Adeno-associated virus variant capsids

Abstract

The present disclosure generally relates to engineered viral capsid polypeptides with enhanced tropism to certain target tissues and uses thereof. Also disclosed are polynucleotides encoding the engineered viral capsid polypeptides, and vectors, cells, or compositions comprising the same and uses thereof.

Description

ADENO-ASSOCIATED VIRUS VARIANT CAPSIDSCROSS REFERENCE TO RELATED APPLICATION

[0001] This application claims priority to International Application No. PCT / CN2024 / 100741, filed on June 21, 2024, the content of which is incorporated by reference in its entirety. FIELD OF DISCLOSURE

[0002] The present disclosure generally relates to engineered viral capsid polypeptides with enhanced tropism to target tissues and uses thereof. Also disclosed are polynucleotides encoding the engineered viral capsid polypeptides, and vectors, cells, or compositions comprising the same and uses thereof.BACKGROUND

[0003] Gene therapy is a new therapeutic modality that delivers genetic materials or genetic modifying tools, called payloads, into cells to correct abnormality caused by genetic defects. Among the various vectors utilized for delivery purposes, adeno-associated virus (AAV) stands out as a prominent choice.

[0004] Adeno-associated virus (AAV) is a single-stranded DNA parvovirus. The AAV genome comprises a rep gene and a cap gene flanked by two inverted terminal repeats (ITRs) . The rep gene encodes Rep78, Rep68, Rep52, and Rep40 proteins responsible for AAV genome replication and virion assembly. The cap gene encodes three capsid proteins (virion protein 1 (VP1) , VP2, and VP3) , and each AAV virion has 60 VP subunits assembled at a 1: 1: 10 ratio of VP1: VP2: VP3. At the virion surface, there are variable regions that determine the properties of AAV as a gene delivery vector, including organ tropism, in vivo trafficking, immunogenicity, etc.

[0005] AAV is commonly used to deliver payloads through various routes of administration, in which intravenous (i.v. ) injection is applied in most FDA-approved gene therapies. However, natural AAV serotypes have strong liver tropism by systematic injection, with 10 to 1,000-fold enrichment over the other therapeutically relevant tissues, e.g., the central nerve systems (CNS) . 1014 vg / kg AAV is applied in FDA or EMA approved medicines to achieve efficacy when gene therapy targets a non-liver tissue (Thomsen, Gretchen, et al. "Biodistribution of onasemnogene abeparvovec DNA, mRNA and SMN protein in human tissue. " Nature medicine 27.10: 1701-1711. (2021) ; Mendell, Jerry R., et al. "Assessment of systemic delivery of rAAVrh74. MHCK7. micro-dystrophin in children with Duchenne muscular dystrophy: a nonrandomized controlled trial. " JAMA neurology 77.9: 1122-1131. (2020) ) . Thus, efforts have been made to engineer the virion surface, especially the variable region of AAV capsid proteins, to obtain target tissue tropism. SEQUENCE LISTING

[0006] This application contains a Sequence Listing electronically submitted as an XML file entitled “Seq. xml” having a size of 7, 079KB and created on June 21, 2024. The information contained in the Sequence Listing is incorporated by reference herein. SUMMARY OF THE PRESENT DISCLOSURE

[0007] The variable regions of AAV capsids involved tens of amino acids, which results in tremendous sequence space to explore and leaves enormous challenges to characterize their corresponding delivery properties through wet lab techniques. Rational design and directed evolution are two major categories to explore the preferential capsid sequences. Besides, a scoring system needs to be established to prioritize the promising candidates. There is a pressing demand for a more advanced and efficient approach to scale up the generation of candidate sequences and streamline the screening process for desired sequences. Traditional methods are proving inadequate in handling the complexity and volume of data required for comprehensive screening and selection. Therefore, a technologically advanced solution, i.e., deep learning (DL) , is employed to meet these challenges effectively.

[0008] Deep learning (DL) is essentially a neural network with three or more layers to mimic the behavior of the human brain, allowing it to learn from large amounts of data. Hence, it is possible to use deep learning to provide superior AAV variants, which can transduce more AAV vectors into targeting organs than their parental wild-type virus. The projection between the data and capsid sequence is based on the concept that the amino acid sequence of a capsid determines its three-dimensional structure, which further determines the function of that capsid.

