed Nuclear Elements (LINEs), and Short Interspersed Nuclear Elements (SINEs). In Renal cell carcinoma, for example, significant data links the expression of particular ERV elements with immunotherapy response, leading to the hypothesis that presentation of translated ERV epitopes may be responsible for this response (Braun et al., Nature Medicine, 2020, Cherkasova et al., Cancer Research, 2017). Exemplary ERV genes include ERV-W1 env (Syncytin-1), HERV-E (also known as ERVE-4), ERV-Fc1 env, ERV-K env and ERV-K pol. Exemplary endogenous retroelement antigens are described in Braun, et al., Nat Med.2020 Jun; 26(6): pp909–918, the contents of which are incorporated herein in their entirety. iv. Bacterial Antigens In some forms, the antigen(s) is or includes a bacterial antigen. Bacterial antigens can originate from any bacteria including, but not limited to, Actinomyces, Anabaena, Bacillus, Bacteroides, Bdellovibrio, Bordetella, Borrelia, Campylobacter, Caulobacter, Chlamydia, Chlorobium, Chromatium, Clostridium, Corynebacterium, Cytophaga, Deinococcus, Escherichia, Francisella, Halobacterium, Heliobacter, Haemophilus, Hemophilus influenza type B (HIB), Hyphomicrobium, Legionella, Leptspirosis, Listeria, Meningococcus A, B and C, Methanobacterium, Micrococcus, Myobacterium, Mycoplasma, Myxococcus, Neisseria, Nitrobacter, Oscillatoria, Prochloron, Proteus, Pseudomonas, Phodospirillum, Rickettsia, Salmonella, Shigella, Spirillum, Spirochaeta, Staphylococcus, Streptococcus, Streptomyces, Sulfolobus, Thermoplasma, Thiobacillus, and Treponema, Vibrio, and Yersinia. 455738066.1 36 v. Parasite Antigens In some forms, the antigen(s) is or includes a parasite antigen. Exemplary parasite allergens, include but are not limited to, Cryptococcus neoformans, Histoplasma capsulatum, Candida albicans, Candida tropicalis, Nocardia asteroides, Rickettsia ricketsii, Rickettsia typhi, Mycoplasma pneumoniae, Chlamydial psittaci, Chlamydial trachomatis, Plasmodium falciparum, Trypanosoma brucei, Entamoeba histolytica, Toxoplasma gondii, Trichomonas vaginalis and Schistosoma mansoni. These include Sporozoan antigens, Plasmodian antigens, such as all or part of a Circumsporozoite protein, a Sporozoite surface protein, a liver stage antigen, an apical membrane associated protein, or a Merozoite surface protein. In some forms, the parasite antigen is one or more antigens from a protozoan, such as one or more protozoans from the genus Toxoplasma, for example T. gondii and species from a related genus, such as Neospora, Hammondia, Frenkelia, Isospora and Sarcocystis. Exemplary antigens derived from T. gondii include the GRA6, ROP2A, ROP18, SAG1, SAG2A and AMA1 gene products. vi. Tolerogenic Antigens In some forms, the antigen(s) is or includes a tolerogenic antigen. Exemplary tolerogenic antigens are known in the art. See, for example, U.S. Published Application No.2014 / 0356384. In some cases, the tolerogenic antigen is derived from a therapeutic agent protein to which tolerance is desired. Examples are protein drugs in their wild type, e.g., human factor VIII or factor IX, to which patients did not establish central tolerance because they were deficient in those proteins; or nonhuman protein drugs, used in a human. Other examples are protein drugs that are glycosylated in nonhuman forms due to production, or engineered protein drugs, e.g., having non-native sequences that can provoke an unwanted immune response. Examples of tolerogenic antigens that are engineered therapeutic proteins not naturally found in humans including human proteins with engineered mutations, e.g., mutations to improve pharmacological characteristics. Examples of tolerogenic antigens that have nonhuman glycosylation include proteins produced in yeast or insect cells. Tolerogenic antigens can be from proteins that are administered to humans that are deficient in the protein. Deficient means that the patient receiving the protein does not naturally produce enough of the protein. Moreover, the proteins may be proteins for which a patient is genetically deficient. Such proteins include, for example, antithrombin-III, protein C, factor VIII, factor IX, growth hormone, somatotropin, insulin, pramlintide acetate, mecasermin (IGF-1), β- gluco cerebrosidase, alglucosidase-alpha, laronidase (α-L-iduronidase), idursuphase (iduronate- 2-sulphatase), galsulphase, agalsidase-beta (α-galactosidase), α-1 proteinase inhibitor, and albumin. 455738066.1 37 The tolerogenic antigen can be from therapeutic antibodies and antibody-like molecules, including antibody fragments and fusion proteins with antibodies and antibody fragments. These include nonhuman (such as mouse) antibodies, chimeric antibodies, and humanized antibodies. Immune responses to even humanized antibodies have been observed in humans (Getts et al., (2010), mAbs, 2(6):682-694). The tolerogenic antigen can be from proteins that are nonhuman. Examples of such proteins include adenosine deaminase, pancreatic lipase, pancreatic amylase, lactase, botulinum toxin type A, botulinum toxin type B, collagenase, hyaluronidase, papain, L-Asparaginase, rasburicase, lepirudin, streptokinase, anistreplase (anisoylated plasminogen streptokinase activator complex), antithymocyte globulin, crotalidae polyvalent immune Fab, digoxin immune serum Fab, L-arginase, and L-methionase. Tolerogenic antigens include those from human allograft transplantation antigens. Examples of these antigens are the subunits of the various MHC class I and MHC class II haplotype proteins, and single-amino-acid polymorphisms on minor blood group antigens including RhCE, Kell, Kidd, Duffy and Ss. The tolerogenic antigen can be a self-antigen against which a patient has developed an autoimmune response or may develop an autoimmune response. Examples are proinsulin (diabetes), collagens (rheumatoid arthritis), myelin basic protein (multiple sclerosis). For instance, Type 1 diabetes mellitus (T1D) is an autoimmune disease whereby T cells that recognize islet proteins have broken free of immune regulation and signal the immune system to destroy pancreatic tissue. Numerous protein antigens that are targets of such diabetogenic T cells have been discovered, including insulin, GAD65, chromogranin-A, among others. In the treatment or prevention of T1D, it would be useful to induce antigen-specific immune tolerance towards defined diabetogenic antigens to functionally inactivate or delete the diabetogenic T cell clones. Tolerance and / or delay of onset or progression of autoimmune diseases may be achieved for various of the many proteins that are human autoimmune proteins, a term referring to various autoimmune diseases wherein the protein or proteins causing the disease are known or can be established by routine testing. In some embodiments, a patient is tested to identify an autoimmune protein and an antigen is created for use in a molecular fusion to create immunotolerance to the protein. Embodiments can include an antigen, or choosing an antigen from or derived from, one or more of the following proteins. In type 1 diabetes mellitus, several primary antigens have been identified: insulin, proinsulin, preproinsulin, glutamic acid decarboxylase-65 (GAD-65), GAD-67, insulinoma-associated protein 2 (IA-2), and insulinoma-associated protein 2 beta (IA- 455738066.1 38 213); other antigens include ICA69, ICA12 (SOX-13), carboxypeptidase H, Imogen 38, GLIMA 38, chromogranin-A, FISP-60, carboxypeptidase E, peripherin, glucose transporter 2, hepatocarcinoma-intestine-pancreas / pancreatic associated protein, S100β, glial fibrillary acidic protein, regenerating gene II, pancreatic duodenal homeobox 1, dystrophia myotonica kinase, islet-specific glucose-6-phosphatase catalytic subunit-related protein, and SST G-protein coupled receptors 1-5. In autoimmune diseases of the thyroid, including Hashimoto's thyroiditis and Graves' disease, primary antigens include thyroglobulin (TG), thyroid peroxidase (TPO) and thyrotropin receptor (TSHR); other antigens include sodium iodine symporter (NIS) and megalin. In thyroid-associated ophthalmopathy and dermopathy, in addition to thyroid autoantigens including TSHR, an antigen is insulin-like growth factor 1 receptor. In hypoparathyroidism, a primary antigen is calcium sensitive receptor. In Addison's disease, primary antigens include 21-hydroxylase, 17α-hydroxylase, and P450 side chain cleavage enzyme (P450scc); other antigens include ACTH receptor, P450c21 and P450c17. In premature ovarian failure, primary antigens include FSH receptor and alpha-enolase. In autoimmune hypophysitis, or pituitary autoimmune disease, primary antigens include pituitary gland-specific protein factor (PGSF) 1a and 2; another antigen is type 2 iodothyronine deiodinase. In multiple sclerosis, primary antigens include myelin basic protein, myelin oligodendrocyte glycoprotein and proteolipid protein. In rheumatoid arthritis, a primary antigen is collagen II. In immunogastritis, a primary antigen is H+, K+-ATPase. In pernicious angemis, a primary antigen is intrinsic factor. In celiac disease, primary antigens are tissue transglutaminase and gliadin. In vitiligo, a primary antigen is tyrosinase, and tyrosinase related protein 1 and 2. In myasthenia gravis, a primary antigen is acetylcholine receptor. In pemphigus vulgaris and variants, primary antigens are desmoglein 3, 1 and 4; other antigens include pemphaxin, desmocollins, plakoglobin, perplakin, desmoplakins, and acetylcholine receptor. In bullous pemphigoid, primary antigens include BP180 and BP230; other antigens include plectin and laminin 5. In dermatitis herpetiformis Duhring, primary antigens include endomysium and tissue transglutaminase. In epidermolysis bullosa acquisita, a primary antigen is collagen VII. In systemic sclerosis, primary antigens include matrix metalloproteinase 1 and 3, the collagen- specific molecular chaperone heat-shock protein 47, fibrillin-1, and PDGF receptor; other antigens include Scl-70, U1 RNP, Th / To, Ku, Jo1, NAG-2, centromere proteins, topoisomerase I, nucleolar proteins, RNA polymerase I, II and III, PM-Slc, fibrillarin, and B23. In mixed connective tissue disease, a primary antigen is U1snRNP. In Sjogren's syndrome, the primary antigens are nuclear antigens SS-A and SS-B; other antigens include fodrin, poly(ADP-ribose) polymerase and topoisomerase. In systemic lupus erythematosus, primary antigens include nuclear proteins including SS-A, high mobility group box 1 (HMGB1), nucleosomes, histone 455738066.1 39 proteins and double-stranded DNA. In Goodpasture's syndrome, primary antigens include glomerular basement membrane proteins including collagen IV. In rheumatic heart disease, a primary antigen is cardiac myosin. Other autoantigens revealed in autoimmune polyglandular syndrome type 1 include aromatic L-amino acid decarboxylase, histidine decarboxylase, cysteine sulfonic acid decarboxylase, tryptophan hydroxylase, tyrosine hydroxylase, phenylalanine hydroxylase, hepatic P450 cytochromes P4501A2 and 2A6, SOX-9, SOX-10, calcium-sensing receptor protein, and the type 1 interferons interferon alpha, beta and omega. In some cases, the tolerogenic antigen is a foreign antigen against which a patient has developed an unwanted immune response. Examples are food antigens. Some embodiments include testing a patient to identify foreign antigen and creating a molecular fusion that comprises the antigen and treating the patient to develop immunotolerance to the antigen or food. Examples of such foods and / or antigens are provided. Examples are from peanut: conarachin (Ara h 1), allergen II (Ara h 2), arachis agglutinin, conglutin (Ara h 6); from apple: 31 kda major allergen / disease resistance protein homolog (Mal d 2), lipid transfer protein precursor (Mal d 3), major allergen Mal d 1.03D (Mal d 1); from milk: .alpha.-lactalbumin (ALA), lactotransferrin; from kiwi: actinidin (Act c 1, Act d 1), phytocystatin, thaumatin-like protein (Act d 2), kiwellin (Act d 5); from mustard: 2S albumin (Sin a 1), 11 S globulin (Sin a 2), lipid transfer protein (Sin a 3), profilin (Sin a 4); from celery: profilin (Api g 4), high molecular weight glycoprotein (Api g 5); from shrimp: Pen a 1 allergen (Pen a 1), allergen Pen m 2 (Pen in 2), tropomyosin fast isoform; from wheat and / or other cereals: high molecular weight glutenin, low molecular weight glutenin, alpha- and gamma-gliadin, hordein, secalin, avenin; from strawberry: major strawberry allergy Fra a 1-E (Fra a 1), from banana: profilin (Mus xp 1). Many protein drugs that are used in human and veterinary medicine induce immune responses, which create risks for the patient and limits the efficacy of the drug. This can occur with human proteins that have been engineered, with human proteins used in patients with congenital deficiencies in production of that protein, and with nonhuman proteins. It would be advantageous to tolerize a recipient to these protein drugs prior to initial administration, and it would be advantageous to tolerize a recipient to these protein drugs after initial administration and development of immune response. In patients with autoimmunity, the self-antigen(s) to which autoimmunity is developed are known. In these cases, it would be advantageous to tolerize subjects at risk prior to development of autoimmunity, and it would be advantageous to tolerize subjects at the time of or after development of biomolecular indicators of incipient autoimmunity. For example, in Type 1 diabetes mellitus, immunological indicators of autoimmunity are present before broad destruction of beta cells in the pancreas and onset of 455738066.1 40 clinical disease involved in glucose homeostasis. It would be advantageous to tolerize a subject after detection of these immunological indicators prior to onset of clinical disease. In some forms, the antigen is an allergen or environmental antigen. Exemplary allergens and environmental antigens, include but are not limited to, an antigen derived from naturally occurring allergens such as pollen allergens (tree-, herb, weed-, and grass pollen allergens), insect allergens (inhalant, saliva and venom allergens), animal hair and dandruff allergens, and food allergens. Important pollen allergens from trees, grasses and herbs originate from the taxonomic orders of Fagales, Oleales, Pinales and platanaceae including i.a. birch (Betula), alder (Alnus), hazel (Corylus), hornbeam (Carpinus) and olive (Olea), cedar (Cryptomeriaand Juniperus), Plane tree (Platanus), the order of Poales including, e.g., grasses of the genera Lolium, Phleum, Poa, Cynodon, Dactylis, Holcus, Phalaris, Secale, and Sorghum, the orders of Asterales and Urticales including e.g., herbs of the genera Ambrosia, Artemisia, and Parietaria. Other allergen antigens that may be used include allergens from house dust mites of the genus Dermatophagoides and Euroglyphus, storage mite, e.g., Lepidoglyphys, Glycyphagus and Tyrophagus, those from cockroaches, midges and fleas, e.g., Blatella, Periplaneta, Chironomus and Ctenocepphalides, those from mammals such as cat, dog and horse, birds, venom allergens including such originating from stinging or biting insects such as those from the taxonomic order of Hymenoptera including bees (superfamily Apidae), wasps (superfamily Vespidea), and ants (superfamily Formicoidae). Still other allergen antigens that may be used include inhalation allergens from fungi such as from the genera Alternaria and Cladosporium. Exemplary food allergens include cow's milk (e.g., lactose), eggs, nuts, shellfish, fish, and legumes (peanuts and soybeans), fruits and vegetables such as tomatoes. When the antigen is an allergen, the compositions including one or more mRNA antigens and one or more mRNA adjuvants can include one or more immune-modulatory molecules, or one or more nucleic acids encoding immune-modulatory molecules to direct the immune response specifically toward a Th1 (cellular) or Th2 (humoral) polarization for the delivered allergen. 3. Targeting Molecules In some forms, the described compositions include or encode one or more molecules that function to direct, target or otherwise improve recognition and uptake of the encoded antigens by immune cells, such as antigen presenting cells (APCs). In some forms, the compositions of synthetic messenger ribonucleic acid (mRNA) include one or more ribonucleic acid sequences encoding one or more amino acid sequences that are linked to sequence(s) encoding antigen(s), and which target the linked antigen(s) to APCs, such as dendritic cells (DCs), and / or improve the uptake and / or presentation of linked antigen(s) by an APC. The targeting polypeptide can be 455738066.1 41 coupled directly or indirectly to an encoded antigen peptide. The targeting polypeptide can be bound to either the “amino” (-NH) terminus, or the “carboxyl” (-COOH) terminus of the antigen polypeptide. In some forms, the targeting polypeptide is coupled to the antigen polypeptide via a linker, such as a flexible linker. i. Clec9a-targeting approaches In some forms, the compositions encode antigens linked to Clec9A-targeting sequences. Clec9a, also known as DNGR-1, is a C-type lectin receptor expressed on mouse CD8α+ DCs and plasmacytoid DCs (pDCs) and is also selectively expressed on human BDCA3+ DCs. Clec9a specifically recognizes actin filaments (F-actin) exposed on necrotic cells, leading to the subsequent routing of necrotic cells into the cross-priming pathway. In some forms, the described compositions including an mRNA encoding antigen also include an mRNA encoding a Clec9a-binding peptide. Typically, the Clec9a-binding peptide is linked to the antigen. In some forms, the compositions include a single mRNA encoding antigen and a Clec9a-binding peptide, such that the antigen peptide is expressed as a polypeptide that also encodes a Clec9a-binding domain. In some forms, the compositions include one or more mRNA(s) encoding one or more antigen(s) and a Clec9a-binding peptide, and one or more adjuvants and / or immuno-modulatory molecules. In some forms, the one or more antigen peptide is expressed as a polypeptide that also encodes a Clec9a-binding domain. An exemplary polypeptide that selectively binds to Clec9a includes the amino acid sequence: WPRFHSSVRHTH (SEQ ID NO:23). An exemplary nucleic acid sequence for a polypeptide that selectively binds to Clec9a includes the sequence:tggccgcgctttcatagcagcgtgcgccatacccat (SEQ ID NO:24). B. Synthetic Nanoparticles In some forms, the compositions of synthetic messenger ribonucleic acid (mRNA) including one or more ribonucleic acid sequences encoding one or more peptide antigens and one or more ribonucleic acid sequences encoding one or more peptide adjuvants include therapeutic, prophylactic and diagnostic agents enclosed or encapsulated within non-toxic, non- immunogenic, biodegradable nanoparticles and have a size amenable for uptake by eukaryotic cells in vivo for the efficient delivery of the therapeutic, prophylactic and diagnostic agents to the intracellular space. The delivery vehicles can protect therapeutic, prophylactic and diagnostic agents from immune surveillance and degradation in the body and enhance the serum half-life of the encapsulated active-agents. The delivery vehicles can optionally include one or more targeting motifs to enhance specificity and uptake by target cells. 455738066.1 42 1. Lipid Nanoparticles In some forms, the compositions of synthetic messenger ribonucleic acid (mRNA) including one or more ribonucleic acid sequences encoding one or more peptide antigens and one or more ribonucleic acid sequences encoding one or more peptide adjuvants is encapsulated within lipid nanoparticles. In order to work within living organisms, mRNA needs reliable, efficient, and long- lasting delivery mechanisms that shield it from degradation and enable its uptake and release within cells. Lipid nanoparticles have emerged as successful candidates for delivering mRNA, with lipid nanoparticle-based mRNA vaccines being actively used in clinical settings to combat COVID-19. (Hou et al., Nature Reviews Materials, volume 6, pages1078–1094, 2021). The compositions of lipid nanoparticles typically involve various lipid components such as phospholipids, cholesterol, and other lipid modifiers. These components are often formulated in specific ratios to achieve desired properties such as stability, encapsulation efficiency, and target-specific delivery. Additionally, lipid nanoparticles may include surface modifications such as PEGylation to enhance circulation time and reduce immune response. Overall, the composition of lipid nanoparticles can be tailored based on the intended application and desired characteristics for efficient delivery of therapeutic agents such as mRNA. The lipid particles may be formed from a combination of more than one lipid, for example, a charged lipid may be combined with a lipid that is non-ionic or uncharged at physiological pH. Representative neutral and anionic lipids include, but are not limited to, sterols and lipids such as cholesterol, phospholipids, lysolipids, lysophospholipids, sphingolipids or pegylated lipids. Neutral and anionic lipids include, but are not limited to, phosphatidylcholine (PC) (such as egg PC, soy PC), including 1 ,2-diacyl-glycero-3-phosphocholines; phosphatidylserine (PS), phosphatidylglycerol, phosphatidylinositol (PI); glycolipids; sphingophospholipids such as sphingomyelin and sphingoglycolipids (also known as 1-ceramidyl glucosides) such as ceramide galactopyranoside, gangliosides and cerebrosides; fatty acids, sterols, containing a carboxylic acid group for example, cholesterol. Representative cationic lipids include, but are not limited to, N-[1-(2,3- dioleoyloxy)propyl]-N,N,N-trimethyl ammonium salts, referred to as TAP lipids, for example, methylsulfate salt. Representative TAP lipids include, but are not limited to, DOTAP (dioleoyl- ), DMTAP (dimyristoyl-), DPTAP (dipalmitoyl-), and DSTAP (distearoyl-). Representative cationic lipids in the liposomes include, but are not limited to, dimethyldioctadecyl ammonium bromide (DDAB), 1 ,2-diacyloxy-3-trimethylammonium propanes, N-[1-(2,3- dioloyloxy)propyl]-Ν,Ν-dimethyl amine (DODAP), 1 ,2-diacyloxy-3-dimethylammonium 455738066.1 43 propanes, N-[1-(2,3-dioleyloxy)propyl]-N,N,N-trimethylammonium chloride (DOTMA), 1 ,2- dialkyloxy-3-dimethylammonium propanes, dioctadecylamidoglycylspermine (DOGS), 3 -[N- (N',N'-dimethylamino-ethane)carbamoyl]cholesterol (DC-Chol); 2,3-dioleoyloxy-N-(2- (sperminecarboxamido)-ethyl)-N,N-dimethyl-1-propanaminium trifluoro-acetate (DOSPA), β- alanyl cholesterol, cetyl trimethyl ammonium bromide (CTAB), diC14-amidine, N-ferf-butyl-N'- tetradecyl-3-tetradecylamino-propionamidine, N-(alpha-trimethylammonioacetyl)didodecyl-D- glutamate chloride (TMAG), ditetradecanoyl-N-(trimethylammonio-acetyl)diethanolamine chloride, 1 ,3-dioleoyloxy-2-(6-carboxy-spermyl)-propylamide (DOSPER), and N , N , N' , N'- tetramethyl- , N'-bis(2-hydroxylethyl)-2,3-dioleoyloxy-1 ,4-butanediammonium iodide. In one form, the cationic lipids can be 1-[2-(acyloxy)ethyl]2-alkyl(alkenyl)-3-(2-hydroxyethyl)- imidazolinium chloride derivatives, for example, 1-[2-(9(Z)-octadecenoyloxy)ethyl]-2-(8(Z)- heptadecenyl-3-(2-hydroxyethyl)imidazolinium chloride (DOTIM), and 1-[2- (hexadecanoyloxy)ethyl]-2-pentadecyl-3-(2-hydroxyethyl)imidazolinium chloride (DPTIM). In one form, the cationic lipids can be 2,3-dialkyloxypropyl quaternary ammonium compound derivatives containing a hydroxyalkyl moiety on the quaternary amine, for example, 1 ,2- dioleoyl-3-dimethyl-hydroxyethyl ammonium bromide (DORI), 1 ,2-dioleyloxypropyl-3- dimethyl-hydroxyethyl ammonium bromide (DORIE), 1 ,2-dioleyloxypropyl-3-dimetyl- hydroxypropyl ammonium bromide (DORIE-HP), 1 ,2-dioleyl-oxy-propyl-3-dimethyl- hydroxybutyl ammonium bromide (DORIE-HB), 1 ,2-dioleyloxypropyl-3-dimethyl- hydroxypentyl ammonium bromide (DORIE-Hpe), 1 ,2-dimyristyloxypropyl-3-dimethyl- hydroxylethyl ammonium bromide (DMRIE), 1 ,2-dipalmityloxypropyl-3-dimethyl- hydroxyethyl ammonium bromide (DPRIE), and 1 ,2-disteryloxypropyl-3-dimethyl- hydroxyethyl ammonium bromide (DSRIE). a. Micelles In some forms, the particle or particle core is a lipid micelle. Lipid micelles can be formed, for instance, as a water-in-oil emulsion with a lipid surfactant. An emulsion is a blend of two immiscible phases wherein a surfactant is added to stabilize the dispersed droplets. In some forms the lipid micelle is a microemulsion. A microemulsion is a thermodynamically stable system composed of at least water, oil and a lipid surfactant producing a transparent and thermodynamically stable system whose droplet size is less than 1 micron, from about 10 nm to about 500 nm, or from about 10 nm to about 250 nm. Lipid micelles are generally useful for encapsulating hydrophobic active agents, including hydrophobic therapeutic agents, hydrophobic prophylactic agents, or hydrophobic diagnostic agents. 