[0009] In one aspect, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence X1-X2-Arg-Gly-Asp-X3-X4-X5, also abbreviated as X1X2RGDX3X4X5, each of X1, X2, X3, X4, and X5 is an amino acid residue.

[0010] In some embodiments, X3 of the present disclosure is an amino acid residue selected from T, S, V, A, M, N, Q, R, Y, and G (Threonine, Serine, Valine, Alanine, Methionine, Asparagine, Glutamine, Arginine, Tyrosine, and Glycine) .

[0011] In some embodiments, X4 of the present disclosure is an amino acid residue comprising a cyclic side chain. In some embodiments, X4 is one selected from F, P, Y, and W (Phenylalanine, Proline, Tyrosine, and Tryptophan) .

[0012] In some embodiments, X2 of the present disclosure is absent or an amino acid residue selected from K, A, R, G, P, T, Q, S, and V (Lysine, Alanine, Arginine, Glycine, Proline, Threonine, Glutamine, Serine, and Valine) .

[0013] In some embodiments, X1 of the present disclosure is not I or L (Isoleucine or Leucine) .

[0014] In some embodiments, X1 of the present disclosure is not any amino acid residue selected from V, I, and L (Valine, Isoleucine, and Leucine) .

[0015] In some embodiments, X5 of the present disclosure is absent or an amino acid residue selected from D, E, P, A, N, H, V, T, Q, M, E, and G (Aspartic acid, Glutamic acid, Proline, Alanine, Asparagine, Histidine, Valine, Threonine, Glutamine, Methionine, and Glycine) .

[0016] In some embodiments, X3-X4 is not Arg-Tyr.

[0017] In some embodiments, X2-Arg-Gly-Asp-X3-X4-X5 of the present disclosure is not Gly-Arg-Gly-Asp-Gln-Tyr-Thr (SEQ ID NO: 3323) .

[0018] In some embodiments, X1-X2-Arg-Gly-Asp-X3-X4-X5 of the present disclosure is not Val-Gly-Arg-Gly-Asp-Thr-Tyr-Pro (SEQ ID NO: 3324) .

[0019] In some embodiments, X3-X4 of the present disclosure is not Arg-Tyr, X2-Arg-Gly-Asp-X3-X4-X5 of the present disclosure is not Gly-Arg-Gly-Asp-Gln-Tyr-Thr (SEQ ID NO: 3323) , and X1-X2-Arg-Gly-Asp-X3-X4-X5 of the present disclosure is not Val-Gly-Arg-Gly-Asp-Thr-Tyr-Pro (SEQ ID NO: 3324) .

[0020] In some embodiments, the amino acid sequence Arg-Gly-Asp-X3-X4 of the present disclosure is selected from SEQ ID NOs: 2511-2542 as listed in Table 1.

[0021] In some embodiments, the amino acid sequence X2-Arg-Gly-Asp-X3-X4 of the present disclosure is selected from SEQ ID NOs: 2543-2752 as listed in Table 2.

[0022] In some embodiments, the amino acid sequence X1-X2-Arg-Gly-Asp-X3-X4 of the present disclosure is selected from SEQ ID NOs: 2753-3322 as listed in Table 3.

[0023] In some embodiments, the amino acid sequence X1-X2-Arg-Gly-Asp-X3-X4-X5 of the present disclosure is selected from SEQ ID NOs: 1531-2375 as listed in Table 4.

[0024] In some embodiments, the viral capsid polypeptide of the present disclosure comprises an amino acid sequence of SEQ ID NOs: 1-930 as listed in Tables 5A and 12.

[0025] In some embodiments, the viral capsid polypeptide of the present disclosure is located in a variable region of a viral capsid protein.

[0026] In some embodiments, the variable region is or around the region between the 571st residue and the 601st residue of a wildtype viral capsid protein.

[0027] In some embodiments, the variable region is or around the region between the 571st residue and the 601st residue of an engineered viral capsid protein.