455738066.1 44 b. Liposomes In some forms, the particle or particle core is a liposome. Liposomes are small vesicles composed of an aqueous medium surrounded by lipids arranged in spherical bilayers. Liposomes can be classified as small uni-lamellar vesicles, large uni-lamellar vesicles, or multi- lamellar vesicles. Multi-lamellar liposomes contain multiple concentric lipid bilayers. Liposomes can be used to encapsulate targeted agents, by trapping hydrophilic agents in the aqueous interior or between bilayers, or by trapping hydrophobic agents within the bilayer. The lipid micelles and liposomes typically have an aqueous center. The aqueous center can contain water or a mixture of water and alcohol. Representative alcohols include, but are not limited to, methanol, ethanol, propanol, (such as isopropanol), butanol (such as n-butanol, isobutanol, sec-butanol, tert-butanol, pentanol (such as amyl alcohol, isobutyl carbinol), hexanol (such as 1-hexanol, 2-hexanol, 3-hexanol), heptanol (such as 1-heptanol, 2-heptanol, 3-heptanol and 4-heptanol) or octanol (such as 1-octanol) or a combination thereof. In one form, liposomes are prepared from long chain fatty acids and phytosterol formulations. c. Solid Lipid Particles In some forms, the particle is a solid lipid particle, or includes a solid lipid core. Solid lipid particles present an alternative to the colloidal micelles and liposomes. Solid lipid particles are typically submicron in size, i.e., from about 10 nm to about 1 micron, from 10 nm to about 500 nm, or from 10 nm to about 250 nm. Solid lipid particles are formed of lipids that are solids at room temperature. They are derived from oil-in-water emulsions, by replacing the liquid oil by a solid lipid. Representative solid lipids include, but are not limited to, higher saturated alcohols, higher fatty acids, sphingolipids, synthetic esters, and mono-, di-, and triglycerides of higher saturated fatty acids. Solid lipids can include aliphatic alcohols having 10-40, preferably 12-30 carbon atoms, such as cetostearyl alcohol. Solid lipids can include higher fatty acids of 10-40, preferably 12-30 carbon atoms, such as stearic acid, palmitic acid, decanoic acid, and behenic acid. Solid lipids can include glycerides, including monoglycerides, diglycerides, and triglycerides, of higher saturated fatty acids having 10-40, preferably 12-30 carbon atoms, such as glyceryl monostearate, glycerol behenate, glycerol palmitostearate, glycerol trilaurate, tricaprin, trilaurin, trimyristin, tripalmitin, tristearin, and hydrogenated castor oil. Representative solid lipids can include cetyl palmitate or beeswax. Cyclodextrin can also be used. In some forms, the compositions of lipid nanoparticles include SM-102, 1,2-DSPC, Cholesterol, and DMG-PEG in a lipid molar ratio of 50:10:38:1.5. 455738066.1 45 C. Formulations and Carriers The composition of the invention can be formulated in pharmaceutical compositions. These compositions can include, in addition to the described nanoparticles including mRNA(s) encoding two or more peptides, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer, or other materials well known to those skilled in the art. Such materials should typically be non-toxic and should not typically interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material can depend on the route of administration, e.g., oral, intravenous, cutaneous or subcutaneous, nasal, intramuscular, or intraperitoneal routes. Pharmaceutical compositions for oral administration can be in tablet, capsule, powder or liquid form. A tablet can include a solid carrier such as gelatin or an adjuvant. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil, or synthetic oil. Physiological saline solution, dextrose, or other saccharide solution or glycols such as ethylene glycol, propylene glycol, or polyethylene glycol can be included. The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the pharmaceutical composition (e.g., immunogenic or vaccine formulation) is administered. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, ethanol and the like. Examples of suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin. The formulation should be selected according to the mode of administration. For intravenous, cutaneous, or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity, and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, or Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants, and / or other additives can be included, as required. Administration is preferably in a “therapeutically effective amount” or “prophylactically effective amount” (as the case can be, although prophylaxis can be considered therapy), this being sufficient to show benefit to the individual. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of disease being treated. Prescription of treatment, e.g., decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and 455738066.1 46 other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in the latest edition of Remington's Pharmaceutical Science, Mack Publishing Company, Easton, Pa. (“Remington's”). 1. Formulations In some forms, the disclosed compositions including mRNA(s) encoding one, two, or more peptides optionally encapsulated within a nanoparticle are formulated in a pharmaceutical composition. Pharmaceutical compositions including the described compositions, together with one or more further adjuvants and / or additional active agents, and the combination thereof are provided. D. Exemplary Immunogenic Compositions and Vaccines In some forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, can deliver exogenous proteins and / or nucleic acids to a subject to stimulate desired immune responses in the subject. The delivery of antigen and adjuvants via the mRNA compositions, including nanoparticles encapsulating the mRNAs, confers protective immunity to infectious agents such as viruses and bacteria. Methods for vaccination using mRNA adjuvants and mRNA antigens within mRNA compositions, including nanoparticles encapsulating the mRNAs, are provided which allow potent and persistent presentation of antigen to the immune system without stimulating IFN responses early upon injection. A strong IFN response would likely impede alphaviral replication and thus limit antigen dose over time. (Zhang, et al., J Virol., 81, 11246-11255, (2007); White, et al., J Virol., 75, 3706-3718 (2001)). Other antigens can be substituted with the antigens described in the study conducted herein. These could include antigens from pathogenic microbes such as viruses, bacteria, fungi, protozoa, as well as cancer antigens. Therefore, the mRNA compositions, including nanoparticles encapsulating the mRNAs, can serve as a safe and effective platform for the delivery vaccine agents, such as RNA-encoded antigens and neo-antigens, targeting many different pathogenic microbes. Typically, delivery of exogenous antigen to the cells of a subject via the described compositions of mRNA(s) optionally encapsulated within nanoparticles, such as lipid nanoparticles (LNP) results in the production of antibodies and other biomolecules capable of recognizing and neutralizing the antigen. Antigen that has been arrayed on the surface of antigen-presenting cells (APC) can be presented to a “helper” T cell, such as an antigen-specific naive CD4+ T cell, or directly to a CD8+ T cell by cross presentation on MHC class I molecules. Such presentation delivers a signal via the T cell receptor (TCR) that directs the T cell to initiate an immune response that will be specific to the presented antigen. 455738066.1 47 Therefore, the mRNA compositions, including nanoparticles encapsulating the mRNAs, can be used to initiate, moderate or enhance a humoral and / or cellular immunity to an encoded antigen. For example, the mRNA compositions, including nanoparticles encapsulating the mRNAs, deliver exogenous nucleic acids and / or proteins in an amount effective to induce, enhance or otherwise moderate the biological activities of immune cells, such as macrophages, B-cells, T-cells, dendritic cells and NK cells. In some forms, administration of the mRNA compositions, including nanoparticles encapsulating the mRNAs, including nucleic acid sequences encoding an antigen and an adjuvant to a subject confers immunity to the antigen to the subject. Immunity can manifest in the production of a reservoir of memory T cells (i.e., memory CD8+ T cells) and / or antigen- specific B cells in the subject sufficient to provide rapid immune cellular and / or humoral immune responses to repeat exposure of the antigen. Preferably, administration of the mRNA compositions, including nanoparticles encapsulating the mRNAs, including nucleic acid sequences encoding an antigen and an adjuvant confers protection against infection or disease caused by the organism(s) from which the antigen is derived. Typically, administration of the mRNA compositions, including nanoparticles encapsulating the mRNAs, including nucleic acid sequences encoding an antigen to a subject enhances the uptake and delivery of antigen to the antigen presenting cells of the subject relative to administration of equal amounts of the antigen or nucleic acid encoding the antigen alone. Therefore, administration of antigen to a subject via the mRNA compositions, including nanoparticles encapsulating the mRNAs, can enhance the immune response to the antigen in the subject relative to administration of equal amounts of the antigen or nucleic acid encoding the antigen alone. For example, mRNA compositions, including nanoparticles encapsulating the mRNAs, can increase, prolong or otherwise enhance presentation of the encoded antigen at the surface of antigen presenting cells of the subject. Vaccines can be administered prophylactically or therapeutically. Vaccines can also be administered according to a vaccine schedule. A vaccine schedule is a series of vaccinations, including the timing of all doses. Many vaccines require multiple doses for maximum effectiveness, either to produce sufficient initial immune response or to boost response that fades over time. Vaccine schedules are known in the art, and are designed to achieve maximum effectiveness. The adaptive immune response to one or more antigen delivered in the mRNA compositions, including nanoparticles encapsulating the mRNAs, can be monitored using methods known in the art to measure the effectiveness of the vaccination protocol. In some forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, deliver exogenous proteins and / or nucleic acids to a subject and stimulate immune responses 455738066.1 48 specifically to antigen that is expressed and biologically-processed by the host cells. Therefore, methods for vaccination using nucleic acids encoding antigens deliver by the mRNA compositions, including nanoparticles encapsulating the mRNAs, can provide immunity to antigen including post-translational modifications specific to the host subject. For example, vaccination using nucleic acids encoding antigen delivered by the mRNA compositions, including nanoparticles encapsulating the mRNAs, can provide immunity to proteins containing post-translational modifications native to the host, such as glycosylation, lipidation (including myristoylation, palmitoylation, isoprenylation), sulfation, oxidation, phosphorylation, adenylation, methylation and amidation. The immune responses generated by a subject to these post-translationally-modified peptide antigens can be the same or different to immune responses raised in the same host against the non-natively expressed or post-translationally modified form of the same antigenic peptide. As described above, mRNA compositions, including nanoparticles encapsulating the mRNAs, can include two or more different antigens and / or two or more different adjuvants. In some forms, vaccines include combinations of different types of mRNAs, such as those encode different antigens or adjuvants, each with different antigen / adjuvant production kinetics. By “multiplexing” RNAs with different kinetics, nanoparticles encapsulating mRNA as vaccines can be engineered to express one or more antigens at different times following administration. The multiplexed mRNA vaccines, optionally in nanoparticles, can include a mixture of distinct mRNA compositions, including nanoparticles encapsulating the mRNAs, each enclosing different RNA species, or alternatively each nanoparticle can be engineered to include more than one RNA species. When mRNA compositions, including nanoparticles encapsulating the mRNAs are engineered to include one species of RNA, such as a single species of mRNAs encoding a single antigen, vaccines can be designed by mixing a desired amount of each nanoparticle to create a combined nanoparticle vaccine, having the desired expression kinetics. Due to the finite persistence of mRNA encoding exogenous antigens and adjuvants in the cells of a subject, mRNA vaccines are self-limiting and only produce antigens / adjuvants for a finite amount of time until the host eliminates the mRNA and all vaccine products are cleared by the body. Antigen production occurs in host cell cytoplasm, and the genetic material in the nucleus of the cell is never manipulated. In some forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, including two or more different mRNAs expressing the different antigens / adjuvants can be used to induce expression of the antigen in the cells of a recipient with different expression kinetics. For example, the delivery of two or more different 455738066.1 49 mRNAs expressing the different antigens / adjuvants can give rise to a different serum half-life of the expression product. In some forms, the encapsulated agent of mRNA compositions, including nanoparticles encapsulating the mRNAs is engineered to include more than one RNA species, to provide expression of antigens over prolonged or defined periods of time following administration. For example, mRNA compositions, including nanoparticles encapsulating the mRNAs can include mRNAs encoding the same or different antigens / adjuvants to provide distinct and different expression kinetics for the antigen(s) within a subject. In some forms, the mRNA compositions, including nanoparticles encapsulating the mRNAs deliver cargo, such as RNA neo-antigens, to a subject to provide two or more distinct phases of expression of the antigen in the subject. For example, mRNAs encoding an antigen can give rise to a first “expression phase” of an antigen associated with translation of one RNA species, leading to an increase in serum concentration of the antigen. As antigen expression diminishes, and antigen serum concentration decreases, a second “expression phase” of the same or different antigen, associated with translation of a second RNA species, leads to a subsequent increase in serum concentration of antigen. Therefore, when mRNA compositions, including nanoparticles encapsulating the mRNAs, including two or more different mRNAs expressing antigen are used for vaccination, it can be desirable to administer the vaccine and / or engineer nanoparticle therapeutic, prophylactic and diagnostic agents to provide a primary (i.e., “prime”) increase in the serum concentration of the antigen(s), followed by a secondary or further subsequent (i.e., “boost”) increases in the serum concentration of the antigen(s), based on only a single administration of the vaccine. For example, mRNA compositions, including nanoparticles encapsulating the mRNAs, enclosing more than one mRNA can provide “Self-boosting” vaccines. In other forms, the nanoparticle, such as a lipid nanoparticle (LNP) vehicles can be designed to enter cells and deliver therapeutic, prophylactic and diagnostic agents at a certain rate, for example, by modification of the composition of the mRNA compositions, including nanoparticles encapsulating the mRNAs to alter the serum half-life of the nanoparticle in vivo. In further forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, are delivered to more than one bodily locations, for example by the same or different administration routes, leading to different serum half-life and cellular-uptake kinetics of the nanoparticle and subsequent differences in the location and rate of antigen expression. In some forms, when mRNA compositions, including nanoparticles each encapsulating two or more species of mRNAs are used to deliver mRNAs to express antigens / adjuvants in the cells of a subject, a smaller molar amount of each species of the mRNAs is required to produce 455738066.1 50 the same antigen-specific immune response in the subject, as compared to the molar amount of each species of mRNA delivered by mRNA compositions including nanoparticles each encapsulating only one of the two species of mRNAs each expressing one of the same antigens / adjuvant, to produce the same antigen-specific immune response. Generally, a smaller amount of mRNA compositions, including nanoparticles each encapsulating one or more RNAs molecule including two or more species of mRNA sequences, each encoding one or more antigen and one or more adjuvant, can be required to produce an antigen-specific immune response in a subject, as compared to the amount of mRNA compositions, including two or more nanoparticles each encapsulating one mRNA molecule encoding one the same antigen or adjuvant. Therefore, the described mRNA compositions, including nanoparticles each encapsulating one or more RNA molecules, each encoding two or more species of mRNA sequences can be used to induce an antigen-specific immune response in a subject that reduces any undesirable effects associated with the introduction of the mRNA compositions, including nanoparticles encapsulating the mRNAs into a subject. Methods for screening of different vaccine agents delivered by the mRNA compositions, including nanoparticles encapsulating the mRNAs, are also provided. Typically the methods include vaccinating a subject with an mRNA composition, including nanoparticles encapsulating the mRNAs, including one or more distinct antigens / adjuvants or nucleic acids encoding antigens and adjuvants and assessing the immune response in the subject. The adaptive immune response to one or more antigens delivered in the mRNA composition, including nanoparticles encapsulating the mRNAs, can be monitored using methods known in the art to measure the effectiveness of the vaccination protocol. For example, the duration and extent of antigen- specific T-cell activation can be used as a marker for antigen expression kinetics. Antigen-serum concentration can also be used to determine antigen-expression kinetics. 1. Compositions including Multiplexed mRNAs In some forms, the compositions include multiple mRNA sequences, for example, as part of a single polycistronic mRNA, encoding an antigen and one or more non-antigen immune- modulatory agents. Typically, the polycistronic mRNA is enclosed or encapsulated within a particle, such as a nanoparticle, for example, a lipid nanoparticle (LNP). In some forms, compositions include multiple mRNA sequences, for example, multiple polycistronic mRNAs encapsulated within the same particle, such as the same nanoparticle. In some forms, the compositions include 2 or more, such as 3, 4, 5, 6, 7, 8, 9, 10 or more than 10 species of mRNAs, each encoding the same or different species of polypeptide. For example, in some forms, a single polycistronic mRNA includes 2 or more, such as 3, 4, 5, 6, 7, 8, 9, 10 or more than 10 species of mRNAs, each encoding the same or different species of polypeptide. In some 455738066.1 51 forms, a single particle, such as a nanoparticle, includes 1 or more polycistronic mRNA molecules, such as 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 polycistronic mRNA molecules. Each polycistronic mRNA molecule can encode 2 or more than 2 species of polypeptide for expression in a target cell. Therefore, compositions including a nanoparticle, such as an LNP, encapsulating 1 or more polycistronic mRNA molecules, such as 2, 3, 4, 5, 6, 7, 8, 9, 10 or more than 10 polycistronic mRNA molecules are also described. In some forms, the described compositions encode 2, 3, 4, 5, 6,7, 8, 9, 10 or more than 10, up to 20 different antigenic peptides and / or adjuvant peptides and / or immune-modulatory peptides, for delivery to and expression within the same cell(s). In some forms, compositions include a single nanoparticle including or encapsulating one or more mRNA molecule encoding a single species of polypeptide (i.e., a single adjuvant peptide, or a single antigen peptide, or a single immunomodulatory peptide), together with one or more polycistronic mRNA molecules encoding two or more peptides (i.e., one or more adjuvant peptide, and / or one or more antigen peptide, and / or one or more immunomodulatory peptide). Therefore, in some forms, the described compositions provide a platform for the multiplexing the delivery and expression of multiple species of immune peptides within the same cell in vivo, for example, to stimulate antigen-specific (i.e., cellular) immunity in a host subject and simultaneously boost or otherwise control non-specific (i.e., humoral) immune responses in the same subject. Typically, the multiplexing of mRNA transcripts within the same particle and / or within the same RNA molecule according to the described compositions increases the biological immune processes that are generated, increased, reduced, or otherwise controlled within a host as compared to providing the same number of transcripts as a multiplicity of single mRNAs encoding the same peptides, but each delivered within separate particles to the same host. For example, in some forms, providing a single particle including 2 species of peptides (i.e., one antigen and one adjuvant) to a host cell in vivo induces a stronger immune response in the host that providing the same mRNA encoding the same antigen in a first particle and the same mRNA encoding the same adjuvant as a second particle to the same host. It may be that the simultaneous processing, translation and / or post-translational modification of multiple species of mRNAs within a single cell enhances the biological activity of immune cells within the host as compared with processing the mRNAs delivered as two separate particles, for example, within two different cells of the same host. In some forms, the multiplexing of mRNAs encoding two peptides (e.g., one antigen peptide and one adjuvant peptide) within the same polycistronic mRNA molecule increases the biological immune processes that are generated, increased, reduced, or otherwise controlled within a host as compared to providing the same number of transcripts as single mRNAs, e.g., 455738066.1 52 encoding the same species of peptides, delivered within the same particle to the same host. It may be that the processing of transcripts from the same polycistronic mRNA provides a more robust translation of equal amounts of each peptide within the cell, and / or provides a more effective immunomodulatory effect as compared with processing of a multiplicity of single mRNA molecules. 