[0028] In some embodiments, the variable region is or around the region between the 582nd residue and the 592nd residue of the wildtype viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV9. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAVhu68. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV6. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV6.2. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV1. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV3. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV3A. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV3B.

[0029] In some embodiments, the variable region is or around the region between the 582nd residue and the 592nd residue of the engineered viral capsid protein. In one embodiment, the engineered viral capsid protein is a viral capsid protein of AAVAnc80L65 (Zinn, Eric, et al. "In silico reconstruction of the viral evolutionary lineage yields a potent gene therapy vector. " Cell reports 12.6: 1056-1068. (2015) ) . In another embodiment, the engineered viral capsid protein is a viral capsid protein of AAV-LK03 (Paulk, Nicole K., et al. "Bioengineered AAV capsids with combined high human liver transduction in vivo and unique humoral seroreactivity. " Molecular Therapy 26.1: 289-303. (2018) ) .

[0030] In some embodiments, the variable region is or around the region between the 579th residue and the 589th residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV11. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV13.

[0031] In some embodiments, the variable region is or around the region between the 588th residue and the 598th residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAVrh32.33. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV12.

[0032] In some embodiments, the variable region is or around the region between the 580th residue and the 590th residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV4.

[0033] In some embodiments, the variable region is or around the region between the 582nd residue and the 599th residue of the wildtype or engineered viral capsid protein. In one embodiment, the engineered viral capsid protein is a viral capsid protein of AAV-PHP. S (Chan, Ken Y., et al. "Engineered AAVs for efficient noninvasive gene delivery to the central and peripheral nervous systems. " Nature neuroscience 20.8: 1172-1179. (2017) ) . In another embodiment, the engineered viral capsid protein is a viral capsid protein of AAV-PHP. eB (Chan, Ken Y., et al. "Engineered AAVs for efficient noninvasive gene delivery to the central and peripheral nervous systems. " Nature neuroscience 20.8: 1172-1179. (2017) ) .

[0034] In some embodiments, the variable region is or around the region between the 584th residue and the 594th residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAVrh74. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAVrh10. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV10. In another embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV8. In another embodiment, the engineered viral capsid protein is a viral capsid protein of AAV-Spark100 (Rasko, John, Adam Cuker, and Jonathan Ducore. "Hemophilia B Gene Therapy with a High-Specific-Activity Factor IX Variant. " (2017) ) .

[0035] In some embodiments, the variable region is or around the region between the 583rd residue and the 593rd residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV7. In another embodiment, the engineered viral capsid protein is a viral capsid protein of AAVDJ (Grimm, Dirk, et al. "In vitro and in vivo gene therapy vector evolution via multispecies interbreeding and retargeting of adeno-associated viruses. " Journal of virology 82.12: 5887-5911. (2008) ) .

[0036] In some embodiments, the variable region is or around the region between the 581st residue and the 591st residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV2.

[0037] In some embodiments, the variable region is or around the region between the 581st residue and the 601st residue of the wildtype or engineered viral capsid protein. In one embodiment, the engineered viral capsid protein is a viral capsid protein of AAV7m8 (Ramachandran, Pavitra S., et al. "Evaluation of dose and safety of AAV7m8 and AAV8BP2 in the non-human primate retina. " Human gene therapy 28.2: 154-167. (2017) ) .

[0038] In some embodiments, the variable region is or around the region between the 571st residue and the 581st residue of the wildtype or engineered viral capsid protein. In one embodiment, the wildtype viral capsid protein is a wildtype viral capsid protein of AAV5.

[0039] In some embodiments, the variable region is or around the region: 1. between position 448 and 462, 2. between position 439 and 455, 3. between position 440 and 456, 4. between position 449 and 464, 5. between position 447 and 462, 6. between position 446 and 461, 7. between position 446 and 462, 8. between position 448 and 464, 9. between position 448 and 463, 10. between position 445 and 459, 11. between position 439 and 448, 12. between position 486 and 511, 13. between position 479 and 509, 14. between position 488 and 518, 15. between position 480 and 510, 16. between position 488 and 513, 17. between position 485 and 510, 18. between position 487 and 512, 19. between position 483 and 508, 20. between position 472 and 479, 21. between position 582 and 592, 22. between position 579 and 589, 23. between position 588 and 598, 24. between position 580 and 590, 25. between position 582 and 599, 26. between position 584 and 594, 27. between position 583 and 593, 28. between position 581 and 591, 29. between position 581 and 601, 30. between position 571 and 581, of the wildtype or engineered viral capsid protein.