2. Tertiary Lymphoid Structures In some forms, the combination of encoded antigen peptide(s), adjuvant peptide(s) and immune-modulatory agent peptide(s) that are encoded by encapsulated mRNA(s) according to the disclosure are effective to induce formation of a tertiary lymphoid structure when expressed within a host in vivo. Tertiary lymphoid structures (TLSs) are formations at sites with persistent inflammatory stimulation, including tumors. These ectopic lymphoid organs mainly include chemo-attracting B cells, T cells, and supporting dendritic cells (DCs). Mature TLSs exhibit functional organization for the optimal development and collaboration of adaptive immune response, delivering an augmented effect on the tumor microenvironment (TME) Emerging evidence indicates that effector cells never fight alone during an immune response. Based on their presence in the TME, the localization, organization, and other cell types of the immune cell lineage can all greatly alter the tumor-associated immune response. It is worth pointing out that the compartmentalized organization defined by the physical separation of immune / non-immune clusters could independently determine the outcome of tumor sufferers. Ectopic aggregated but orderly organized immune cells are termed as tertiary lymphoid structures (TLSs). These are well-organized aggregates of immune cells in non-lymphoid tissues that are subjected to long-lasting inflammatory response, including chronic infection, autoimmune disease, as well as tumors. TLSs are composed of an inner CD20+ B cell-zone mantled with CD3+ T cell-zone, anchored with dendritic cells (DCs) and vessel structure, similar to the lymphoid follicles in secondary lymphoid organs (SLOs). Therefore, in some forms, the described compositions include mRNA(s) encoding one or more molecules that promote, stimulate, enhance or generate the formation of a tertiary lymphoid structure. In some forms, the described compositions include mRNA(s) encoding one or more of vascular cell adhesion molecule 1 (VCAM1), intercellular adhesion molecule 1 (ICAM1), mucosal vascular addressin cell adhesion molecule 1 (MAdCAM1), peripheral lymph node addressin (PNAd)) and / or one or more chemokines (e.g., chemokine (C-C motif) ligand 19 (CCL19), CCL21, and chemokine (C-X-C motif) ligand 13 (CXCL13)). In some forms, the compositions include one or more mRNA(s) encoding one or more molecules that promote, stimulate, enhance or otherwise generate vascularization and / or immune cell recruitment at or 455738066.1 53 within a tertiary lymphoid structure. In some forms, the compositions include one or more mRNA(s) encoding one or more molecules that promote B cell recruitment, together with the downstream process for lymphoid neogenesis, including but not limited to vessel differentiation, chemokine induction, T / B segregation, and germinal center (GC) formation. Specific signals thought to be involved in TLS formation include receptors such as lymphotoxin alpha, lymphotoxin beta, CXCL13 and TNF, as well as type I IFNs. Therefore, in some forms, the combination of encoded antigen peptide(s), adjuvant peptide(s) and immune- modulatory agent peptide(s) include one or more of lymphotoxin alpha, lymphotoxin beta, CXCL13 and TNF, and / or type I IFNs. III. Methods of Making In general, the DNA vectors contains the following elements: (i) a prokaryotic origin of replication, so that the vector may be amplified in a prokaryotic host; (ii) a gene encoding a marker which allows selection of prokaryotic host cells that contain the vector (e.g., a gene encoding antibiotic resistance); and (iii) at least one gene encoding a desired mRNA or protein located adjacent to a transcriptional promoter capable of directing the expression of the gene. In some forms, nucleic acid for producing an mRNA includes a nucleotide sequence encoding a peptide antigen and / or adjuvant or immunomodulatory agent and optionally one or more additional elements linked thereto. The elements include but are not limited to elements that enhance transcription or translation. Non-limiting exemplary elements are discussed below and include, but are not limited to, signal peptide, promoter region such as T7 promoter, TRILINK CAP site, traditional KOZAK sequence, 5’ untranslated region (UTR), 3’ UTR, and poly(A) tail. It will be appreciated that some of these elements are present only for the purpose of transcription (e.g., promoter, CAP site, UTRs, etc.), and thus, may be absent from an mRNA construct and expressed protein. Furthermore, it will also be appreciated that some of these elements are present only for nucleic acid stability and / or translation (e.g., TRILINK CAP site, KOZAK sequence, poly(A) tail) and thus may be absent from an expressed protein. Furthermore, it will be appreciated that some of the elements are present only for protein trafficking and / or purification (e.g., signal sequence and purification tags), and may be present or absent in the final antigenic polypeptide. Thus, these elements and others are disclosed in all combinations, and can be selectively present or absent from the constructs depending on the particular composition at a particular time, e.g., DNA or RNA vector construct, mRNA, or protein. In some forms, a signal peptide is incorporated to improve transcription of one or more mRNAs encoding one or more antigen and / or adjuvant peptides. Thus, in some forms, the nucleic acid sequence also includes one or more signal peptides. 455738066.1 54 In some forms, the nucleic acid includes a promoter sequence. In one form, the nucleic acid includes a T7 promoter sequence. In another form, the nucleic acid includes a T3 promoter. In a further form, the nucleic acid includes a SP6 promoter. In some forms, the nucleic acid includes a 5’ untranslated region (UTR) sequence. In some forms, the nucleic acid includes a 3’ UTR sequence. In some forms, the isolated nucleic acid sequence includes nucleotide sequence encoding the antigen such as the LTA protein of MCPyV, and / or immunogenic domains and fragments thereof, and (i) signal peptide at the 5’ end of the nucleotide sequence encoding the antigen, (ii) one or more restriction sites flanking either or both side of the nucleotide sequence, (iii) promoter region such as T7 promoter, (iv) TRILINK CAP site, (v) a KOZAK sequence, (vi) 5’ UTR, (vii) 3’ UTR, and (viii) poly(A) tail. A. Designing Synthetic Nucleic Acid Constructs that Express Antigens and Adjuvants In some forms, DNA constructs that encode a functional mRNA subunit for antigens and adjuvants are designed. As shown in the plasmid diagram (FIG.1), a T7 promoter sequence was added immediately following the first restriction site for compatibility with commercial in-vitro transcription kits. This T7 promoter sequence was modified to end with an AGG sequence for compatibility with Trilink (San Diego, CA) CleanCap 5’ mRNA capping technology. For the 5’ untranslated region (UTR), a synthetic sequence was chosen based on previously published screen (Cao, et al., Nat Commun 12, 41382021). This sequence was generated by artificial intelligence to be optimized for high efficiency translation and was among the highest performers in a 5’ UTR screen. Natural 3’ UTRs from each potential adjuvant were used. In cases where the natural 3’ UTR exceeded 100 bases, the length was shortened to only include the first 100 bases. A 100 base polyadenylation sequence was added following the 3’ UTR. In some forms, DNA constructs capable of encoding antigen and adjuvants are co- encapsulated for in vivo delivery. Linked constructs that contain coding regions for both the antigens of interest and adjuvants as a single functional subunit can be designed. In some forms, antigen constructs are linked to the adjuvant constructs using a self-cleaving linker, such as a 2A peptide linker, with addition of a Furin cleavage site that excludes the linker amino acids and produces full length antigen and functional full-length adjuvants as separate end products of a single mRNA. Furin is a recombinant, ubiquitous subtilisin-like proprotein convertase with a minimal cleavage site of Arg-X-X-Arg, preferably the site Arg-X-Lys / Arg-Arg. An exemplary furin cleavage nucleotide sequence is CGGGCCAAGCGG (SEQ ID NO:34). Additionally, two or more separate adjuvant transcripts can be linked using a self-cleaving P2A linker followed by a self-cleaving T2A linker with Furin cleavage sites that exclude linker amino acids. 455738066.1 55 In some forms, these DNA sequences can be cloned into a vector such as pUC57-Simple or pUC57-Simple-BsaI-BsmBI-Free vector with an antibiotic resistance gene and be amplified into a prokaryotic host. The template DNA can be extracted from the base plasmids by cutting at the appropriate restriction sites. Template DNAs can be separated from plasmid DNAs based on fragment size by gel electrophoresis and be purified from agarose gel using Gel DNA recovery kit. Purified, double stranded, linearized template DNA can then be used for mRNA production via in vitro transcription methods. mRNA is 5’ capped for increased stability and translational efficiency. The mRNA products are then purified using RNA purifying kits and these purified functional mRNA can then be stored in sterile water at -80 degrees. The cloning platform demonstrated here can be used to substitute any suitable antigen transcript combined with any suitable adjuvant transcript(s) in a fully customizable model depending on the indication and clinical intent (i.e., prophylactic vs. therapeutic use). 1. Linkers The described messenger ribonucleic acid (mRNA) molecules typically include a linker between the two or more sequences encoding different polypeptides. Generally, in polycistronic protein expression, linker sequences are inserted between multiple protein-coding sequences (ORFs) on a single mRNA transcript to ensure each protein is independently expressed. In some forms, these linkers facilitate ribosomal skipping or peptide cleavage, allowing the ribosome to move to the next ORF without translating the linker itself. In other forms, the linkers are expressed and include a cleavage site, such as a protease cleavage site. Any linkers designed for expression of a polycistronic construct can be incorporated into the described synthetic mRNAs. For multi-gene expression, linkers can be fusion linkers, proteolytic cleavage sites, internal ribosomal entry sites (IRESs), or self-cleaving 2 A peptides. The linkers can be “read through” linkers, such as tandem “Gly-Gly-Ser” or “Gly-Ser” repeats that act as “fusion peptides”, and / or self-cleaving 2A peptides, or they can be non-read through linkers, such as an IRES sequence. In some forms, a linker is a 2A peptide.2A peptides include polypeptides of about 18 to 22 contiguous amino acids, which can induce “ribosomal skipping” during translation, i.e., to cause the ribosome to “skip” over the peptide sequence during translation, effectively separating the two proteins.2A peptides are naturally present in various viruses, and include the sequence D-X-E-X-NPGP (SEQ ID NO:26). In some forms, the described synthetic mRNAs include a single ORF including a sequence encoding one or more 2A peptides to generate polyproteins by causing the ribosome to fail at making a peptide bond, and then resume translation. 455738066.1 56 Exemplary 2A peptide amino acid sequences include: EGRGSLLTCGDVEENPGP (“T2A”; SEQ ID NO:27); ATNFSLLKQAGDVEENPGP (“P2A”; SEQ ID NO:28); QCTNYALLKLAGDVESNPGP (“E2A”; SEQ ID NO:29); and VKQTLNFDLLKLAGDVESNPGP (“F2A”; SEQ ID NO:30). In some forms, a 2A peptide sequence is located between a first and second ORF encoding a polypeptide. In some forms, more than one 2A sequence is located between a first and second ORF encoding a polypeptide, for example, two or three 2A sequences in tandem may be included. An exemplary nucleotide sequence for a T2A sequence includes: gagggcaggggaagtcttctaacatgcggggacgtggaggaaaatcccggccca (SEQ ID NO:31). Any of the described 2A linkers can include a “GSG” (Gly-Ser-Gly) sequence on the N- terminal of a 2A peptide, for example, to assist with efficiency. In other forms, a linker is an internal ribosome entry site (IRES) or Ubx-IRES. An IRES sequence is an RNA element that allows for translation initiation in a cap-independent manner, as part of the greater process of protein synthesis. Initiation of eukaryotic translation nearly always occurs at and is dependent on the 5' cap of mRNA molecules, where the translation initiation complex forms and ribosomes engage the mRNA. IRES elements, however, allow ribosomes to engage the mRNA and begin translation independently of the 5' cap. IRES sequences are known in the art (see, e.g., Zhao et al., Genomics Proteomics Bioinformatics.2020 Apr;18(2):129-139. doi: 10.1016 / j.gpb.2020.03.001). Exemplary IRES nucleotide sequences include: aaaaacttccggcgggaaccggaaggtgcggtggcactcacggaatctcgggtcttctgacgtg ccgggcgggaagatgtcatcattgccaagaagagcgaaagtacaggtccaggatgtggtactga aagatgaattttcttcattctctgagttatcatctgcctctgaaga (SEQ ID NO:32); and aaaatccaccccaacaatcgctgtgtgccgctttagtgcgctcgccgtcggctctacctgcgtg ctttagctccttctcgcctgatccttctgtctctcccaaccccggacacccggcttcgactggt tatatcttcggtgttcttttcctctcttcttctttcgcggttcagc (SEQ ID NO:33). 2. Exemplary synthetic mRNAs In an exemplary form a synthetic mRNA prepared according to the described methods includes, from 5’ to 3’ (i) a 5’ Cap 1 structure; (ii) a 5’ untranslated region (5’ UTR); 455738066.1 57 (iii) a sequence encoding a first polypeptide; (iv) a first Furin cleavage sequence; (v) a first linker sequence, such as a P2A linker; (vi) a sequence encoding a second polypeptide; (vii) a 3’ untranslated region (3’ UTR); and (viii) a poly Adenylated 3’tail; whereby one of the first or the second polypeptide encodes the peptide antigen; and whereby one of the first or the second polypeptide encodes a peptide adjuvant. In other forms, the synthetic mRNA prepared according to the described methods includes, from 5’ to 3’ (i) a 5’ Cap 1 structure; (ii) a 5’ untranslated region (5’ UTR); (iii) a sequence encoding a first polypeptide; (iv) a first Furin cleavage sequence; (v) a first linker sequence, such as a P2A linker, optionally including an N-terminal Gly-Ser-Gly; (vi) a sequence encoding a second polypeptide; (vii) a second Furin cleavage sequence; (viii) a second linker sequence, such as a P2A linker, optionally including an N- terminal Gly-Ser-Gly; (ix) a sequence encoding a third polypeptide; (x) a 3’ untranslated region (3’ UTR); and (xi) a poly Adenylated 3’ tail; whereby the first or the second polypeptide encodes a first peptide antigen, whereby the first or the second polypeptide encodes a first peptide adjuvant, and whereby the third polypeptide encodes a second peptide adjuvant or a second peptide antigen. In some forms, at the time of addition of a 5’ cap, n1-methyl-pseudo UTP is also substituted for stability, and / or to limit immunogenicity of the resulting mRNA compositions in vivo. In some forms, base substitution is 100%. In other forms, base substitution is in an amount from about 10% to about 99%, inclusive. An exemplary synthetic mRNA includes a cleavable linker configured between two coding mRNA sequences encoding a first and second, and / or second and third polypeptides. An exemplary cleavable linker includes a furin recognition sequence, a Gly-Ser-Gly polypeptide, and a P2A linker peptide. 455738066.1 58 An exemplary cleavable linker polypeptide construct includes: RAKRGSGEGRGSLLTCGDVEENPGP (SEQ ID NO:34), with the furin cleavage sequence indicated in bold font, the Gly-Ser-Gly indicated in italic font, and the P2A peptide indicated in uppercase font, respectively. A corresponding nucleic acid sequence encoding the cleavable linker polypeptide construct of SEQ ID NO:34 includes: cgggccaagcggggctccggcgagggcaggggaagtcttctaacatgcggggacgtggaggaaa atcccggccca (SEQ ID NO:35). 3. Nucleotide Composition The described synthetic messenger ribonucleic acids (mRNA) can include naturally occurring nucleotides, or modified / synthetic nucleotides, or mixtures thereof within the same RNA molecule. In some forms, one or more of the nucleotides associated with the described synthetic mRNAs are modified nucleotides. Examples of modified nucleotides include, but are not limited to diaminopurine, S2T, 5- fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4- acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2- thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6- isopentenyladenine, 1 -methylguanine, 1 -methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-D46- isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2- thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3- N-2- carboxypropyl) uracil, and (acp3)w, 2,6-diaminopurine. Nucleotides within the describe synthetic mRNAs may also be modified at the base moiety (e.g., at one or more atoms that typically are available to form a hydrogen bond with a complementary nucleotide and / or at one or more atoms that are not typically capable of forming a hydrogen bond with a complementary nucleotide), sugar moiety or phosphate backbone. In some forms, the described synthetic mRNAs include Locked nucleic acids (LNA). LNA is a family of conformationally locked nucleotide analogues which, amongst other benefits, imposes truly unprecedented affinity and very high nuclease resistance to DNA and RNA oligonucleotides (Wahlestedt C, et al., Proc. Natl Acad. Sci. USA, 975633–5638 (2000); Braasch, DA, et al., Chem. Biol.81–7 (2001); Kurreck J, et al., Nucleic Acids Res.301911–1918 (2002)). 455738066.1 59 In some forms, the described synthetic mRNAs include Peptide nucleic acids (PNA). PNA is a nucleic acid analog in which the sugar phosphate backbone of natural nucleic acid has been replaced by a synthetic peptide backbone usually formed from N-(2-amino-ethyl)-glycine units, resulting in an achiral and uncharged mimic (Nielsen, et al., Science 254, 1497-1500 (1991)). It is chemically stable and resistant to hydrolytic (enzymatic) cleavage. In some forms, the described synthetic mRNAs include a combination of natural or synthetic ribonucleotides, PNAs, LNAs, or any combination thereof. In some forms, the described synthetic mRNAs include one or more modified nucleotides that provide nuclease resistant nucleotide linkages, such as phosphorothioate (PS) bonds which substitute a sulfur atom for a non-bridging oxygen in the phosphate backbone of an oligonucleotide; 2'-O-Methyl (2'OMe), a naturally occurring post-transcriptional modification of RNA that prevents attack by single-stranded endonucleases; 2' fluoro bases, that include a fluorine-modified ribose which increases binding affinity and also confers some relative nuclease resistance relative to native RNA; inverted dT and / or ddT incorporated at the 3′ end of an oligonucleotide, leading to a 3'-3' linkage that will inhibit degradation by 3' exonucleases; and phosphorylation of the 3′ end of the nucleotides to inhibit degradation by some 3′-exonucleases. B. Encapsulation of the Functional mRNAs Using Lipid Nanoparticles In some forms, nanoparticles such as lipid nanoparticles can be used to encapsulate the mRNAs for delivery of mRNAs into a subject. In some forms, lipid nanoparticles containing SM-102, 1,2-DSPC, Cholesterol, and DMG-PEG in a lipid molar ration of 50:10:38.5:1.5 are assembled and incorporated with mRNA using a rapid solvent injection mixing technique. For example, mRNA can be first combined with 50 mM sodium acetate solution at pH 5.0. This solution can be then stirred in a sterile container at 700 rpm and the ethanolic mixture can be rapidly injected into the acidic solution and mixed for an additional 30 minutes to create homogenous nanoparticles containing the functional mRNA units. Placebo containing all components except for mRNA can be prepared using the same process. mRNA compositions, including nanoparticles encapsulating the mRNAs can then dialyzed against 500 volumes of sterile PBS. The nanoparticle solution can be then drawn into sterile 1mL syringes and stored at 4 degrees until use. IV. Methods of Using Methods of using the described compositions, for example including a synthetic messenger ribonucleic acid (mRNA) including (a) one or more ribonucleic acid sequences encoding one or more peptide antigens; and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvants optionally packaged in nanoparticles, are provided. 455738066.1 60 In some forms, the methods induce an immune response to a peptide antigen in a subject by administering to the subject the pharmaceutical composition including a synthetic messenger ribonucleic acid (mRNA) including (a) one or more ribonucleic acid sequences encoding one or more peptide antigens; and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvants, whereby the ribonucleic acid is configured to express the peptide antigen(s) and the peptide adjuvant(s) as distinct polypeptides within a mammalian cell. Methods of using the compositions to treat one or more diseases or disorders in a subject by administering the compositions of synthetic mRNA(s) to the subject are also provided. Any of the methods can include the selection of a subject and / or a suitable control. Suitable routes of administration, dosages and effective amounts are also described. A. Methods of Treatment Methods of treating a subject by administering to the subject an effective amount of the described compositions, for example, including a synthetic messenger ribonucleic acid (mRNA) including one or more ribonucleic acid sequences encoding one or more peptide antigens; and one or more ribonucleic acid sequences encoding one or more peptide adjuvants mRNAs and / or nanoparticles encapsulating the synthetic mRNAs for treating or preventing one or more diseases in the subject are provided. Typically, the methods administer an amount of the described mRNA compositions to raise an immune response to the antigenic component in the subject, whereby the encoded adjuvant component simultaneously enhances, directs or otherwise influences the size, scope and / or downstream response to the antigen in the subject. In some forms, the mRNAs encode one or more antigen(s) associated with a disease or pathological state in the subject, and the methods administer the composition to treat or ameliorate the disease or pathological state in the subject. For example, in some forms, the methods administer an mRNA encoding a cancer antigen to a subject to treat or ameliorate one or more symptoms of the cancer in the subject. In other forms, the methods administer an mRNA encoding an antigen derived from a disease state or a pathogen to a subject to prevent or delay the onset of one or more symptoms of the disease or an infection with the pathogen in the subject. Therefore, in some forms, the methods administer the compositions prophylactically to the subject. Methods for using the described compositions including one or more mRNA antigens and one or more mRNA adjuvants as a vaccine for inducing or stimulating an immune response to the encoded antigen(s) in a subject are provided. In some forms, the methods are effective to induce an immune response to a peptide antigen(s) in a subject, for example, whereby the immune response is effective to treat or prevent an infection and / or disease in the subject caused by the organism or agent from which the 455738066.1 61 antigen is derived. Exemplary diseases and / or infections include proliferative diseases such as cancer, and infectious diseases, such as those caused by a pathogenic bacterium, or a pathogenic virus, or a pathogenic fungus, or a pathogenic protozoan. In other forms, the methods are effective to treat a subject having a disease, disorder, or condition by administering to the subject an effective amount of a synthetic mRNA including (a) one or more ribonucleic acid sequences encoding one or more peptide antigens; and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvants to treat or reduce a symptom of a disease, disorder, or condition in the subject. 