[0040] In some embodiments, viral capsid polypeptide of the present disclosure is inserted between any two amino acid residues in the variable region described herein of a wildtype or engineered viral capsid protein. In some embodiments, viral capsid polypeptide of the present disclosure is inserted between any two contiguous amino acid residues in the variable region described herein of a wildtype or engineered viral capsid protein. In some embodiments, 0-30 amino acids are optionally deleted from the variable region before the insertion of the viral capsid polypeptide described herein, preferably 0-10 amino acids are optionally deleted from the variable region before the insertion of the viral capsid polypeptide described herein, more preferably 1-8 amino acids are optionally deleted from the variable region before the insertion of the viral capsid polypeptide described herein. In some embodiments, the inserted viral capsid polypeptide comprises at least one overlapping amino acid residue as the deleted amino acid sequence from the variable region before the insertion of the viral capsid polypeptide described herein. For example, for illustrative purposes, when an inserted sequence such as X1RGDX2X3X4X5, wherein X5 is Q, replaces a sequence such as T1T2T3Q (wherein T1, T2, and T3 are amino acid residues) of a wildtype or engineered viral capsid protein, the inserted sequence and the deleted sequence overlap at the Q residue. In that case, X1RGDX2X3X4X5 could be inserted into a wildtype or engineered viral capsid protein to replace T1T2T3Q, or, alternatively, X1RGDX2X3X4 could be inserted into a wildtype or engineered viral capsid protein to replace T1T2T3, to achieve the same end results.

[0041] In another aspect, the present disclosure provides a viral capsid polypeptide, comprising an amino acid sequence X1’-X2’-Arg-Gly-Asp-X3’-X4’-X5’, also abbreviated as X1’X2’RGDX3’X4’X5’, each of X1’, X2’, X3’, X4’, and X5’ is an amino acid residue, and the amino acid sequence X1’-X2’-Arg-Gly-Asp-X3’-X4’-X’ 5 is selected from SEQ ID NOs: 2376-2510 as listed in Table 4.

[0042] In some embodiments, the viral capsid polypeptide of the present disclosure comprises an amino acid sequence of SEQ ID NOs: 931-1068 as listed in Table 5A.

[0043] In another aspect, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence of SEQ ID NOs: 1069-1530 as listed in Table 5A.

[0044] In some embodiments, the viral capsid polypeptide of the present disclosure comprises an amino acid sequence of SEQ ID NOs: 4863-4910 as listed in Table 5B.

[0045] In some embodiments, the viral capsid polypeptide of the present disclosure comprises an amino acid sequence of SEQ ID NOs: 4911-5658 as listed in Table 5C.

[0046] In some embodiments, the viral capsid polypeptide of the present disclosure comprises an amino acid sequence of SEQ ID NOs: 5659-6478 as listed in Table 5D.

[0047] In another aspect, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence of SEQ ID NOs: 3343-3932 as listed in Table 6.

[0048] In some embodiments, the viral capsid polypeptide of the present disclosure is a viral capsid polypeptide of an adeno associated virus (AAV) .

[0049] In some embodiments, a viral capsid polypeptide sequence selected from the sequences of Tables 5A-5D, 6 and 12 is inserted into a wildtype or engineered AAV capsid protein.

[0050] In some embodiments, the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV. In some embodiments, the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV2v4, AAVDJ, AAVrh74, AAV12, AAV13, AAV8AIT, and AAV3B.

[0051] In some embodiments, the viral capsid polypeptide is a viral capsid polypeptide of engineered adeno associated virus which is engineered by insertion and optional deletion between the 571st residue and the 601st residue of a wildtype or engineered viral capsid protein selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV.