1. Pathogens / Diseases to be Treated or Vaccinated Against The described compositions including one or more mRNA antigens and one or more mRNA adjuvants can deliver protein and / or nucleic acid antigen to a subject in an amount effective to vaccinate the subject from one or more diseases and disorders. The Compositions including one or more mRNA antigens and one or more mRNA adjuvants can serve as a vaccination platform for a wide variety of microbial pathogens, such as bacterial, viral, fungal and protozoan pathogens. In some forms, the target of the vaccine could be a type of cancer cell as a cancer treatment. Alternately, the target could be any of a large number of microbial pathogens. Exemplary diseases that can be vaccinated against include disease for which vaccines are currently available. Alternatively or in addition, Compositions including one or more mRNA antigens and one or more mRNA adjuvants can serve as a platform for inducing immunological tolerance to a subject to one or more allergens, such as food allergens and environmental allergens. In some forms, the recipient subject has a disease or disorder, or has been identified as being at increased risk of getting a disease or disorder. For example, in some form, the subject has cancer, or has been identified as being at increased risk of getting a cancer. In other forms, the subject has an infectious disease, or has been identified as being at increased risk of getting an infectious disease. a. Cancer In certain forms, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be used to immunize a subject against cancer. In some forms, the methods treat or prevent cancer or other proliferative diseases or disorders in a subject identified as having, or at risk of having cancer or other proliferative disease or disorder. Cancer is a disease of genetic instability, allowing a cancer cell to acquire the hallmarks proposed by Hanahan and Weinberg, including (i) self-sufficiency in growth signals; (ii) insensitivity to anti-growth signals; (iii) evading apoptosis; (iv) sustained angiogenesis; (v) tissue 455738066.1 62 invasion and metastasis; (vi) limitless replicative potential; (vii) reprogramming of energy metabolism; and (viii) evading immune destruction (Cell.,144:646–674, (2011)). Tumors, which can be treated in accordance with the disclosed methods, are classified according to the embryonic origin of the tissue from which the tumor is derived. Carcinomas are tumors arising from endodermal or ectodermal tissues such as skin or the epithelial lining of internal organs and glands. Sarcomas, which arise less frequently, are derived from mesodermal connective tissues such as bone, fat, and cartilage. The leukemias and lymphomas are malignant tumors of hematopoietic cells of the bone marrow. Leukemias proliferate as single cells, whereas lymphomas tend to grow as tumor masses. Malignant tumors may show up at numerous organs or tissues of the body to establish a cancer. In some forms, the compositions including one or more mRNA antigens and one or more mRNA adjuvants are administered to a subject diagnosed with cancer (i.e., as a therapeutic vaccine), or to a subject having a predisposition or risk of developing cancer (i.e., as a prophylactic vaccine). In some forms, the compositions of compositions including one or more mRNA antigens and one or more mRNA adjuvants are administered to a cancer patient in addition to one or more additional therapeutic agents. In an exemplary cancer therapy, bioinformatics is used to sequence each patient’s unique tumor exome to identify neoantigens. Then, corresponding mRNAs of these neoantigens are used to generate the antigens necessary to create immunity. Finally, these mRNAs are delivered using the described methods to activate the immune system in order to create durable and long- term protection against new tumor growth and metastases. The disclosed compositions and methods of treatment thereof are generally suited for treatment of carcinomas, sarcomas, lymphomas and leukemias. The described compositions and methods are useful for treating, or alleviating subjects having benign or malignant tumors by delaying or inhibiting the growth / proliferation or viability of tumor cells in a subject, reducing the number, growth or size of tumors, inhibiting or reducing metastasis of the tumor, and / or inhibiting or reducing symptoms associated with tumor development or growth. The types of cancer that can be treated with the provided compositions and methods include, but are not limited to, cancers such as vascular cancer such as multiple myeloma, adenocarcinomas and sarcomas, of bone, bladder, brain, breast, cervical, colorectal, esophageal, kidney, liver, lung, nasopharangeal, pancreatic, prostate, skin, stomach, and uterine. In some forms, the compositions are used to treat multiple cancer types concurrently. The compositions can also be used to treat metastases or tumors at multiple locations. In some forms, the compositions including one or more mRNA antigens and one or more mRNA adjuvants include one or more tumor antigens or one or more nucleic acids expressing a 455738066.1 63 tumor antigen. The compositions including one or more mRNA antigens and one or more mRNA adjuvants can be used to provide immunity and therapeutic activity against tumor cells and non-tumor cells located within a tumor or a tumor environment. Compositions including one or more mRNA antigens and one or more mRNA adjuvants can be formulated to provide protective and / or therapeutic activity against solid tumors and cancers of the blood. Exemplary tumor cells include, but are not limited to, tumor cells of cancers, including leukemias including, but not limited to, acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemias such as myeloblastic, promyelocytic, myelomonocytic, monocytic, erythroleukemia leukemias and myelodysplastic syndrome, chronic leukemias such as but not limited to, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, hairy cell leukemia; polycythemia vera; lymphomas such as, but not limited to, Hodgkin’s disease, non-Hodgkin’s disease; multiple myelomas such as, but not limited to, smoldering multiple myeloma, non-secretory myeloma, osteosclerotic myeloma, plasma cell leukemia, solitary plasmacytoma and extramedullary plasmacytoma; Waldenström’s macroglobulinemia; monoclonal gammopathy of undetermined significance; benign monoclonal gammopathy; heavy chain disease; bone and connective tissue sarcomas such as, but not limited to, bone sarcoma, osteosarcoma, chondrosarcoma, Ewing’s sarcoma, malignant giant cell tumor, fibrosarcoma of bone, chordoma, periosteal sarcoma, soft- tissue sarcomas, angiosarcoma (hemangiosarcoma), fibrosarcoma, Kaposi’s sarcoma, leiomyosarcoma, liposarcoma, lymphangiosarcoma, neurilemmoma, rhabdomyosarcoma, synovial sarcoma; brain tumors including, but not limited to, glioma, astrocytoma, brain stem glioma, ependymoma, oligodendroglioma, nonglial tumor, acoustic neurinoma, craniopharyngioma, medulloblastoma, meningioma, pineocytoma, pineoblastoma, primary brain lymphoma; breast cancer including, but not limited to, adenocarcinoma, lobular (small cell) carcinoma, intraductal carcinoma, medullary breast cancer, mucinous breast cancer, tubular breast cancer, papillary breast cancer, Paget’s disease, and inflammatory breast cancer; adrenal cancer, including, but not limited to, pheochromocytom and adrenocortical carcinoma; thyroid cancer such as but not limited to papillary or follicular thyroid cancer, medullary thyroid cancer and anaplastic thyroid cancer; pancreatic cancer, including, but not limited to, insulinoma, gastrinoma, glucagonoma, vipoma, somatostatin-secreting tumor, and carcinoid or islet cell tumor; pituitary cancers including, but not limited to, Cushing’s disease, prolactin-secreting tumor, acromegaly, and diabetes insipius; eye cancers including, but not limited to, ocular melanoma such as iris melanoma, choroidal melanoma, and cilliary body melanoma, and retinoblastoma; vaginal cancers, including, but not limited to, squamous cell carcinoma, adenocarcinoma, and melanoma; vulvar cancer, including, but not limited to, squamous cell carcinoma, melanoma, adenocarcinoma, basal cell carcinoma, sarcoma, and Paget’s disease; 455738066.1 64 cervical cancers including, but not limited to, squamous cell carcinoma, and adenocarcinoma; uterine cancers including, but not limited to, endometrial carcinoma and uterine sarcoma; ovarian cancers including, but not limited to, ovarian epithelial carcinoma, borderline tumor, germ cell tumor, and stromal tumor; esophageal cancers including, but not limited to, squamous cancer, adenocarcinoma, adenoid cyctic carcinoma, mucoepidermoid carcinoma, adenosquamous carcinoma, sarcoma, melanoma, plasmacytoma, verrucous carcinoma, and oat cell (small cell) carcinoma; stomach cancers including, but not limited to, adenocarcinoma, fungating (polypoid), ulcerating, superficial spreading, diffusely spreading, malignant lymphoma, liposarcoma, fibrosarcoma, and carcinosarcoma; colon cancers; rectal cancers; liver cancers including, but not limited to, hepatocellular carcinoma and hepatoblastoma, gallbladder cancers including, but not limited to, adenocarcinoma; cholangiocarcinomas including, but not limited to, papillary, nodular, and diffuse; lung cancers including, but not limited to, non-small cell lung cancer, squamous cell carcinoma (epidermoid carcinoma), adenocarcinoma, large-cell carcinoma and small-cell lung cancer; testicular cancers including, but not limited to, germinal tumor, seminoma, anaplastic, classic (typical), spermatocytic, nonseminoma, embryonal carcinoma, teratoma carcinoma, choriocarcinoma (yolk-sac tumor), prostate cancers including, but not limited to, adenocarcinoma, leiomyosarcoma, and rhabdomyosarcoma; penal cancers; oral cancers including, but not limited to, squamous cell carcinoma; basal cancers; salivary gland cancers including, but not limited to, adenocarcinoma, mucoepidermoid carcinoma, and adenoidcystic carcinoma; pharynx cancers including, but not limited to, squamous cell cancer, and verrucous; skin cancers including, but not limited to, basal cell carcinoma, squamous cell carcinoma and melanoma, superficial spreading melanoma, nodular melanoma, lentigo malignant melanoma, acral lentiginous melanoma; kidney cancers including, but not limited to, renal cell cancer, adenocarcinoma, hypernephroma, fibrosarcoma, transitional cell cancer (renal pelvis and / or uterer); Wilms’ tumor; bladder cancers including, but not limited to, transitional cell carcinoma, squamous cell cancer, adenocarcinoma, carcinosarcoma. Cancers that can be prevented, treated or otherwise diminished by the Compositions including one or more mRNA antigens and one or more mRNA adjuvants include myxosarcoma, osteogenic sarcoma, endotheliosarcoma, lymphangioendotheliosarcoma, mesothelioma, synovioma, hemangioblastoma, epithelial carcinoma, cystadenocarcinoma, bronchogenic carcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, and gastric cancer (for a review of such disorders, see Fishman et al., 1985, Medicine, 2d Ed., J.B. Lippincott Co., Philadelphia and Murphy et al., 1997, Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery, Viking Penguin, Penguin Books U.S.A., Inc., United States of America). In some forms, Compositions including one or more mRNA 455738066.1 65 antigens and one or more mRNA adjuvants can be used to immunize a subject against one or more cancers for which no alternative vaccine is available. b. Infectious Diseases Compositions including one or more mRNA antigens and one or more mRNA adjuvants can deliver antigens to the APC of a subject in an amount effective to vaccinate the subject from one or more infectious diseases caused by a wide variety of microbial pathogens, such as bacterial, viral, fungal and protozoan pathogens. In some forms, the target of the vaccine could be any of a large number of microbial pathogens. Exemplary diseases that can be vaccinated against include disease for which vaccines are currently available, including Anthrax; Diseases (e.g., cervical cancer, cancer of the esophagus) caused by Human Papillomavirus (HPV); Diphtheria; Hepatitis A; Hepatitis B; Haemophilus influenzae type b (Hib); Influenza viruses (Flu); Japanese encephalitis (JE); Lyme disease; Measles; Meningococcal; Monkeypox; Mumps; Pertussis; Pneumococcal; Polio; Rabies; Rotavirus; Rubella; Shingles (Herpes Zoster); Smallpox; Tetanus; Toxoplasmosis; Typhoid; Tuberculosis (TB); Varicella (Chickenpox); Yellow Fever. In some forms, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be used to immunize a subject against an infectious disease or pathogen, for example, for vaccination against an infectious disease or pathogen to which no alternative vaccine is available / Exemplary diseases include, but are not limited to, malaria, streptococcus, Ebola Zaire, HIV, Herpes virus, hepatitis C, Middle East Respiratory Syndrome (MERS), Sleeping sickness, Severe Acute Respiratory Syndrome (SARS), rhinovirus, chicken pox, Hendra, NIPA virus, Zika Virus, and others. In some forms, the disease is a pathogen that infects non-mammalian subjects, such as birds. Exemplary avian subjects include domesticated birds (i.e., poultry), such as chickens, ducks, geese, pheasants and other commercial fowl, or pet birds such as parakeets and parrots. For example, bacterial hybrid vectors can be useful to vaccinate birds against Infectious Bursal Disease (IBD). IBD, also known as Gumboro disease, a viral disease affecting the Bursa of Fabricius of young chickens. Other diseases and disorders of poultry that can be vaccinated for using the described bacterial hybrid vectors include Influenza, Ranikhet; Mareks disease, fowl pox, fowl cholera, egg drope syndrome, infectious coryza, coccidiosis, avian encephalitis, avian influenza, chicken infectious anemia and salmonella. c. Tolerance This approach can also be used in autoimmunity or autoinflammatory disease or allergy, in this case providing antigen in the context of explicitly tolerizing signals (e.g. in the case of MS providing myelin sheath protein along with regulatory T cell development signals such as 455738066.1 66 TGFbeta or IL-10). The idea of tolerizing mRNA vaccines is known in the art with a focus on the tolerogenic properties of nanoparticles and the mRNA itself, rather than programming the expansion of tolerogenic immune populations via adjuvant mRNA signals (Krienke, et al., Science 371, 145–153 (2021)). Thus, the compositions and methods disclosed herein may also be used to promote tolerance. Tolerogenic therapy aims to induce immune tolerance where there is pathological or undesirable activation of the normal immune response. Such embodiments may also include co- administration of an immunosuppressive agent such as rapamycin. Tolerogenic vaccines deliver antigens with the purpose of suppressing immune responses (e.g., induce or increase a suppressive immune response) and promoting robust long-term antigen-specific immune tolerance. For example, Incomplete Freund’s Adjuvant (IFA) mixed with antigenic peptides stimulates Treg proliferation (and / or accumulation) and IFA / Insulin peptide prevents type I diabetes onset in susceptible mice, though this approach is ineffective in reversing early onset type I diabetes (Fousteri, G., et al., 53:1958-1970 (2010)). The compositions and methods disclosed herein are also useful for controlling the immune response to an antigen. For example, in some embodiments, the compositions are used as part of a tolerizing vaccine. In certain embodiments, the disclosed compositions are used to treat an inflammatory response or autoimmune disorder in a subject. For example, the disclosed methods can be used to prophylactically or therapeutically inhibit, reduce, alleviate, or permanently reverse one or more symptoms of an inflammatory response or autoimmune disorder. An inflammatory response or autoimmune disorder can be inhibited or reduced in a subject by administering to the subject an effective amount of a composition in vivo, or cells modulated by the composition ex vivo. Representative inflammatory responses and autoimmune diseases that can be inhibited or treated include, but are not limited to, rheumatoid arthritis, systemic lupus erythematosus, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison’s disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome (alps), autoimmune thrombocytopenic purpura (ATP), Bechet’s disease, bullous pemphigoid, cardiomyopathy, celiac sprue-dermatitis, chronic fatigue syndrome immune deficiency, syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, cicatricial pemphigoid, cold agglutinin disease, Crest syndrome, Crohn’s disease, Dego’s disease, dermatomyositis, dermatomyositis – juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia – fibromyositis, grave’s disease, Guillain-barre, Hashimoto’s thyroiditis, idiopathic pulmonary fibrosis, idiopathic thrombocytopenia purpura 455738066.1 67 (ITP), Iga nephropathy, insulin dependent diabetes (Type I), juvenile arthritis, Meniere’s disease, mixed connective tissue disease, multiple sclerosis, myasthenia gravis, pemphigus vulgaris, pernicious anemia, polyarteritis nodosa, polychondritis, polyglancular syndromes, polymyalgia rheumatica, polymyositis and dermatomyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, Raynaud’s phenomenon, Reiter’s syndrome, rheumatic fever, sarcoidosis, scleroderma, Sjogren’s syndrome, stiff-man syndrome, Takayasu arteritis, temporal arteritis / giant cell arteritis, ulcerative colitis, uveitis, vasculitis, vitiligo, and Wegener’s granulomatosis. In certain forms, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be used to immunize a subject against an allergen. The compositions and methods can therefore be tolerogenic vaccines. The compositions including one or more mRNA antigens and one or more mRNA adjuvants can be administered to a subject diagnosed with an allergy or to a subject having a predisposition to an allergy. In some forms, the compositions of compositions including one or more mRNA antigens and one or more mRNA adjuvants are administered to a patient having an allergy in addition to one or more additional therapeutic agents. Allergies are abnormal reactions of the immune system that occur in response to otherwise harmless substances. An allergy is a type of immune reaction in which the immune system responds to foreign microorganisms or particles by producing specific antibodies capable of binding to allergens such as pollen, dust, animal hairs, etc. Allergic reactions that can be treated include delayed hypersensitivity reactions and immediate hypersensitivity reactions. Allergies that can be treated include allergic responses in the skin, such as dermatitis, the upper airways and eyes, such as allergic rhinitis, hay fever, asthma, and conjunctivitis (pink eye) in the gastrointestinal tract, such as food allergies, and blood stream, such as urticaria and hives, angioedema, anaphylaxis, or atopic dermatitis. B. Methods of Administration The described mRNA compositions, including nanoparticles encapsulating the mRNAs can be formulated into compositions including suitable excipient for administering the nanoparticles into the body of a subject. In certain forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, are formulated in a carrier or excipient suitable for delivery into a subject by injection, for example, via intramuscular (i.m.) intravenous (i.v.), subcutaneous (s.c.), intraperitoneal (i.p.), or via skin scarification. Typical carriers are saline, phosphate buffered saline, glucose solutions, and other injectable carriers. 455738066.1 68 Therefore, formulations including mRNA compositions, with or without delivery vehicles such as nanoparticles encapsulating the mRNAs are described. The mRNA compositions, including nanoparticles encapsulating the mRNAs, can be formulated into pharmaceutical compositions including one or more pharmaceutically acceptable carriers. Pharmaceutical compositions can be formulated for different mechanisms of administration, according to the desired purpose of the mRNA composition, including nanoparticles encapsulating the mRNAs, and the intended use. Pharmaceutical compositions formulated for administration by parenteral (intramuscular, intraperitoneal, intravenous (IV), intraocular or subcutaneous injection), topical or transdermal (either passively or using iontophoresis or electroporation) routes of administration or using bioerodible inserts are described. In some forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, are formulated for administration in an aqueous solution, by parenteral injection. The formulation may also be in the form of a suspension or emulsion. In general, pharmaceutical compositions are provided including effective amounts of an active agent, targeting moiety, and optional a delivery vehicle and optionally include pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, and / or carriers. Such compositions include the diluents sterile water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength and optionally additives such as detergents and solubilizing agents (e.g., TWEEN® 20, TWEEN® 80 also referred to as polysorbate 20 or 80), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol). Examples of non-aqueous solvents or vehicles are propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. The formulations may be lyophilized and redissolved / resuspended immediately before use. The formulation may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating the compositions. Compositions of mRNA compositions, including nanoparticles encapsulating the mRNAs, can be formulated for application topically, by instillation or by inhalation. In some forms, mRNA compositions, including nanoparticles encapsulating the mRNAs, are formulated for administration to the mucosa, such as the lungs, mouth, eyes, lungs, nasal, oral (sublingual, buccal), vaginal, or rectal mucosa. Formulations for administration to the mucosa will typically be spray dried drug particles, which may be incorporated into a tablet, gel, capsule, suspension or emulsion. Standard pharmaceutical excipients are available from any formulator. In some forms, the mRNA compositions, including nanoparticles encapsulating the mRNAs are formulated for delivery to the skin, for example, by direct application to the surface 455738066.1 69 of diseased, or damaged or ruptured skin. Therefore, in some forms, mRNA compositions, including nanoparticles encapsulating the mRNAs are formulated for delivery to a wound or site of surgery. Compositions formulated for topical delivery can include one or more penetration enhancers. In one form, the mRNA compositions, including nanoparticles encapsulating the mRNAs are formulated for pulmonary delivery, such as intranasal administration or oral inhalation. The respiratory tract is the structure involved in the exchange of gases between the atmosphere and the blood stream. The upper and lower airways are called the conducting airways. The terminal bronchi divide into respiratory bronchiole, which then lead to the ultimate respiratory zone, the alveoli, or deep lung. The deep lung, or alveoli, is the primary target of inhaled therapeutic aerosols for systemic drug delivery. Therapeutic agents that are active in the lungs can be administered systemically and targeted via pulmonary absorption. The term aerosol refers to any preparation of a fine mist of particles, which can be in solution or a suspension, whether or not it is produced using a propellant. Aerosols can be produced using standard techniques, such as ultra-sonication or high-pressure treatment. Carriers for pulmonary formulations can be divided into those for dry powder formulations and for administration as solutions. Aerosols for the delivery of therapeutic agents to the respiratory tract are known in the art. For administration via the upper respiratory tract, the formulation can be formulated into a solution, e.g., water or isotonic saline, buffered or un- buffered, or as a suspension, for intranasal administration as drops or as a spray. Preferably, such solutions or suspensions are isotonic relative to nasal secretions and of about the same pH, ranging e.g., from about pH 4.0 to about pH 7.4 or, from pH 6.0 to pH 7.0. Buffers should be physiologically compatible and include, simply by way of example, phosphate buffers. One skilled in the art can readily determine a suitable saline content and pH for an innocuous aqueous solution for nasal and / or upper respiratory administration. Compositions can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns. Dry powder formulations (“DPFs”) with large particle size have improved flowability characteristics, such as less aggregation, easier aerosolization, and potentially less phagocytosis. Dry powder aerosols for inhalation therapy are generally produced with mean diameters primarily in the range of less than 5 microns, although a preferred range is between one and ten microns in aerodynamic diameter. Large “carrier” particles (containing no drug) have been co- delivered with therapeutic aerosols to aid in achieving efficient aerosolization among other possible benefits. A wide range of mechanical devices designed for pulmonary delivery of 455738066.1 70 therapeutic products can be used, including, but not limited to, nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art. In some forms, the described methods administer a composition to the patient via intramuscular, intravenous, subcutaneous or intraperitoneal injection. C. Dosages and Effective Amounts In some in vivo approaches, the compositions of Compositions including one or more mRNA antigens and one or more mRNA adjuvants are administered to a subject in a therapeutically effective amount. The term “effective amount” or “therapeutically effective amount” means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of the disorder being treated or to otherwise provide a desired pharmacologic and / or physiologic effect. The precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease or disorder, and the treatment being effected. For all of the compounds described, as further studies are conducted, information will emerge regarding appropriate dosage levels for treatment of various conditions in various patients, and the ordinary skilled worker, considering the therapeutic context, age, and general health of the recipient, will be able to ascertain proper dosing. The selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired. Generally dosage levels of between 0.001 and 100 mg / kg of body weight daily are administered to subjects such as mammals, most preferably, humans. Generally, for intravenous injection or infusion, dosage may be lower. Preferably, the compositions are formulated to achieve a modified prokaryotic cell serum level of between about 1 and about 1,000 µM. It has been established that an effective dose range (total mRNA content antigen + adjuvant) in mice is from about 10 µg to about 30 µg, inclusive per dose, with a preferred dose of about 15 µg. In some forms, a dosage effective in humans is from about 100 µg per dose to about 500 µg per dose, inclusive. In some forms, the effective dose of the described synthetic mRNA(s) is an amount equivalent to the amount of an approved mRNA therapeutic. For example, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be in an amount effective to deliver antigen to a subject and induce the proliferation and clonal expansion of B cells, T cells or induce the migratory or chemotactic activity of macrophages. Therefore, in some forms, the compositions including one or more mRNA antigens and one or more mRNA adjuvants including encapsulated agent are in an amount effective to stimulate a primary immune response to an antigen in a subject. In a preferred form the effective amount of compositions including one or more mRNA antigens and 455738066.1 71 one or more mRNA adjuvants does not induce significant cytotoxicity in the cells of a subject compared to an untreated control subject. Preferably, the amount of compositions including one or more mRNA antigens and one or more mRNA adjuvants is effective to prevent or reduce the infection or onset of a disease or disorder in a subject compared to an untreated control. In another form, the compositions including one or more mRNA antigens and one or more mRNA adjuvants are in an amount effective to decrease the amount of expression of a target gene, or to prevent or decrease the serum concentration of a target gene product in a subject. In a particular form, compositions including one or more mRNA antigens and one or more mRNA adjuvants are in an amount effective to induce presentation of an antigen by antigen-presenting cells. For example, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be in an amount effective to induce T cell activation in response to an exogenous polypeptide encoded by a gene delivered to the cells of a subject by the compositions including one or more mRNA antigens and one or more mRNA adjuvants. In a further form, the one or more compositions including one or more mRNA antigens and one or more mRNA adjuvants are in an amount effective to decrease the amount of antigen required to stimulate a robust or protective immune response to the antigen in a subject. The compositions including one or more mRNA antigens and one or more mRNA adjuvants can be effective to induce the production or antibodies to an antigen encoded by the compositions including one or more mRNA antigens and one or more mRNA adjuvants. Thus, the compositions including one or more mRNA antigens and one or more mRNA adjuvants can be effective to enhance the amount of antigen-specific immune cells in a subject. For example the amount of antigen-specific immune cells in a subject can be increased relative to the amount in an untreated control. For example, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be effective to induce several signaling pathways controlling cellular immune activities, including cellular proliferation, chemotaxis and actin reorganization. Preferably the effective amount of compositions including one or more mRNA antigens and one or more mRNA adjuvants does not cause cytotoxicity. The effective amount of compositions including one or more mRNA antigens and one or more mRNA adjuvants to provide adaptive immunity to an encoded antigen or allergen should not generate a significant systemic increase in inflammatory cytokine production, including IFN. In some forms, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be used to immunize a subject against a cancer, an infectious disease or an allergen using only a single dose. Therefore, in some forms, only a single administration is required with no boosting. In other forms, enhanced or prolonged immunity, such as protective 455738066.1 72 immunity, is achieved when one or more additional doses are used to boost the immune response to a first or previous administration. Typically, the absence of a cytokine response to the nanoparticle delivery vehicles in vivo precludes the development of anti-vector immunity. Therefore, in some forms, administration of compositions including one or more mRNA antigens and one or more mRNA adjuvants can be carried out repeatedly using the same or different doses of the compositions including one or more mRNA antigens and one or more mRNA adjuvants containing the same or different RNAs encoding antigens, for example, to provide immunity to a variety of different antigens or allergens in the same subject. D. Combination Therapies Compositions including one or more mRNA antigens and one or more mRNA adjuvants can be administered alone, or in combination with one or more additional active agent(s), as part of a therapeutic or prophylactic treatment regime. The compositions including one or more mRNA antigens and one or more mRNA adjuvants can be administered on the same day, or a different day than the second active agent. For example, compositions including one or more mRNA antigens and one or more mRNA adjuvants can be administered on the first, second, third, or fourth day, or combinations thereof. The term “combination” or “combined” is used to refer to either concomitant, simultaneous, or sequential administration of two or more agents. Therefore, the combinations can be administered either concomitantly (e.g., as an admixture), separately but simultaneously (e.g., via separate intravenous lines into the same subject), or sequentially (e.g., one of the compounds or agents is given first followed by the second). In some forms, the additional prophylactic or therapeutic agents can be vaccines for a specific antigen. The antigen can be the same or different to that encoded by the compositions including one or more mRNA antigens and one or more mRNA adjuvants. In some forms, the compositions including one or more mRNA antigens and one or more mRNA adjuvants are useful as an agent to enhance the immune response to an antigen in a subject relative to the immune response raised to the same antigen in the absence of the nanoparticle delivery vehicles. When compositions including one or more mRNA antigens and one or more mRNA adjuvants are used to induce an immune response, for example, to one or more antigens or allergens encoded by RNA encapsulated within the compositions including one or more mRNA antigens and one or more mRNA adjuvants, the administration of an effective amount of the compositions including one or more mRNA antigens and one or more mRNA adjuvants does not require the co-administration of an adjuvant to elicit the desired immune response. Therefore, in 455738066.1 73 some forms, the compositions including one or more mRNA antigens and one or more mRNA adjuvants are administered in the absence of an adjuvant, or immuno-stimulatory molecule. E. Controls The effect of compositions including one or more mRNA antigens and one or more mRNA adjuvants can be compared to a control. Suitable controls are known in the art and include, for example, untreated cells or an untreated subject. In some forms, the control is untreated tissue from the subject that is treated, or from an untreated subject. Preferably the cells or tissue of the control are derived from the same tissue as the treated cells or tissue. In some forms, an untreated control subject suffers from, or is at risk from the same disease or condition as the treated subject. For example, in some forms, an untreated control subject does not raise an immune response to an antigen. Any of the results relating to the described compositions and methods can be compared to a control, such as a subject vaccinated with a different antigens / adjuvants or combination of antigens and adjuvants using the same or different delivery vehicles, same or different protocol, vaccination schedule or administration. In some forms, a suitable control is an unvaccinated subject. The described compositions and methods will be better understood in view of the following numbered paragraphs. 1. A synthetic messenger ribonucleic acid (mRNA) molecule including (a) one or more ribonucleic acid sequences encoding one or more peptide antigen(s); and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvant(s) and / or other immuno-modulatory agent, wherein the ribonucleic acid is configured to express the peptide antigen(s) and the peptide adjuvant(s) and / or other immuno-modulatory agent(s) as distinct polypeptides within a mammalian cell. 2. The synthetic mRNA molecule of paragraph 1, wherein the one or more ribonucleic acid sequences encoding one or more peptide antigen(s) further include a ribonucleic acid sequence encoding a polypeptide targeting motif, wherein the polypeptide targeting motif enhances binding, uptake or processing of the antigen by an antigen presenting cell (APC). 3. The synthetic mRNA molecule of paragraph 2, wherein one or more ribonucleic acid sequences encoding a peptide antigen(s) is fused with the sequence encoding a polypeptide targeting motif, and 455738066.1 74 wherein an amino-terminus of the peptide antigen is coupled to a carboxyl terminus of the targeting motif. 4. The synthetic mRNA molecule of any one of paragraphs 2-3, wherein the polypeptide targeting motif includes a Clec9a binding motif. 5. The synthetic mRNA molecule of any one of paragraphs 2-4, wherein the polypeptide targeting motif includes an amino acid sequence WPRFHSSVRHTH (SEQ ID NO:23). 6. The synthetic mRNA of any one of paragraphs 1-5, wherein the ribonucleic acid sequence(s) encoding each of the antigen(s) or targeting motif(s), and each of the ribonucleic acid sequence(s) encoding the adjuvant(s) and / or other immuno-modulatory agent(s) are connected via one or more cleavable linker(s). 7. The synthetic mRNA of paragraph 6, wherein the one or more linker(s) include a P2A linker and a Furin cleavage site, and wherein the Furin cleavage site excludes the linker amino acids. 8. The synthetic mRNA of paragraph 7, wherein the Furin cleavage site and the P2A linker are joined by a linker including amino acid residues GSG. 9. The synthetic mRNA of any one of paragraphs 1-8, including a single 5’ Cap 1 structure. 10. The synthetic mRNA of any one of paragraphs 1-8, including a poly Adenylated 3’ tail structure. 11. The synthetic mRNA of any one of paragraphs 1-10, including a single 5’ untranslated region (5’ UTR). 12. The synthetic mRNA of any one of paragraphs 1-11, including a single 3’ untranslated region (3’ UTR). 13. The synthetic mRNA of paragraph 1 or 2, including from 5’ to 3’ (i) a 5’Cap 1 structure; (ii) a 5’untranslated region (5’UTR); (iii) a sequence encoding a first polypeptide; (iv) a first Furin cleavage sequence; (v) a first P2A linker sequence; (vi) a sequence encoding a second polypeptide; (vii) a 3’untranslated region (3’UTR); and (viii) a poly Adenylated 3’tail; wherein one of the first or the second polypeptide encodes the peptide antigen and optionally a targeting motif; and wherein one of the first or the second polypeptide encodes a peptide adjuvant or other immuno-modulatory agent. 455738066.1 75 14. The synthetic mRNA of paragraph 1 or 2, including from 5’ to 3’ (i) a 5’ Cap 1 structure; (ii) a 5’untranslated region (5’ UTR); (iii) a sequence encoding a first polypeptide; (iv) a first Furin cleavage sequence; (v) a first P2A linker sequence; (vi) a sequence encoding a second polypeptide; (vii) a second Furin cleavage sequence; (viii) a second P2A linker sequence; (ix) a sequence encoding a third polypeptide; (x) a 3’untranslated region (3’ UTR); and (xi) a poly Adenylated 3’ tail; wherein the first or the second polypeptide encodes a first peptide antigen and optionally a targeting motif, wherein the first or the second polypeptide encodes a first peptide adjuvant and / or other immuno-modulatory agent, and wherein the third polypeptide encodes a second peptide adjuvant and / or other immuno- modulatory agent, or a second peptide antigen. 15. A nanoparticle including the synthetic mRNA of any one of paragraphs 1-14. 16. The nanoparticle of paragraph 15, wherein the synthetic mRNA is encapsulated within the nanoparticle. 17. A cell including the nanoparticle of paragraph 15 or 16. 18. A synthetic nanoparticle for the delivery of therapeutic and / or prophylactic agents to a subject, including: (a) one or more ribonucleic acid sequences encoding one or more peptide antigen(s); and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvant(s) and / or other immuno-modulatory agent(s); wherein the ribonucleic acids are encapsulated within the nanoparticle. 19. The nanoparticle of paragraph 18, wherein the one or more ribonucleic acid sequences encoding the one or more antigen(s) and the one or more adjuvant(s) and / or other immuno- modulatory agent(s) are included within the same ribonucleic acid. 20. The synthetic mRNA of any one of paragraphs 1-14 or the nanoparticle of any one of paragraphs 15-16 or 18-19 wherein the ribonucleic acid sequence(s) includes between approximately 100 and 15,000 bases, inclusive. 455738066.1 76 21. The synthetic mRNA of any one of paragraphs 1-14, or 20, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein the ribonucleic acid sequence(s) encode two or more species of protein antigens. 22. The synthetic mRNA of any one of paragraphs 1-14, or 20-21, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein the ribonucleic acid sequence(s) encode two or more species of protein adjuvants and / or other immuno-modulatory agents. 23. The synthetic mRNA of any one of paragraphs 1-14, or 20-22, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from a source selected from the group including an infectious agent, a parasite, a cancer and a peptide allergen. 24. The synthetic mRNA of any one of paragraphs 1-14 or 20-23, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from an infectious agent selected from the group including a virus, a fungi, a protozoan and a bacterium. 25. The synthetic mRNA of any one of paragraphs 1-14 or 20-24, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from a virus. 26. The synthetic mRNA of any one of paragraphs 1-14 or 20-25, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from a virus selected from the group including a filovirus, an arenavirus, a coronavirus an orthopoxvirus and an orthomyxovirus. 27. The synthetic mRNA of any one of paragraphs 1-14 or 20-26, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from a virus selected from the group including Merkel Cell Polyomavirus (MCPyV), Influenza virus, Ebola virus, Zika Virus, and SARS-Cov-2. 28. The synthetic mRNA of any one of paragraphs 1-14 or 20-27, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from a fungus. 29. The synthetic mRNA of any one of paragraphs 1-14 or 20-28, or the nanoparticle of any one of paragraphs 15-16 or 18-19, wherein one or more peptide antigen(s) is derived from a fungus selected from the group including Candida albicans, Aspergillus fumigatus, Candida auris, Cryptococcus neoformans, and Candida glabrata. 30. The synthetic mRNA of any one of paragraphs 1-14 or 20-29, or the nanoparticle of any one of paragraphs 15-16 or 18-29, wherein one or more peptide antigen(s) is derived from a cancer. 455738066.1 77 31. The synthetic mRNA of any one of paragraphs 1-10 or 16-30, or the nanoparticle of any one of paragraphs 15-16 or 18-30, wherein one or more peptide antigen(s) is derived from a cancer selected from the group including alpha-actinin-4, Alphafetoprotein (AFP), Bcr-Abl fusion protein, Carcinoembryonic antigen (CEA), CA-125, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, epithelial tumor antigen, EF2, ETV6-AML1 fusion protein, LDLR-fucosyltransferaseAS fusion protein, HLA-A2, HLA-A11, hsp70-2, KIAAO205, Mart2, Mum-1, 2, and 3, neo-PAP, myosin class I, OS-9, pml-RARa fusion protein, PTPRK, K- ras, N-ras, Triosephosphate isomeras, Bage-1, Gage 3,4,5,6,7, GnTV, Herv-K-mel, Lage-1, Melanoma-associated antigen (MAGE);Mage-A1,2,3,4,6,10,12, Mage-C2, NA-88, NY-Eso- 1 / Lage-2, SP17, SSX-2, and TRP2-Int2, MelanA (MART-I), gp100 (Pmel 17), tyrosinase, TRP- 1, TRP-2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, p15(58), CEA, RAGE, NY-ESO (LAGE), SCP-1, Hom / Mel-40, PRAME, p53, H-Ras, HER-2 / neu, BCR-ABL, E2A-PRL, H4- RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus (HPV) antigens E6 and E7, TSP-180, MAGE-4, MAGE-5, MAGE-6, p185erbB2, p180erbB-3, c-met, nm-23H1, PSA, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, b-Catenin, CDK4, Mum-1, p16, TAGE, PSMA, PSCA, CT7, telomerase, 43-9F, 5T4, 791Tgp72, a-fetoprotein, 13HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, G250, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7-Ag, MOV18, MUC-1, NB\70K, NY-CO-1, RCAS1, SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated protein), TAAL6, TAG72, TLP, tyrosinase, and TPS. 32. The synthetic mRNA of any one of paragraphs 1-14 or 20-31, or the nanoparticle of any one of paragraphs 15-16 or 18-31, wherein one or more peptide antigen(s) is derived from a bacterium selected from the group including Bacillus, Yersinia, Spirochetes, Rickettsia, Staphylococcus aureus, and Escherichia coli. 33. The synthetic mRNA of any one of paragraphs 1-14 or 20-32, or the nanoparticle of any one of paragraphs 15-16 or 18-32, wherein one or more peptide antigen(s) is tolerogenic antigen, optionally derived from an allergen. 34. The synthetic mRNA of any one of paragraphs 1-14 or 20-33, or the nanoparticle of any one of paragraphs 15-16 or 18-33, wherein one or more peptide antigen(s) is derived from a protozoan. 35. The synthetic mRNA of any one of paragraphs 1-14 or 20-34, or the nanoparticle of any one of paragraphs 15-16 or 18-34, wherein one or more peptide adjuvants is selected from the group including a cytokine, a TLR agonist, a pattern recognition receptor, a chemotactic factor, and a transcriptional regulator. 455738066.1 78 36. The synthetic mRNA of any one of paragraphs 1-14 or 20-35, or the nanoparticle of any one of paragraphs 15-16 or 18-35, wherein the cytokine is selected from the group including IL- 2, IL-7, and IL-15. 37. The synthetic mRNA of any one of paragraphs 1-14 or 20-36, or the nanoparticle of any one of paragraphs 15-16 or 18-36, wherein the other immuno-modulatory agent is selected from the group including IL-2, IL-7, IL-15, ICAM-1, LFA-1, CD2, LFA3 (CD58), CD28, CD152 CD80, CD86, class I MHC, class II MHC, CD40L, Flt3L, Flt3, OX40, OX40L, GITR, CD137, PD1, TIGIT, TIM3, LAG3, and CLec9-targeting agents or a combination thereof. 38. A cell including the nanoparticle of any one of paragraphs 15-16 or 18-37. 39. A pharmaceutical composition including the synthetic mRNA of any one of paragraphs 1-10 or the nanoparticle of any one of 15-16 or 18-37 and a pharmaceutically acceptable excipient. 40. The pharmaceutical composition of paragraph 39, further including one or more additional active agents. 41. A method of inducing an immune response to a peptide antigen in a subject including administering to the subject the pharmaceutical composition of paragraph 39 or 40 in an amount effective to induce or stimulate an immune response in the subject to the peptide antigen(s). 42. The method of paragraph 41, wherein the immune response to the peptide antigen(s) is effective to treat or prevent an infection and / or disease in the subject caused by the organism or agent from which the antigen is derived. 43. The method of paragraph 41 or 42, wherein the antigen is a tumor antigen. 44. The method of paragraph 43, wherein the tumor antigen is an autologous tumor antigen. 45. The method of paragraph 41 or 42, wherein the antigen is derived from a pathogenic bacterium. 46. The method of paragraph 41 or 42, wherein the antigen is derived from a pathogenic virus. 47. The method of paragraph 41 or 42, wherein the antigen is derived from a pathogenic fungus. 48. The method of paragraph 41 or 42, wherein the antigen is derived from a pathogenic protozoan. 49. A method of treating a subject having a disease, disorder, or condition including administering to the subject an effective amount of the pharmaceutical composition of paragraph 40 to treat or reduce a symptom of the disease, disorder, or condition in the subject. 50. The method of any one of paragraphs 41 to 49, wherein the composition is administered to the patient via intramuscular, intravenous, subcutaneous or intraperitoneal injection. 455738066.1 79 51. The method of any one of paragraphs 41 to 49, wherein the subject has a disease or disorder, or has been identified as being at increased risk of getting a disease or disorder. 52. The method of paragraph 51, wherein the subject has cancer, or has been identified as being at increased risk of getting a cancer. 53. The method of paragraph 51, wherein the subject has an infectious disease, or has been identified as being at increased risk of getting an infectious disease. 54. A kit including the synthetic mRNA of any one of paragraphs 1-14 or 18-37, or the nanoparticle of any one of 15-16 or 18-37, optionally wherein the kit further includes instructions for the method of any one of paragraphs 41-53. 55. A nucleic acid including the sequence of SEQ ID NO:18. 56. A nucleic acid including the sequence of SEQ ID NO:19. The described compositions and methods will be better understood in view of the following Examples. Examples Example 1. Transfection of adjuvant mRNAs in culture cells elevates cytokines levels Materials and Methods Selection of Adjuvants for mRNA vaccines IL-2 was selected for its role as a pro-inflammatory cytokine that potentiates T cell differentiation to cytotoxic and memory populations when present with antigen stimulation. The nucleic acid coding sequence used for IL-2 was as follows: ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGTGCAC CTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGATTTACAGAT GATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATGCTCACATTTAAGTTT TACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTGGAAGAAGAACTCAAACCTC TGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTAAGACCCAGGGACTTAATCAG CAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAAACAACATTCATGTGTGAATATGCT GATGAGACAGCAACCATTGTAGAATTTCTGAACAGATGGATTACCTTTTGTCAAAGCATCATCT CAACACTGACTTGA (SEQ ID NO:1). In SEQ ID NO:1 the sequence indicated in BOLD font was changed from XBAI TCTAA to codon optimized leucine sequence TCTGGA (CTA > CTG). The amino acid sequence used for IL-2 was as follows: MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKF YMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYA DETATIVEFLNRWITFCQSIISTLT (SEQ ID NO:2). 455738066.1 80 IL-7 was selected for its role in stimulating proliferation of all lymphoid cells and for its crucial role in T and NK cell development and survival. The nucleic acid coding sequence used for IL-7 was as follows: ATGTTCCATGTTTCTTTTAGGTATATCTTTGGACTTCCTCCCCTGATCCTTGTTCTGTTGCCAG TAGCATCATCTGATTGTGATATTGAAGGTAAAGATGGCAAACAATATGAGAGTGTTCTAATGGT CAGCATCGATCAATTATTGGACAGCATGAAAGAAATTGGTAGCAATTGCCTGAATAATGAATTT AACTTTTTTAAAAGACATATCTGTGATGCTAATAAGGAAGGTATGTTTTTATTCCGTGCTGCTC GCAAGTTGAGGCAATTTCTTAAAATGAATAGCACTGGTGATTTTGATCTCCACTTATTAAAAGT TTCAGAAGGCACAACAATACTGTTGAACTGCACTGGCCAGGTTAAAGGAAGAAAACCAGCTGCC CTGGGTGAAGCCCAACCAACAAAGAGTTTGGAAGAAAATAAATCTTTAAAGGAACAGAAAAAAC TGAATGACTTGTGTTTCCTAAAGAGACTATTACAAGAGATAAAAACTTGTTGGAATAAAATTTT GATGGGCACTAAAGAACACTGA (SEQ ID NO:3). The amino acid sequence used for IL-7 was as follows: MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEF NFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAA LGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH (SEQ ID NO:4). IL-15 was selected for its role in activating and stimulating proliferation of T and NK cells. IL-15 also plays a key role in maintaining long term antigen-specific memory populations. The nucleic acid coding sequence used for IL-15 was as follows: ATGAGAATTTCGAAACCACATTTGAGAAGTATTTCCATCCAGTGCTACTTGTGTTTACTTCTAA ACAGTCATTTTCTAACTGAAGCTGGCATTCATGTCTTCATTTTGGGCTGTTTCAGTGCAGGGCT TCCTAAAACAGAAGCCAACTGGGTGAATGTAATAAGTGATTTGAAAAAAATTGAAGATCTTATT CAATCTATGCATATTGATGCTACTTTATATACGGAAAGTGATGTTCACCCCAGTTGCAAAGTAA CAGCAATGAAGTGCTTTCTCTTGGAGTTACAAGTTATTTCACTTGAGTCCGGAGATGCAAGTAT TCATGATACAGTAGAAAATCTGATCATCCTAGCAAACAACAGTTTGTCTTCTAATGGGAATGTA ACAGAATCTGGATGCAAAGAATGTGAGGAACTGGAGGAAAAAAATATTAAAGAATTTTTGCAGA GTTTTGTACATATTGTCCAAATGTTCATCAACACTTCTTGA (SEQ ID NO:5). The amino acid sequence used for IL-15 was as follows: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLI QSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNV TESGCKECEELEEKNIKEFLQSFVHIVQMFINTS (SEQ ID NO:6). XCL1 was selected for its role as a chemotactic factor for conventional dendritic cells and for stimulating antigen uptake and cross presentation. 455738066.1 81 The nucleic acid coding sequence used for XCL1 was as follows: ATGAGACTTCTCATCCTGGCCCTCCTTGGCATCTGCTCTCTCACTGCATACATTGTGGAAGGTG TAGGGAGTGAAGTCTCAGATAAGAGGACCTGTGTGAGCCTCACTACCCAGCGACTGCCGGTTAG CAGAATCAAGACCTACACCATCACGGAAGGCTCCTTGAGAGCAGTAATTTTTATTACCAAACGT GGCCTAAAAGTCTGTGCTGATCCACAAGCCACATGGGTGAGAGACGTGGTCAGGAGCATGGACA GGAAATCCAACACCAGAAATAACATGATCCAGACCAAGCCAACAGGAACCCAGCAATCGACCAA TACAGCTGTGACTCTGACTGGCTAG (SEQ ID NO:7). The amino acid sequence used for XCL1 was as follows: MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKR GLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG (SEQ ID NO:8). A truncated / modified form of XCL1 with increased function is also envisioned. IRF3 was selected for its role as a transcriptional regulator of cellular response to viral infection that activates innate immune pathways and leads to production of type 1 interferons. The nucleic acid coding sequence used for IRF3 was as follows: ATGGGAACCCCAAAGCCACGGATCCTGCCCTGGCTGGTGTCGCAGCTGGACCTGGGGCAACTGG AGGGCGTGGCCTGGGTGAACAAGAGCCGCACGCGCTTCCGCATCCCTTGGAAGCACGGCCTACG GCAGGATGCACAGCAGGAGGATTTCGGAATCTTCCAGGCCTGGGCCGAGGCCACTGGTGCATAT GTTCCCGGGAGGGATAAGCCAGACCTGCCAACCTGGAAGAGGAATTTCCGCTCTGCCCTCAACC GCAAAGAAGGGTTGCGTTTAGCAGAGGACCGGAGCAAGGACCCTCACGACCCACATAAAATCTA CGAGTTTGTGAACTCAGGAGTTGGGGACTTTTCCCAGCCAGACACCTCTCCGGACACCAATGGt ggaggcagtacttctgatacccagGAAGACATTCTGGATGAGTTACTGGGTAACATGGTGTTGG CCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGCCCCT GCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTG AAGCGGCTGTTGGTGCCGGGGGAAGAGTGGGAGTTCGAGGTGACAGCCTTCTACCGGGGCCGCC AAGTCTTCCAGCAGACCATCTCCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGGGAGA CAGGACGCTGCCTGGATGGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGA GTGATGAGCTACGTGAGGCATGTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCG GGCAGTGGCTCTGGGCCCAGCGGCTGGGGCACTGCCACACATACTGGGCAGTGAGCGAGGAGCT GCTCCCCAACAGCGGGCATGGGCCTGATGGCGAGGTCCCCAAGGACAAGGAAGGAGGCGTGTTT GACCTGGGGCCCTTCATTGTAGATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCT ATGCCCTCTGGTTCTGTGTGGGGGAGTCATGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGT GATGGTCAAGGTTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCCGGGTAGGGGGTGCC TCCTCCCTGGAGAATACTGTGGACCTGCACATTTCCAACAGCCACCCACTCTCCCTCACCTCCG ACCAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAGAG CTGA (SEQ ID NO:9). 455738066.1 82 The amino acid sequence used for IRF3 was as follows: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAY VPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNG GGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPL KRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRG VMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVF DLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGA SSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES (SEQ ID NO:10). A constitutively active version of the IRF3 protein, known as IRF3-5D, with the following mutations: S396D / S398D / S402D / T404D / S405D has also been previously described, and was selected and shown below as a potential adjuvant (Lin, et al., Molecular and Cellular Biology, 19:4, 2465-2474 (1999)). This protein was also included in the panel. The nucleic acid coding sequence used for IRF3-5D was as follows: ATGGGAACCCCAAAGCCACGGATCCTGCCCTGGCTGGTGTCGCAGCTGGACCTGGGGCAACTGG AGGGCGTGGCCTGGGTGAACAAGAGCCGCACGCGCTTCCGCATCCCTTGGAAGCACGGCCTACG GCAGGATGCACAGCAGGAGGATTTCGGAATCTTCCAGGCCTGGGCCGAGGCCACTGGTGCATAT GTTCCCGGGAGGGATAAGCCAGACCTGCCAACCTGGAAGAGGAATTTCCGCTCTGCCCTCAACC GCAAAGAAGGGTTGCGTTTAGCAGAGGACCGGAGCAAGGACCCTCACGACCCACATAAAATCTA CGAGTTTGTGAACTCAGGAGTTGGGGACTTTTCCCAGCCAGACACCTCTCCGGACACCAATGGt ggaggcagtacttctgatacccagGAAGACATTCTGGATGAGTTACTGGGTAACATGGTGTTGG CCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGCCCCT GCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTG AAGCGGCTGTTGGTGCCGGGGGAAGAGTGGGAGTTCGAGGTGACAGCCTTCTACCGGGGCCGCC AAGTCTTCCAGCAGACCATCTCCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGGGAGA CAGGACGCTGCCTGGATGGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGA GTGATGAGCTACGTGAGGCATGTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCG GGCAGTGGCTCTGGGCCCAGCGGCTGGGGCACTGCCACACATACTGGGCAGTGAGCGAGGAGCT GCTCCCCAACAGCGGGCATGGGCCTGATGGCGAGGTCCCCAAGGACAAGGAAGGAGGCGTGTTT GACCTGGGGCCCTTCATTGTAGATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCT ATGCCCTCTGGTTCTGTGTGGGGGAGTCATGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGT GATGGTCAAGGTTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCCGGGTAGGGGGTGCC TCCTCCCTGGAGAATACTGTGGACCTGCACATTGACAACGACCACCCACTCGACCTCGACGACG ACCAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAGAG CTGA (SEQ ID NO:11). 455738066.1 83 The sequence corresponding to the S396D / S398D / S402D / T404D / S405D mutations is indicated in lower-case font. The amino acid sequence used for IRF3-5D was as follows: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAY VPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNG GGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPL KRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRG VMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVF DLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGA SSLENTVDLHIDNDHPLDLDDDQYKAYLQDLVEGMDFQGPGES (SEQ ID NO:12). MDA5 was selected for its role as a pattern recognition receptor that binds double stranded RNA and initiates activation of anti-viral innate immune programs through IRF3 and IRF7, leading to type 1 interferon production. The nucleic acid coding sequence used for MDA5 was as follows: ATGTCGAATGGGTATTCCACAGACGAGAATTTCCGCTATCTCATCTCGTGCTTCAGGGCCAGGG TGAAAATGTACATCCAGGTGGAGCCTGTGCTGGACTACCTGACCTTTCTGCCTGCAGAGGTGAA GGAGCAGATTCAGAGGACAGTCGCCACCTCCGGGAACATGCAGGCAGTTGAACTGCTGCTGAGC ACCTTGGAGAAGGGAGTCTGGCACCTTGGTTGGACTCGGGAATTCGTGGAGGCCCTCCGGAGAA CCGGCAGCCCTCTGGCCGCCCGCTACATGAACCCTGAGCTCACGGACTTGCCCTCTCCATCGTT TGAGAACGCTCATGATGAATATCTCCAACTGCTGAACCTCCTTCAGCCCACTCTGGTGGACAAG CTTCTAGTTAGAGACGTCTTGGATAAGTGCATGGAGGAGGAACTGTTGACAATTGAAGACAGAA ACCGGATTGCTGCTGCAGAAAACAATGGAAATGAATCAGGTGTAAGAGAGCTACTAAAAAGGAT TGTGCAGAAAGAAAACTGGTTCTCTGCATTTCTGAATGTTCTTCGTCAAACAGGAAACAATGAA CTTGTCCAAGAGTTAACAGGCTCTGATTGCTCAGAAAGCAATGCAGAGATTGAGAATTTATCAC AAGTTGATGGTCCTCAAGTGGAAGAGCAACTTCTTTCAACCACAGTTCAGCCAAATCTGGAGAA GGAGGTCTGGGGCATGGAGAATAACTCATCAGAATCATCTTTTGCAGATTCTTCTGTAGTTTCA GAATCAGACACAAGTTTGGCAGAAGGAAGTGTCAGCTGCTTAGATGAAAGTCTTGGACATAACA GCAACATGGGCAGTGATTCAGGCACCATGGGAAGTGATTCAGATGAAGAGAATGTGGCAGCAAG AGCATCCCCGGAGCCAGAACTCCAGCTCAGGCCTTACCAAATGGAAGTTGCCCAGCCAGCCTTG GAAGGGAAGAATATCATCATCTGCCTCCCTACAGGGAGTGGAAAAACCAGAGTGGCTGTTTACA TTGCCAAGGATCACTTAGACAAGAAGAAAAAAGCATCTGAGCCTGGAAAAGTTATAGTTCTTGT CAATAAGGTACTGCTAGTTGAACAGCTCTTCCGCAAGGAGTTCCAACCATTTTTGAAGAAATGG TATCGTGTTATTGGATTAAGTGGTGATACCCAACTGAAAATATCATTTCCAGAAGTTGTCAAGT CCTGTGATATTATTATCAGTACAGCTCAAATCCTTGAAAACTCCCTCTTAAACTTGGAAAATGG AGAAGATGCTGGTGTTCAATTGTCAGACTTTTCCCTCATTATCATTGATGAATGTCATCACACC 455738066.1 84 AACAAAGAAGCAGTGTATAATAACATCATGAGGCATTATTTGATGCAGAAGTTGAAAAACAATA GACTCAAGAAAGAAAACAAACCAGTGATTCCCCTTCCTCAGATACTGGGACTAACAGCTTCACC TGGTGTTGGAGGGGCCACGAAGCAAGCCAAAGCTGAAGAACACATTTTAAAACTATGTGCCAAT CTTGATGCATTTACTATTAAAACTGTTAAAGAAAACCTTGATCAACTGAAAAACCAAATACAGG AGCCATGCAAGAAGTTTGCCATTGCAGATGCAACCAGAGAAGATCCATTTAAAGAGAAACTTCT GGAAATAATGACAAGGATTCAAACTTATTGTCAAATGAGTCCAATGTCAGATTTTGGAACTCAA CCCTATGAACAATGGGCCATTCAAATGGAAAAAAAAGCTGCAAAAGAAGGAAATCGCAAAGAAC GTGTTTGTGCAGAACATTTGAGGAAGTACAATGAGGCCCTACAAATTAATGACACAATTCGAAT GATAGATGCGTATACTCATCTTGAAACTTTCTATAATGAAGAGAAAGATAAGAAGTTTGCAGTC ATAGAAGATGATAGTGATGAGGGTGGTGATGATGAGTATTGTGATGGTGATGAAGATGAGGATG ATTTAAAGAAACCTTTGAAACTGGATGAAACAGATAGATTTCTCATGACTTTATTTTTTGAAAA CAATAAAATGTTGAAAAGGCTGGCTGAAAACCCAGAATATGAAAATGAAAAGCTGACCAAATTA AGAAATACCATAATGGAGCAATATACTAGGACTGAGGAATCAGCACGAGGAATAATCTTTACAA AAACACGACAGAGTGCATATGCGCTTTCCCAGTGGATTACTGAAAATGAAAAATTTGCTGAAGT AGGAGTCAAAGCCCACCATCTGATTGGAGCTGGACACAGCAGTGAGTTCAAACCCATGACACAG AATGAACAAAAAGAAGTCATTAGTAAATTTCGCACTGGAAAAATAAATCTGCTTATCGCTACCA CAGTGGCAGAAGAAGGTCTGGATATTAAAGAATGTAACATTGTTATCCGTTATGGTCTCGTCAC CAATGAAATAGCCATGGTCCAGGCCCGTGGTCGAGCCAGAGCTGATGAGAGCACCTACGTCCTG GTTGCTCACAGTGGTTCAGGAGTTATCGAACATGAGACAGTTAATGATTTCCGAGAGAAGATGA TGTATAAAGCTATACATTGTGTTCAAAATATGAAACCAGAGGAGTATGCTCATAAGATTTTGGA ATTACAGATGCAAAGTATAATGGAAAAGAAAATGAAAACCAAGAGAAATATTGCCAAGCATTAC AAGAATAACCCATCACTAATAACTTTCCTTTGCAAAAACTGCAGTGTGCTAGCCTGTTCTGGGG AAGATATCCATGTAATTGAGAAAATGCATCACGTCAATATGACCCCAGAATTCAAGGAACTTTA CATTGTAAGAGAAAACAAAGCACTGCAAAAGAAGTGTGCCGACTATCAAATAAATGGTGAAATC ATCTGCAAATGTGGCCAGGCTTGGGGAACAATGATGGTGCACAAAGGCTTAGATTTGCCTTGTC TCAAAATAAGGAATTTTGTAGTGGTTTTCAAAAATAATTCAACAAAGAAACAATACAAAAAGTG GGTAGAATTACCTATCACATTTCCCAATCTTGACTATTCAGAATGCTGTTTATTTAGTGATGAG GATTAG (SEQ ID NO:13). The sequence indicated in in BOLD font was changed from XBAI TCTAGA to codon optimized leucine sequence TCTGGA (CTA > CTG). The amino acid sequence used for MDA5 was as follows: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLS TLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDK LLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNE LVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVS 455738066.1 85 ESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPAL EGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKW YRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHT NKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGGATKQAKAEEHILKLCAN LDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQ PYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAV IEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKL RNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQ NEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVL VAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHY KNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDE D (SEQ ID NO:14). A mutated (G495R) form of MDA5 that is constitutively active and associated with Aicardi-Goutières syndrome has been previously described, and was also selected and shown below as a potential adjuvant (CA-MDA5) (Rice, et al., Nat Genet.46(5):503-509 (2014)). The nucleic acid coding sequence used for CA-MDA5 was as follows: ATGTCGAATGGGTATTCCACAGACGAGAATTTCCGCTATCTCATCTCGTGCTTCAGGGCCAGGG TGAAAATGTACATCCAGGTGGAGCCTGTGCTGGACTACCTGACCTTTCTGCCTGCAGAGGTGAA GGAGCAGATTCAGAGGACAGTCGCCACCTCCGGGAACATGCAGGCAGTTGAACTGCTGCTGAGC ACCTTGGAGAAGGGAGTCTGGCACCTTGGTTGGACTCGGGAATTCGTGGAGGCCCTCCGGAGAA CCGGCAGCCCTCTGGCCGCCCGCTACATGAACCCTGAGCTCACGGACTTGCCCTCTCCATCGTT TGAGAACGCTCATGATGAATATCTCCAACTGCTGAACCTCCTTCAGCCCACTCTGGTGGACAAG CTTCTAGTTAGAGACGTCTTGGATAAGTGCATGGAGGAGGAACTGTTGACAATTGAAGACAGAA ACCGGATTGCTGCTGCAGAAAACAATGGAAATGAATCAGGTGTAAGAGAGCTACTAAAAAGGAT TGTGCAGAAAGAAAACTGGTTCTCTGCATTTCTGAATGTTCTTCGTCAAACAGGAAACAATGAA CTTGTCCAAGAGTTAACAGGCTCTGATTGCTCAGAAAGCAATGCAGAGATTGAGAATTTATCAC AAGTTGATGGTCCTCAAGTGGAAGAGCAACTTCTTTCAACCACAGTTCAGCCAAATCTGGAGAA GGAGGTCTGGGGCATGGAGAATAACTCATCAGAATCATCTTTTGCAGATTCTTCTGTAGTTTCA GAATCAGACACAAGTTTGGCAGAAGGAAGTGTCAGCTGCTTAGATGAAAGTCTTGGACATAACA GCAACATGGGCAGTGATTCAGGCACCATGGGAAGTGATTCAGATGAAGAGAATGTGGCAGCAAG AGCATCCCCGGAGCCAGAACTCCAGCTCAGGCCTTACCAAATGGAAGTTGCCCAGCCAGCCTTG GAAGGGAAGAATATCATCATCTGCCTCCCTACAGGGAGTGGAAAAACCAGAGTGGCTGTTTACA TTGCCAAGGATCACTTAGACAAGAAGAAAAAAGCATCTGAGCCTGGAAAAGTTATAGTTCTTGT CAATAAGGTACTGCTAGTTGAACAGCTCTTCCGCAAGGAGTTCCAACCATTTTTGAAGAAATGG 455738066.1 86 TATCGTGTTATTGGATTAAGTGGTGATACCCAACTGAAAATATCATTTCCAGAAGTTGTCAAGT CCTGTGATATTATTATCAGTACAGCTCAAATCCTTGAAAACTCCCTCTTAAACTTGGAAAATGG AGAAGATGCTGGTGTTCAATTGTCAGACTTTTCCCTCATTATCATTGATGAATGTCATCACACC AACAAAGAAGCAGTGTATAATAACATCATGAGGCATTATTTGATGCAGAAGTTGAAAAACAATA GACTCAAGAAAGAAAACAAACCAGTGATTCCCCTTCCTCAGATACTGGGACTAACAGCTTCACC TGGTGTTGGACGGGCCACGAAGCAAGCCAAAGCTGAAGAACACATTTTAAAACTATGTGCCAAT CTTGATGCATTTACTATTAAAACTGTTAAAGAAAACCTTGATCAACTGAAAAACCAAATACAGG AGCCATGCAAGAAGTTTGCCATTGCAGATGCAACCAGAGAAGATCCATTTAAAGAGAAACTTCT GGAAATAATGACAAGGATTCAAACTTATTGTCAAATGAGTCCAATGTCAGATTTTGGAACTCAA CCCTATGAACAATGGGCCATTCAAATGGAAAAAAAAGCTGCAAAAGAAGGAAATCGCAAAGAAC GTGTTTGTGCAGAACATTTGAGGAAGTACAATGAGGCCCTACAAATTAATGACACAATTCGAAT GATAGATGCGTATACTCATCTTGAAACTTTCTATAATGAAGAGAAAGATAAGAAGTTTGCAGTC ATAGAAGATGATAGTGATGAGGGTGGTGATGATGAGTATTGTGATGGTGATGAAGATGAGGATG ATTTAAAGAAACCTTTGAAACTGGATGAAACAGATAGATTTCTCATGACTTTATTTTTTGAAAA CAATAAAATGTTGAAAAGGCTGGCTGAAAACCCAGAATATGAAAATGAAAAGCTGACCAAATTA AGAAATACCATAATGGAGCAATATACTAGGACTGAGGAATCAGCACGAGGAATAATCTTTACAA AAACACGACAGAGTGCATATGCGCTTTCCCAGTGGATTACTGAAAATGAAAAATTTGCTGAAGT AGGAGTCAAAGCCCACCATCTGATTGGAGCTGGACACAGCAGTGAGTTCAAACCCATGACACAG AATGAACAAAAAGAAGTCATTAGTAAATTTCGCACTGGAAAAATAAATCTGCTTATCGCTACCA CAGTGGCAGAAGAAGGTCTGGATATTAAAGAATGTAACATTGTTATCCGTTATGGTCTCGTCAC CAATGAAATAGCCATGGTCCAGGCCCGTGGTCGAGCCAGAGCTGATGAGAGCACCTACGTCCTG GTTGCTCACAGTGGTTCAGGAGTTATCGAACATGAGACAGTTAATGATTTCCGAGAGAAGATGA TGTATAAAGCTATACATTGTGTTCAAAATATGAAACCAGAGGAGTATGCTCATAAGATTTTGGA ATTACAGATGCAAAGTATAATGGAAAAGAAAATGAAAACCAAGAGAAATATTGCCAAGCATTAC AAGAATAACCCATCACTAATAACTTTCCTTTGCAAAAACTGCAGTGTGCTAGCCTGTTCTGGGG AAGATATCCATGTAATTGAGAAAATGCATCACGTCAATATGACCCCAGAATTCAAGGAACTTTA CATTGTAAGAGAAAACAAAGCACTGCAAAAGAAGTGTGCCGACTATCAAATAAATGGTGAAATC ATCTGCAAATGTGGCCAGGCTTGGGGAACAATGATGGTGCACAAAGGCTTAGATTTGCCTTGTC TCAAAATAAGGAATTTTGTAGTGGTTTTCAAAAATAATTCAACAAAGAAACAATACAAAAAGTG GGTAGAATTACCTATCACATTTCCCAATCTTGACTATTCAGAATGCTGTTTATTTAGTGATGAG GATTAG (SEQ ID NO:15). The sequence indicated in BOLD was changed from XBAI TCTAGA to codon optimized leucine sequence TCTGGA (CTA -> CTG). 455738066.1 87 The amino acid sequence used for CA-MDA5 was as follows: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLS TLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDK LLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNE LVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVS ESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPAL EGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKW YRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHT NKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGRATKQAKAEEHILKLCAN LDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQ PYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAV IEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKL RNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQ NEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVL VAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHY KNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEI ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDE D (SEQ ID NO:16). Design of Plasmid for Production of Adjuvant mRNA Using the human consensus sequence for each individual adjuvant protein as a template, necessary components were added for a functional mRNA subunit. As shown in the plasmid diagram (FIG.1), a T7 promoter sequence was added immediately following the first restriction site for compatibility with commercial in-vitro transcription kits. This T7 promoter sequence was modified to end with an AGG sequence for compatibility with Trilink (San Diego, CA) CleanCap 5’ mRNA capping technology. For the 5’ untranslated region (UTR), a synthetic sequence was chosen based on previously published screen (Cao, et al., Nat Commun 12, 4138 (2021)). This sequence was generated by artificial intelligence to be optimized for high efficiency translation and was among the highest performers in their 5’ UTR screen. Natural 3’ UTRs from each potential adjuvant were used. In cases where the natural 3’ UTR exceeded 100 bases, the length was shortened to only include the first 100 bases. A 100 base polyadenylation sequence was added following the 3’UTR. An example sequence containing all these elements is shown below (SEQ ID NO:17): GAGCTCACGCGTTAATACGACTCACTATAGacccaagctggctagcgtttaaacttaagcttgg gttacacaagggaagaaaagccgctgccgcactccgagtgtGCCACCATGTTCCATGTTTCTTT 455738066.1 88 TAGGTATATCTTTGGACTTCCTCCCCTGATCCTTGTTCTGTTGCCAGTAGCATCATCTGATTGT GATATTGAAGGTAAAGATGGCAAACAATATGAGAGTGTTCTAATGGTCAGCATCGATCAATTAT TGGACAGCATGAAAGAAATTGGTAGCAATTGCCTGAATAATGAATTTAACTTTTTTAAAAGACA TATCTGTGATGCTAATAAGGAAGGTATGTTTTTATTCCGTGCTGCTCGCAAGTTGAGGCAATTT CTTAAAATGAATAGCACTGGTGATTTTGATCTCCACTTATTAAAAGTTTCAGAAGGCACAACAA TACTGTTGAACTGCACTGGCCAGGTTAAAGGAAGAAAACCAGCTGCCCTGGGTGAAGCCCAACC AACAAAGAGTTTGGAAGAAAATAAATCTTTAAAGGAACAGAAAAAACTGAATGACTTGTGTTTC CTAAAGAGACTATTACAAGAGATAAAAACTTGTTGGAATAAAATTTTGATGGGCACTAAAGAAC ACTGAAAAATATGGAGTGGCAATATAGAAACACGAACTTTAGCTGCATCCTCCAAGAATCTATC TGCTTATGCAGTTTTTCAGAGTGGAATGCTTCCTAGAAGTTaaaaaaaaaaaaaaaaaaaaaaa aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa aaaaaaaaaaaaaTCTAGAGAGCTC (SEQ ID NO:17). In SEQ ID NO:17, the restriction site sequences are indicated in italic uppercase font; the T7 promoter and Trilink cap site “AG” is indicated within a box; the 5’UTR sequence is indicated in bold lowercase font, the traditional kozak sequience is indicated in bold italic uppercase font, the 3’UTR sequence is indicated in bold uppercase font and the polyA tail is indicated in lowercase font. mRNA Production The template DNA was extracted from the base plasmids by cutting at restriction sites MluI and XbaI. Template DNA was separated from plasmid DNA based on fragment size by gel electrophoresis and was purified from agarose gel using a Zymo Research (Irvine, CA) Zymoclean Gel DNA recovery kit. Purified, double stranded, linearized template DNA was then used for mRNA production via the New England Biolabs (Ipswich, MA) HiScribe T7 High Yield RNA Kit with addition of Trilink CleanCap mRNA capping technology and Trilink N1- MethylPseudo-UTP modified Uracil base for increased stability and translational efficiency of the mRNA product. The mRNA product was then purified using the New England Biolabs Monarch RNA Cleanup Kit. Purified functional mRNA was then stored in sterile water at -80 degrees. In vitro Assay To assess functionality of the mRNA constructs, a test transfection was performed in HEK 293T cells.250,000 cells were plated in a 12 well tissue culture plate with 2 mL complete DMEM cell culture media.2 ug of mRNA was transfected using lipofectamine 2000 (Thermo, Waltham Ma.) per manufacturer protocol. No transfection and lipofectamine alone served as controls.18 hours following transfection, the supernatant was collected and tested for the cytokine output of interest using ELISA. 455738066.1 89 Results For each cytokine mRNA, there was detection of a significant amount of the matched cytokine in supernatant after 18 hours compared to both NS and lipofectamine only (FIGS.2A- 2D). For constitutively active IRF3, IFNb was used as a surrogate marker for successful translation, as it is a direct output of the transcription factor. Example 2. mRNA vaccine containing IL-7 mRNA adjuvant results in tumor growth suppression in mice Methods Lipid Nanoparticle Encapsulation For injection into animals, lipid nanoparticles containing SM-102, 1,2-DSPC, Cholesterol, and DMG-PEG in a lipid molar ration of 50:10:38.5:1.5 were assembled and incorporated with mRNA using a rapid solvent injection mixing technique. mRNA was first combined with 50mM sodium acetate solution at pH 5.0. This solution was then stirred in a sterile container at 700rpm and the ethanolic mixture was rapidly injected into the acidic solution and mixed for an additional 30 minutes to create homogenous nanoparticles containing the functional mRNA units. Placebo containing all components except for mRNA were prepared using the same process. Compositions including one or more mRNA antigens and one or more mRNA adjuvants were then dialyzed against 500 volumes of sterile PBS. The nanoparticle solution was then drawn into sterile 1mL syringes and stored at 4 degrees until use. Animal studies mRNA therapeutic vaccine response in a murine melanoma model was used to test the efficacy of adjuvant candidates. B16F10 melanoma cells that ectopically express the Large T antigen (LTA) from the Merkel Cell Polyomavirus (MCPyV) were injected subcutaneously into the right flank of 10-week-old syngeneic female C57BL / 6 mice, and an mRNA vaccine containing LTA transcripts or placebo with and without adjuvant candidates were delivered by IM injection on days 6 and 15. The LTA vaccine alone has previously been shown to control tumor growth and prolong overall survival. Results This experiment revealed that addition of IL-7 transcripts to the LTA vaccine resulted in significant growth suppression compared to LTA vaccine alone, placebo, and placebo + IL-7 transcripts alone (FIG.3). In order to examine the specific effects of adjuvant IL-7 on memory formation, mice from the above experiment that were treated with LTA alone or LTA + IL-7 were euthanized on day 30 and their and spleens were processed for analysis of immune populations by flow cytometry. Spleens from the LTA + IL-7 treatment group were found to have an increase in total 455738066.1 90 T cells as well as an increased proportion of CD8+ T cells. Most importantly, these CD8+ T cells were enriched in memory markers IL7Ra and CD62L, indicating an expansion of both the overall memory compartment and the central memory compartment, suggesting the potential of the COMET approach to improve systemic immunity (FIGS.4A-4D). Example 3. Linked antigen-adjuvant mRNA templates result in effective local concentrations of single or double adjuvant cytokines Materials and Methods Design of linked Constructs Separate mRNA constructs for viral antigen targets and cytokine adjuvants that were co- encapsulated for in vivo delivery was used in examples 2 and 3. In order to simplify the functional construct, streamline encapsulation, and avoid heterogenous mRNA interactions, linked constructs were created that contain coding regions for both the target antigen and adjuvanting cytokine(s) as a single functional mRNA subunit (FIG.5 and FIG.6). As an example, the MCPyV LTA antigen transcript can be linked to the IL-2 transcript using a self-cleaving P2A linker with addition of a Furin cleavage site that excludes the linker amino acids and produces full length antigen and functional full-length cytokine as separate end products of a single mRNA (FIG.5). Additionally, two or more separate adjuvant transcripts can be linked using a self- cleaving P2A linker followed by a self-cleaving T2A linker with Furin cleavage sites that exclude linker amino acids. For example, the MCPyV LTA antigen can be linked to IL-7 and IL- 2 in the following sequence: LTA-P2A-IL7-T2A-IL2, which would result in full length antigen, functional full-length IL-7, and functional full length IL-2 as separate end products of a single mRNA (FIG.6). These sequences can be cloned into a pUC57-Simple plasmid and used as a template for mRNA production by in-vitro transcription as described above. It is important to note that the cloning platform demonstrated here can theoretically be used to substitute any suitable antigen transcript combined with any suitable adjuvant transcript(s) in a fully customizable model depending on the indication and clinical intent (i.e. prophylactic vs. therapeutic). The nucleic acid sequence of the DNA template encoding the LTA-P2A-IL2 mRNA is as follows: GAGCTCACGCGTTAATACGACTCACTATAAGacccaagctggctagcgtttaaacttaagcttg tgttacacaagggaagaaaagccgctgccgcactccgagtgtGCCACCATGTTCGTGTTCCTGG TGCTGCTGCCCCTGGTGAGCAGCCAGTGCGTGGATTTAGTCCTAAATAGGAAAGAAAGAGAGGC TCTCTGCAAGCTTTTAGAGATTGCTCCTAATTGTTATGGCAACATCCCTCTGATGAAAGCTGCT TTCAAAAGAAGCTGCTTAAAGCATCACCCTGATAAAGGGGGAAATCCTGTTATAATGATGGAAT TGAACACCCTTTGGAGCAAATTCCAGCAAAATATCCACAAGCTCAGAAGTGACTTCTCTATGTT TGATGAGGTCGACGAGGCCCCTATATATGGGACCACTAAATTCAAAGAATGGTGGAGATCAGGA GGATTCAGCTTCGGGAAGGCATACGAATATGGGCCCAATCCACACGGGACCAACTCAAGATCCA GAAAGCCTTCCTCCAATGCATCCAGGGGAGCCCCCAGTGGAAGCTCACCACCCCACAGCCAGAG CTCTTCCTCTGGGTATGGGTCCTTCTCAGCGTCCCAGGCTTCAGACTCCCAGTCCAGAGGACCC GATATACCTCCCGAACACCATGAGGAACCCACCTCATCCTCTGGATCCAGTAGCAGAGAGGAGA CCACCAATTCAGGAAGAGAATCCAGCACACCCAATGGAACCAGTGTACCTAGAAATTCTTCCAG AACGGATGGCACCTGGGAGGATCTCTTCTGCGATGAATCACTTTCCTCCCCTGAGCCTCCCTCG TCCTCTGAGGAGCCTGAGGAGCCCCCCTCCTCAAGAAGCTCGCCCCGGCAGCCCCCGTCTTCCT CTGCCGAGGAGGCCTCGTCATCTCAGTTTACAGATCGGGCCAAGCGGGGCAGCGGCGCCACAAA CTTCTCTCTGCTAAAGCAAGCAGGTGATGTTGAAGAAAACCCCGGGCCTATGTACAGGATGCAA CTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACAAACAGTGCACCTACTTCAAGTTCTA CAAAGAAAACACAGCTACAACTGGAGCATTTACTGCTGGATTTACAGATGATTTTGAATGGAAT TAATAATTACAAGAATCCCAAACTCACCAGGATGCTCACATTTAAGTTTTACATGCCCAAGAAG GCCACAGAACTGAAACATCTTCAGTGTCTGGAAGAAGAACTCAAACCTCTGGAGGAAGTGCTAA ATTTAGCTCAAAGCAAAAACTTTCACTTAAGACCCAGGGACTTAATCAGCAATATCAACGTAAT AGTTCTGGAACTAAAGGGATCTGAAACAACATTCATGTGTGAATATGCTGATGAGACAGCAACC ATTGTAGAATTTCTGAACAGATGGATTACCTTTTGTCAAAGCATCATCTCAACACTGACTTGAG CGGCCGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTGGGCCTCCCCCCAGCCCCTCCTCCC CTTCCTGCACCCGTACCCCCGTGGTCTTTGAATAAAGTCTGAGTGGGCGGCaaaaaaaaaaaaa In sequence ID NO:18, the restriction site sequences are indicated in italic uppercase font; the T7 promoter and Trilink cap site “AG” is indicated within a box; the 5’UTR sequence is indicated in bold lowercase font, the traditional Kozak sequence is indicated in bold italic uppercase font; Signal peptide is highlighted in dashed underlining and in uppercase font; Furin Cleavage site is highlighted in dashed underlining and in uppercase italics font; Linker sequence is highlighted in gray and in uppercase bold font; the 3’UTR sequence is indicated in bold uppercase font and the polyA tail is indicated in lowercase font. The nucleic acid sequence of the DNA template encoding the LTA-P2A-IL7-T2A-IL2 mRNA is as follows: GAGCTCACGCGTTAATACGACTCACTATAAGacccaagctggctagcgtttaaacttaagcttg 455738066.1 92 tgttacacaagggaagaaaagccgctgccgcactccgagtgtGCCACCATGTTCGTGTTCCTGG TGCTGCTGCCCCTGGTGAGCAGCCAGTGCGTGGATTTAGTCCTAAATAGGAAAGAAAGAGAGGC TCTCTGCAAGCTTTTAGAGATTGCTCCTAATTGTTATGGCAACATCCCTCTGATGAAAGCTGCT TTCAAAAGAAGCTGCTTAAAGCATCACCCTGATAAAGGGGGAAATCCTGTTATAATGATGGAAT TGAACACCCTTTGGAGCAAATTCCAGCAAAATATCCACAAGCTCAGAAGTGACTTCTCTATGTT TGATGAGGTCGACGAGGCCCCTATATATGGGACCACTAAATTCAAAGAATGGTGGAGATCAGGA GGATTCAGCTTCGGGAAGGCATACGAATATGGGCCCAATCCACACGGGACCAACTCAAGATCCA GAAAGCCTTCCTCCAATGCATCCAGGGGAGCCCCCAGTGGAAGCTCACCACCCCACAGCCAGAG CTCTTCCTCTGGGTATGGGTCCTTCTCAGCGTCCCAGGCTTCAGACTCCCAGTCCAGAGGACCC GATATACCTCCCGAACACCATGAGGAACCCACCTCATCCTCTGGATCCAGTAGCAGAGAGGAGA CCACCAATTCAGGAAGAGAATCCAGCACACCCAATGGAACCAGTGTACCTAGAAATTCTTCCAG AACGGATGGCACCTGGGAGGATCTCTTCTGCGATGAATCACTTTCCTCCCCTGAGCCTCCCTCG TCCTCTGAGGAGCCTGAGGAGCCCCCCTCCTCAAGAAGCTCGCCCCGGCAGCCCCCGTCTTCCT CTGCCGAGGAGGCCTCGTCATCTCAGTTTACAGATCGGGCCAAGCGGGGCAGCGGCGCCACAAA CTTCTCTCTGCTAAAGCAAGCAGGTGATGTTGAAGAAAACCCCGGGCCTATGTTCCATGTTTCT TTTAGGTATATCTTTGGACTTCCTCCCCTGATCCTTGTTCTGTTGCCAGTAGCATCATCTGATT GTGATATTGAAGGTAAAGATGGCAAACAATATGAGAGTGTTCTAATGGTCAGCATCGATCAATT ATTGGACAGCATGAAAGAAATTGGTAGCAATTGCCTGAATAATGAATTTAACTTTTTTAAAAGA CATATCTGTGATGCTAATAAGGAAGGTATGTTTTTATTCCGTGCTGCTCGCAAGTTGAGGCAAT TTCTTAAAATGAATAGCACTGGTGATTTTGATCTCCACTTATTAAAAGTTTCAGAAGGCACAAC AATACTGTTGAACTGCACTGGCCAGGTTAAAGGAAGAAAACCAGCTGCCCTGGGTGAAGCCCAA CCAACAAAGAGTTTGGAAGAAAATAAATCTTTAAAGGAACAGAAAAAACTGAATGACTTGTGTT TCCTAAAGAGACTATTACAAGAGATAAAAACTTGTTGGAATAAAATTTTGATGGGCACTAAAGA ACACCGGGCCAAGCGGGGCTCCGGCGAGGGCAGGGGAAGTCTTCTAACATGCGGGGACGTGGAG GAAAATCCCGGCCCAATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTG TCACAAACAGTGCACCTACTTCAAGTTCTACAAAGAAAACACAGCTACAACTGGAGCATTTACT GCTGGATTTACAGATGATTTTGAATGGAATTAATAATTACAAGAATCCCAAACTCACCAGGATG CTCACATTTAAGTTTTACATGCCCAAGAAGGCCACAGAACTGAAACATCTTCAGTGTCTGGAAG AAGAACTCAAACCTCTGGAGGAAGTGCTAAATTTAGCTCAAAGCAAAAACTTTCACTTAAGACC CAGGGACTTAATCAGCAATATCAACGTAATAGTTCTGGAACTAAAGGGATCTGAAACAACATTC ATGTGTGAATATGCTGATGAGACAGCAACCATTGTAGAATTTCTGAACAGATGGATTACCTTTT GTCAAAGCATCATCTCAACACTGACTTGAGCGGCCGCTGGAGCCTCGGTGGCCTAGCTTCTTGC CCCTTGGGCCTCCCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCGTGGTCTTTGAATA AAGTCTGAGTGGGCGGCaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa 455738066.1 93 aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaTCTAGA (SEQ ID NO:19). the T7 promoter and Trilink cap site “AG” is indicated within a box; the 5’UTR sequence is indicated in bold lowercase font, the traditional Kozak sequence is indicated in bold italic uppercase font; Signal peptide is highlighted in dashed underlining and in uppercase font; Furin Cleavage site is highlighted in dashed underlining and in uppercase italics font; Linker sequence is highlighted in gray and in uppercase bold font; the 3’UTR sequence is indicated in bold uppercase font and the polyA tail is indicated in lowercase font. Expression Assay In order to test the above linked antigen-adjuvant constructs, the LTA-P2A-IL7, LTA- P2A-IL2, and LTA-P2A-IL7-T2A-IL2 mRNA were transfected into HEK 293T cells. For test transfection, 500k 293T cells were plated in 6 well plates with 2 mL complete DMEM media with 10% FBS, and each construct above was transfected at doses based on antigen weight, such that each well received the equivalent of 2 µg of antigen mRNA but different total doses depending on the portion of mRNA that encode adjuvanting cytokines. Transfection was performed with 4 µL Lipofectamine 2000 in 100 µL total OptiMEM per manufacturer protocol, and cells were incubated for 24 hours. Control transfection with volume matched Lipofectamine 2000 only was performed. Cell culture supernatants were collected after 24 hours and analyzed by ELISA to determine cytokine concentration. Results The results indicated high levels of cytokine production with single and double linked constructs comparable to cytokine only mRNA (FIGS.7A-7B). Individual cytokine concentrations were lower in double linked constructs as expected, with total yield being roughly equivalent to single linked constructs or cytokine only mRNA. These results provide in vitro evidence that the linked antigen-adjuvant mRNA template can achieve effective local concentrations of single or double adjuvant molecules. Discussion Confirmation of adjuvant findings observed in the B16-LTA model are underway in a B16-OVA model with an mRNA vaccine directed against full length ovalbumin. A B16-OVA model will allow for identification of antigen specific T cells in the tumor, peripheral blood, and spleen of treated mice by flow cytometry using H-2K(b)- tetramers including the SIINFEKL (SEQ ID NO:20) peptide antigen. OVA specific antigen presenting cells can also be identified by flow cytometry using an antibody directed against the Class 1 – SIINFEKL complex. Finally, 455738066.1 94 OVA specific antibody levels can be tracked. Addition of these antigen specific readouts will allow for much more detailed evaluation of the adjuvant benefits of the COMET system, and for high throughput screening of future adjuvant candidates. The adjuvant approach and principles that have been described herein, including the systematic expansion of adaptive immune cells like B or T cells could be applied to nearly any mRNA cancer vaccine, including therapeutic or prophylactic vaccines that depend on T cells, or vaccines that depend largely on B cells, such as vaccines for infectious diseases like influenza, COVID or bacterial vaccines including vaccines to streptococcus pneumonia, hemophilius influenza B or Borrelia burgdorferia. In the case of antibody-mediated vaccines signals such as CD40L, or Th2 cytokines could be encoded. This approach could also be used in autoimmunity or autoinflammatory disease or allergy, in this case providing antigen in the context of explicitly tolerizing signals (e.g. in the case of MS providing myelin sheath protein along with regulatory T cell development signals such as TGFbeta or IL-10). The idea of tolerizing mRNA vaccines is known in the art with a focus on the tolerogenic properties of nanoparticles and the mRNA itself, rather than programming the expansion of tolerogenic immune populations via adjuvant mRNA signals (Krienke, et al., Science 371, 145–153 (2021)). Example 4: antigen+IL-7 vaccines increase antigen-specific memory CD8+ T cells compared with antigen-only vaccines To determine the efficacy of the adjuvant-antigen construct system for the establishment of antigen-specific memory CD8+ T cells, the system was tested in vivo. Materials and Methods Linked constructs were designed as described in Example 3. Specifically, constructs including IL-7 linked to antigen were prepared. 15 µg of mRNA vaccine was used to treat B16-LTA tumor-bearing mice on d6 and day 13 after tumor inoculation (d13). On d15, mice were sacrificed and spleens were examined for antigen-specific and memory phenotype CD8+ T cells. Enrichment of LTA-immunodominant epitope-dextramer positive CD8+ T cells on d15 from the spleens of mice following placebo, LTA vaccine and LTA+IL-7-containing vaccine treatment was monitored. The proportion of LTA antigen-specific CD8+ T cells with memory (IL7R+) phenotypes on d15 from the spleens of mice following placebo, LTA-vaccine and LTA+IL-7-containing vaccine treatment was also assessed. Results IL-7+ Antigen co-encoded vaccines improve CD8+ T cell memory. As set forth in FIGS.8A-8B, antigen+IL-7 mRNA vaccines enhance antigen specific CD8+ T cell frequency systemically compared with antigen-only and placebo treatments and only 455738066.1 95 antigen+IL-7 mRNA vaccines enhance the accumulation of antigen-specific memory phenotype CD8+ T cells.Example 5: Vaccines that encoded Antigen, IL7 and IL2 increased antigen- specific CD8+ T cells compared to all other groups compared with antigen-only vaccines To determine the efficacy of the double-adjuvant-antigen construct system for the establishment of antigen-specific CD8+ T cells, the system was tested in vivo. Materials and Methods Linked constructs were designed as described in Example 3. Specifically, constructs including IL-7 linked to IL-2 and antigen were prepared. B16-Ova tumor-bearing mice were treated on day 6 and day 13 after tumor inoculation with Ova, IL-7 only, IL-2 only, Ova+IL-7, Ova+IL-2 or Ova+IL-7+IL-2 mRNA encoded immunotherapies. On day 15, mice were sacrificed and spleens were dissected and evaluated via flow cytometry including evaluation via tetramers for the immunodominant epitope, SIINFEKL (SEQ ID NO:20). Results IL-2+IL-7+Antigen-encoded vaccines improves the frequency of antigen-specific T cells. As demonstrated in Figure 9, vaccines that encoded Ova+IL-7+IL-2 increased antigen- specific CD8+ T cells compared to all other groups. Example 6. Addition of Targeting Clec9a Peptide Materials and Methods To target antigens to antigen-presenting cells, compositions of synthetic messenger ribonucleic acid (mRNA), including one or more ribonucleic acid sequences encoding one or amino acid sequences that target linked antigens to antigen presenting cells (APCs) such as dendritic cells (DCs), or improve the uptake and presentation of those antigens by APCs were prepared and tested. As an exemplary approach, the co-encoding of antigens linked to Clec9A-targeting sequences was assessed for increased peptide uptake by APCs. Clec9a is a protein expressed on APCs including dendritic cells. An mRNA approach to co-encode a Clec9a-binding peptide linked to antigen was developed. To provide a proof of principle for this approach, a Blue Fluorescent Protein (BFP) encoded mRNA with and without a signal peptide (SP) and with and without an mRNA sequence for a Clec9a-binding protein was developed. Briefly, each mRNA sequence was cloned into a puc57 DNA plasmid and mRNA was prepared for each sequence. 293T cells were transfected with Blue Fluorescent Protein-containing (BFP), signal peptide- BFP-containing (SP-BFP), Clec9a-Binding-Peptide-BFP-containing (CBP-BFP) or SP-CBP- BFP mRNAs. Following transfection, 293T cells were mixed in a 1:1 ratio with MuTuDCs and incubated as shown prior to flow cytometry. 455738066.1 96 The CBP amino acid sequence that was used is:WPRFHSSVRHTH (SEQ ID NO:23). The DNA sequence for constructs is noted below (5’->3’): TTCGTGTTCCTGGTGCTGCTGCCCCTGGTGAGCAGCCAGTGCGTGtggccgcgctttcatagca gcgtgcgccatacccatggcggaggg (SEQ ID NO:25), where residues in upper case font encode a signal sequence; residues in lower case font encode a Clec9a-binding peptide; and residues in bold font encode a linker peptide. Each mRNA construct was transfected into 293T cells on day 1 prior to performing Co- culture (1:1 ratio) with MuTuDC cells, a cell line that phenocopies mouse cDC1s. It was hypothesized that the inclusion of both SP and CBP would improve uptake of the BFP protein relative to constructs that lack either of these elements. Results Cells were harvested at 4 h, 8 h, 12 h, 24 h, and 36 h, and blue fluorescent protein expression was assessed via flow cytometry in both the 293T cells and the MuTuDCs. The inclusion of SP and CBP both improved BFP fluorescence by MuTuDCs at multiple timepoints (See Figs.10A and 10B). References 1. Rongtuan, et al. (1999) Structural and Functional Analysis of Interferon Regulatory Factor 3: Localization of the Transactivation and Autoinhibitory Domains, Molecular and Cellular Biology, 19:4, 2465-2474 2. Rice, et al., Gain-of-function mutations in IFIH1 cause a spectrum of human disease phenotypes associated with upregulated type I interferon signaling. Nat Genet.2014 May;46(5):503-509. doi: 10.1038 / ng.2933. Epub 2014 Mar 30. PMID: 24686847; PMCID: PMC4004585. 3. Cao, et al. High-throughput 5′ UTR engineering for enhanced protein production in non- viral gene therapies. Nat Commun 12, 4138 (2021). doi.org / 10.1038 / s41467-021-24436-7 4. Krienke, et al. A noninflammatory mRNA vaccine for treatment of experimental autoimmune encephalomyelitis. Science 371, 145–153 (2021). It is understood that the disclosed methods and compositions are not limited to the particular methodology, protocols, and reagents described as these can vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention which will be limited only by the appended claims. Disclosed are materials, compositions, and components that can be used for, can be used in conjunction with, can be used in preparation for, or are products of the disclosed method and 455738066.1 97 compositions. These and other materials are disclosed herein, and it is understood that when combinations, subsets, interactions, groups, etc. of these materials are disclosed that while specific reference of each various individual and collective combinations and permutation of these compounds may not be explicitly disclosed, each is specifically contemplated and described herein. For example, if a nucleic acid sequence is disclosed and discussed and a number of modifications that can be made to a number of molecules including the nucleic acid sequence are discussed, each and every combination and permutation of the nucleic acid sequence and the modifications that are possible are specifically contemplated unless specifically indicated to the contrary. Thus, if a class of molecules A, B, and C are disclosed as well as a class of molecules D, E, and F and an example of a combination molecule, A-D is disclosed, then even if each is not individually recited, each is individually and collectively contemplated. Thus, is this example, each of the combinations A-E, A-F, B-D, B-E, B-F, C-D, C-E, and C-F are specifically contemplated and should be considered disclosed from disclosure of A, B, and C; D, E, and F; and the example combination A-D. Likewise, any subset or combination of these is also specifically contemplated and disclosed. Thus, for example, the sub-group of A-E, B-F, and C-E are specifically contemplated and should be considered disclosed from disclosure of A, B, and C; D, E, and F; and the example combination A-D. Further, each of the materials, compositions, components, etc. contemplated and disclosed as above can also be specifically and independently included or excluded from any group, subgroup, list, set, etc. of such materials. These concepts apply to all aspects of this application including, but not limited to, steps in methods of making and using the disclosed compositions. Thus, if there are a variety of additional steps that can be performed it is understood that each of these additional steps can be performed with any specific embodiment or combination of embodiments of the disclosed methods, and that each such combination is specifically contemplated and should be considered disclosed. It must be noted that as used herein and in the appended claims, the singular forms "a ", "an", and "the" include plural reference unless the context clearly dictates otherwise. Thus, for example, reference to "a nucleic acid sequence" includes a plurality of such nucleic acids, reference to "the nucleic acids" is a reference to one or more nucleic acid and equivalents thereof known to those skilled in the art, and so forth. “Optional” or “optionally” means that the subsequently described event, circumstance, or material may or may not occur or be present, and that the description includes instances where the event, circumstance, or material occurs or is present and instances where it does not occur or is not present. 455738066.1 98 Unless the context clearly indicates otherwise, use of the word “can” indicates an option or capability of the object or condition referred to. Generally, use of “can” in this way is meant to positively state the option or capability while also leaving open that the option or capability could be absent in other forms or embodiments of the object or condition referred to. Unless the context clearly indicates otherwise, use of the word “may” indicate an option or capability of the object or condition referred to. Generally, use of “may” in this way is meant to positively state the option or capability while also leaving open that the option or capability could be absent in other forms or embodiments of the object or condition referred to. Unless the context clearly indicates otherwise, use of “may” herein does not refer to an unknown or doubtful feature of an object or condition. Ranges can be expressed herein as from "about" one particular value, and / or to "about" another particular value. When such a range is expressed, also specifically contemplated, and considered disclosed is the range from the one particular value and / or to the other particular value unless the context specifically indicates otherwise. Similarly, when values are expressed as approximations, by use of the antecedent “about,” it will be understood that the value forms another, specifically contemplated embodiment that should be considered disclosed unless the context specifically indicates otherwise. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint unless the context specifically indicates otherwise. All of the individual values and sub-ranges of values contained within an explicitly disclosed range are also specifically contemplated and should be considered disclosed unless the context specifically indicates otherwise. Finally, all ranges refer both to the recited range as a range and as a collection of individual numbers from and including the first endpoint to and including the second endpoint. In the latter case, any of the individual numbers can be selected as one form of the quantity, value, or feature to which the range refers. In this way, a range describes a set of numbers or values from and including the first endpoint to and including the second endpoint from which a single member of the set (i.e. a single number) can be selected as the quantity, value, or feature to which the range refers. The foregoing applies regardless of whether in particular cases some or all of these embodiments are explicitly disclosed. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed method and compositions belong. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present method and compositions, the particularly useful methods, devices, and materials are as described. Publications cited herein and the material for which they are cited are hereby specifically incorporated by reference. 455738066.1 99 Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such disclosure by virtue of prior invention. No admission is made that any reference constitutes prior art. The discussion of references states what their authors assert, and applicants reserve the right to challenge the accuracy and pertinency of the cited documents. It will be clearly understood that, although a number of publications are referred to herein, such reference does not constitute an admission that any of these documents forms part of the common general knowledge in the art. Although the description of materials, compositions, components, steps, techniques, etc. can include numerous options and alternatives, this should not be construed as, and is not an admission that, such options and alternatives are equivalent to each other or, in particular, are obvious alternatives. Thus, for example, a list of different gene targets does not indicate that the listed gene targets are obvious one to the other, nor is it an admission of equivalence or obviousness. Every component disclosed herein is intended to be and should be considered to be specifically disclosed herein. Further, every subgroup that can be identified within this disclosure is intended to be and should be considered to be specifically disclosed herein. As a result, it is specifically contemplated that any component, or subgroup of components can be either specifically included for or excluded from use or included in or excluded from a list of components. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the method and compositions described herein. Such equivalents are intended to be encompassed by the following claims. 455738066.1 100

Claims

We claim:

1. A synthetic messenger ribonucleic acid (mRNA) molecule comprising (a) one or more ribonucleic acid sequences encoding one or more peptide antigen(s); and (b) one or more ribonucleic acid sequences encoding one or more peptide adjuvant(s) and / or other immuno-modulatory agent, wherein the ribonucleic acid is configured to express the peptide antigen(s) and the peptide adjuvant(s) and / or other immuno-modulatory agent(s) as distinct polypeptides within a mammalian cell.

2. The synthetic mRNA molecule of claim 1, wherein the one or more ribonucleic acid sequences encoding one or more peptide antigen(s) further comprise a ribonucleic acid sequence encoding a polypeptide targeting motif, wherein the polypeptide targeting motif enhances binding, uptake or processing of the antigen by an antigen presenting cell (APC).

3. The synthetic mRNA molecule of claim 2, wherein one or more ribonucleic acid sequences encoding a peptide antigen(s) is fused with the sequence encoding a polypeptide targeting motif, and wherein an amino-terminus of the peptide antigen is coupled to a carboxyl terminus of the targeting motif.

4. The synthetic mRNA molecule of any one of claims 2-3, wherein the polypeptide targeting motif comprises a Clec9a binding motif.

5. The synthetic mRNA molecule of any one of claims 2-4, wherein the polypeptide targeting motif comprises an amino acid sequence WPRFHSSVRHTH (SEQ ID NO:23).

6. The synthetic mRNA of any one of claims 1-5, wherein the ribonucleic acid sequence(s) encoding each of the antigen(s) or targeting motif(s), and each of the ribonucleic acid sequence(s) encoding the adjuvant(s) and / or other immuno-modulatory agent(s) are connected via one or more cleavable linker(s).

7. The synthetic mRNA of claim 6, wherein the one or more linker(s) comprise, independently, a 2A linker, or an IRES sequence.

8. The synthetic mRNA of claim 7, wherein the 2A linker is selected from the group consisting of a T2A linker, a P2A linker, an E2A linker, and an F2A linker.

9. The synthetic mRNA of claim 8, wherein the 2A linker is a P2A linker.45738066.110110. The synthetic mRNA of any one of claims 7-9, wherein the 2A linker further comprises a Gly-Ser-Gly sequence at the N-terminal region.

11. The synthetic mRNA of any one of claims 6-10, further comprising a Furin cleavage site.

12. The synthetic mRNA of claim 11, comprising a cleavable linker comprising a Furin cleavage site and a 2A linker, wherein the furin cleavage site and 2A linker are connected via a Gly-Ser-Gly polypeptide sequence, optionally wherein the cleavable linker comprises the nucleic acid sequence of SEQ ID NO:35 .

13. The synthetic mRNA of any one of claims 1-12, comprising a single 5’ Cap 1 structure.

14. The synthetic mRNA of any one of claims 1-13, comprising a poly Adenylated 3’ tail structure.

15. The synthetic mRNA of any one of claims 1-14, comprising a single 5’ untranslated region (5’ UTR).

16. The synthetic mRNA of any one of claims 1-15, comprising a single 3’ untranslated region (3’ UTR).

17. The synthetic mRNA of claim 1 or 2, comprising from 5’ to 3’ (i) a 5’Cap 1 structure; (ii) a 5’untranslated region (5’UTR); (iii) a sequence encoding a first polypeptide; (iv) a first Furin cleavage sequence; (v) a first 2A linker sequence, optionally including an N-terminal Gly-Ser-Gly; (vi) a sequence encoding a second polypeptide; (vii) a 3’untranslated region (3’UTR); and (viii) a poly Adenylated 3’tail; wherein one of the first or the second polypeptide encodes the peptide antigen and optionally a targeting motif; and wherein one of the first or the second polypeptide encodes a peptide adjuvant or other immuno-modulatory agent.

18. The synthetic mRNA of claim 1 or 2, comprising from 5’ to 3’ (i) a 5’ Cap 1 structure; (ii) a 5’untranslated region (5’ UTR); 455738066.1(iii) a sequence encoding a first polypeptide; (iv) a first Furin cleavage sequence; (v) a first 2A linker sequence, optionally including an N-terminal Gly-Ser-Gly; (vi) a sequence encoding a second polypeptide; (vii) a second Furin cleavage sequence; (viii) a second 2A linker sequence, optionally including an N-terminal Gly-Ser-Gly; (ix) a sequence encoding a third polypeptide; (x) a 3’untranslated region (3’ UTR); and (xi) a poly Adenylated 3’ tail; wherein the first or the second polypeptide encodes a first peptide antigen and optionally a targeting motif, wherein the first or the second polypeptide encodes a first peptide adjuvant and / or other immuno-modulatory agent, and wherein the third polypeptide encodes a second peptide adjuvant and / or other immuno-modulatory agent, or a second peptide antigen.

19. The synthetic messenger ribonucleic acid (mRNA) molecule of any one of claims 1-18, wherein the one or more ribonucleic acid sequences encoding an antigen encodes a peptide antigen derived from a source selected from group consisting of a bacteria, virus, protozoan, fungus and a cancer; and wherein the one or more ribonucleic acid sequence(s) encoding an adjuvant encodes a functional IL2 or a functional derivative or fragment thereof, or a functional IL7, or a functional derivative or fragment thereof, or wherein the ribonucleic acid sequence(s) encodes both a functional IL2 and a functional IL7 or functional derivatives or fragments thereof.

20. A nanoparticle comprising the synthetic mRNA of any one of claims 1-19.

21. The nanoparticle of claim 20, wherein the synthetic mRNA is encapsulated within the nanoparticle.

22. A cell comprising the nanoparticle of claim 20 or 21.

23. A synthetic nanoparticle for the delivery of therapeutic and / or prophylactic agents to a subject, comprising: (a) one or more ribonucleic acid sequences encoding one or more peptide antigen(s); and 455738066.1 103(b) one or more ribonucleic acid sequences encoding one or more peptide adjuvant(s) and / or other immuno-modulatory agent(s); wherein the ribonucleic acids are encapsulated within the nanoparticle.

24. The nanoparticle of claim 23, wherein the one or more ribonucleic acid sequences encoding the one or more antigen(s) and the one or more adjuvant(s) and / or other immuno- modulatory agent(s) are comprised within the same ribonucleic acid.

25. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-24, wherein the ribonucleic acid sequence(s) comprises between approximately 100 and 15,000 bases, inclusive.

26. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-25, wherein the ribonucleic acid sequence(s) encode two or more species of protein antigens.

27. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-26 , wherein the ribonucleic acid sequence(s) encode two or more species of protein adjuvants and / or other immuno-modulatory agents.

28. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-27,, wherein one or more peptide antigen(s) is derived from a source selected from the group consisting of an infectious agent, a parasite, a cancer and a peptide allergen.

29. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-28, wherein one or more peptide antigen(s) is derived from an infectious agent selected from the group consisting of a virus, a fungi, a protozoan and a bacterium.

30. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-29, wherein one or more peptide antigen(s) is derived from a virus.

31. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-30, wherein one or more peptide antigen(s) is derived from a virus selected from the group consisting of a filovirus, an arenavirus, a coronavirus an orthopoxvirus and an orthomyxovirus.

32. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-31, , wherein one or more peptide antigen(s) is derived from a virus selected from the group consisting of Merkel Cell Polyomavirus (MCPyV), Influenza virus, Ebola virus, Zika Virus, and SARS-CoV-2.

33. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-32 , wherein one or more peptide antigen(s) is derived from a fungus. 455738066.1 10434. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-33 , wherein one or more peptide antigen(s) is derived from a fungus selected from the group consisting of Candida albicans, Aspergillus fumigatus, Candida auris, Cryptococcus neoformans, and Candida glabrata.

35. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-34, , wherein one or more peptide antigen(s) is derived from a cancer.

36. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-35, , wherein one or more peptide antigen(s) is derived from a cancer selected from the group consisting of alpha-actinin-4, Alphafetoprotein (AFP), Bcr-Abl fusion protein, Carcinoembryonic antigen (CEA), CA-125, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, epithelial tumor antigen, EF2, ETV6-AML1 fusion protein, LDLR-fucosyltransferaseAS fusion protein, HLA-A2, HLA-A11, hsp70-2, KIAAO205, Mart2, Mum-1, 2, and 3, neo-PAP, myosin class I, OS-9, pml-RARa fusion protein, PTPRK, K-ras, N-ras, Triosephosphate isomeras, Bage-1, Gage 3,4,5,6,7, GnTV, Herv-K-mel, Lage-1, Melanoma-associated antigen (MAGE);Mage-A1,2,3,4,6,10,12, Mage- C2, NA-88, NY-Eso-1 / Lage-2, SP17, SSX-2, and TRP2-Int2, MelanA (MART-I), gp100 (Pmel 17), tyrosinase, TRP-1, TRP-2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, p15(58), CEA, RAGE, NY-ESO (LAGE), SCP-1, Hom / Mel-40, PRAME, p53, H-Ras, HER- 2 / neu, BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus (HPV) antigens E6 and E7, TSP-180, MAGE-4, MAGE-5, MAGE-6, p185erbB2, p180erbB-3, c-met, nm-23H1, PSA, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, b-Catenin, CDK4, Mum-1, p16, TAGE, PSMA, PSCA, CT7, telomerase, 43-9F, 5T4, 791Tgp72, a-fetoprotein, 13HCG, BCA225, BTAA, CA 125, CA 15- 3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, G250, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7-Ag, MOV18, MUC-1, NB\70K, NY-CO- 1, RCAS1, SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated protein), TAAL6, TAG72, TLP, tyrosinase, and TPS.

37. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-36, wherein one or more peptide antigen(s) is derived from a bacterium selected from the group consisting of Bacillus, Yersinia, Spirochetes, Rickettsia, Staphylococcus aureus, and Escherichia coli.

38. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-37, wherein one or more peptide antigen(s) is tolerogenic antigen, optionally derived from an allergen. 455738066.1 10539. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-38, wherein one or more peptide antigen(s) is derived from a protozoan.

40. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-39, wherein one or more peptide adjuvants is selected from the group consisting of a cytokine, a TLR agonist, a pattern recognition receptor, a chemotactic factor, and a transcriptional regulator.

41. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-40, wherein the cytokine is selected from the group consisting of IL-2, IL- 7, and IL-15.

42. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-41, wherein the other immuno-modulatory agent is selected from the group consisting of IL-2, IL-7, IL-15, ICAM-1, LFA-1, CD2, LFA3 (CD58), CD28, CD152 CD80, CD86, class I MHC, class II MHC, CD40L, Flt3L, Flt3, OX40, OX40L, GITR, CD137, PD1, TIGIT, TIM3, LAG3, and CLec9-targeting agents or a combination thereof.

43. The synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of claims 20-21 or 23-42, wherein the mRNA encodes (i) a functional IL-2, or a functional derivative or fragment thereof; and (ii) a functional IL-7 or a functional derivative or fragment thereof.

44. A cell comprising the nanoparticle of any one of claims 20-21 or 23-43,.

45. A pharmaceutical composition comprising the synthetic mRNA of any one of claims 1-19 or the nanoparticle of any one of 20-21 or 23-43 and a pharmaceutically acceptable excipient.

46. The pharmaceutical composition of claim 45, further comprising one or more additional active agents.

47. A method of inducing an immune response to a peptide antigen in a subject comprising administering to the subject the pharmaceutical composition of claim 45 or 46 in an amount effective to induce or stimulate an immune response in the subject to the peptide antigen(s).

48. The method of claim 47, wherein the immune response to the peptide antigen(s) is effective to treat or prevent an infection and / or disease in the subject caused by the organism or agent from which the antigen is derived.

49. The method of claim 47 or 48, wherein the antigen is a tumor antigen.

50. The method of claim 49, wherein the tumor antigen is an autologous tumor antigen. 455738066.1 10651. The method of claim 47 or 48, wherein the antigen is derived from a pathogenic bacterium.

52. The method of claim 47 or 48, wherein the antigen is derived from a pathogenic virus.

53. The method of claim 47 or 48, wherein the antigen is derived from a pathogenic fungus.

54. The method of claim 47 or 48, wherein the antigen is derived from a pathogenic protozoan.

55. A method of treating a subject having a disease, disorder, or condition comprising administering to the subject an effective amount of the pharmaceutical composition of claim 45 or 46 to treat or reduce a symptom of the disease, disorder, or condition in the subject.

56. The method of any one of claims 47 to 55, wherein the composition is administered to the patient via intramuscular, intravenous, subcutaneous or intraperitoneal injection.

57. The method of any one of claims 47 to 56, wherein the subject has a disease or disorder, or has been identified as being at increased risk of getting a disease or disorder.

58. The method of claim 57, wherein the subject has cancer, or has been identified as being at increased risk of getting a cancer.

59. The method of claim 57, wherein the subject has an infectious disease, or has been identified as being at increased risk of getting an infectious disease.

60. A kit comprising the synthetic mRNA of any one of claims 1-19 or 23-42, or the nanoparticle of any one of 20-21 or 23-42, optionally wherein the kit further comprises instructions for the method of any one of claims 47-59.

61. A nucleic acid comprising the sequence of SEQ ID NO:

18.

62. A nucleic acid comprising the sequence of SEQ ID NO:

19. 455738066.1 107

Citation Information

Patent Citations

  • Erythrocyte-binding therapeutics

    US20140356384A1

  • Bispecific signaling agents and uses thereof

    WO2017134305A1

  • Compositions and methods of use thereof for the treatment of virally driven cancers

    WO2024130009A1

  • Gene modified dendritic cell and application thereof

    CN116948967A

  • Combination therapy

    US20220387573A1