[0052] In a preferred embodiment, the viral capsid polypeptide is a viral capsid polypeptide of an engineered AAV9, which is engineered by insertion and optional deletion between the 582nd residue and the 592nd residue of a wildtype viral capsid protein of a parental AAV9, preferably a AAV9 capsid protein according to SEQ ID NO: 3325.

[0053] In some embodiments, the viral capsid polypeptide has tropism to a target tissue. In some embodiments, the viral capsid polypeptide has tropism to multiple target tissues.

[0054] In some embodiments, the viral capsid polypeptide has tropism to muscles.

[0055] In some embodiments, the viral capsid polypeptide has tropism to a target organ. In some embodiments, the viral capsid polypeptide has tropism to multiple target organs.

[0056] In some embodiments, the viral capsid polypeptide has tropism to skeletal muscles and / or heart.

[0057] In some embodiments, the viral capsid polypeptide has tropism to lung.

[0058] In some embodiments, the viral capsid polypeptide has tropism to the CNS such as brain or spinal cord.

[0059] In another aspect, the present disclosure provides a polynucleotide encoding the viral capsid polypeptide according to the present disclosure.

[0060] In another aspect, the present disclosure provides an adeno associated virus (AAV) vector, comprising a polynucleotide described herein.

[0061] In another aspect, the present disclosure provides a kit comprising: a viral capsid polypeptide, a polynucleotide, or an adeno associated virus vector according to the present disclosure.

[0062] In another aspect, the present disclosure provides a cell comprising a viral capsid polypeptide described herein.

[0063] In another aspect, the present disclosure provides a pharmaceutical composition comprising a viral capsid polypeptide, a polynucleotide, or an adeno associated virus (AAV) vector described herein.

[0064] In another aspect, the present disclosure provides a method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with an adeno associated adeno associated virus (AAV) vector described herein, wherein the AAV vector is engineered to contain the payload polynucleotide.

[0065] In some embodiments, the cell is a somatic cell.

[0066] In some embodiments, the cell is a muscle cell.

[0067] In some embodiments, the adeno associated adeno associated virus vector comprises a capsid polypeptide which has tropism to the cell.

[0068] In some embodiments, the cell is a cardiomyocyte or a skeletal muscle cell. In some embodiments, the cell is a brain cell.

[0069] In another aspect, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5, i.e., also abbreviated as Y1RGDY2Y3Y4Y5, each of Y1, Y2, Y3, Y4, and Y5 is an amino acid residue.

[0070] In some embodiments, Y1 is selected from K and R.

[0071] In some embodiments, Y2 is absent or preferably selected from S, T, A, V, Q, N, and M.

[0072] In some embodiments, Y3 is absent or preferably selected from L, I, M, V, A, D, and P.

[0073] In some embodiments, Y4 is selected from D and E.

[0074] In some embodiments, Y5 is absent or preferably selected from A, P, V, M, E, D, G, and T.

[0075] In some embodiments, Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 is not any one selected from RRGDKADI (SEQ ID NO: 4855) , RGDMGDN (SEQ ID NO: 4856) , RRGDLNDS (SEQ ID NO: 4857) , RRGDKTEL (SEQ ID NO: 4858) , RRGDIKEY (SEQ ID NO: 4859) , RRGDYSEQ (SEQ ID NO: 4860) , and RRGDYQEL (SEQ ID NO: 4861) .

[0076] In some embodiments, the amino acid sequence Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 of the present disclosure is selected from SEQ ID NOs: 3935-4095, as listed in Tabel 7.

[0077] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 of the present disclosure comprises an amino acid sequence selected from SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 27, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 34, SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 61, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 99, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 141, SEQ ID NO: 145, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 154, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 166, SEQ ID NO: 167, SEQ ID NO: 200, SEQ ID NO: 206, SEQ ID NO: 310, SEQ ID NO: 312, SEQ ID NO: 314, SEQ ID NO: 315, SEQ ID NO: 316, SEQ ID NO: 317, SEQ ID NO: 319, SEQ ID NO: 358, SEQ ID NO: 359, SEQ ID NO: 360, SEQ ID NO: 361, SEQ ID NO: 371, SEQ ID NO: 372, SEQ ID NO: 433, SEQ ID NO: 464, SEQ ID NO: 466, SEQ ID NO: 467, SEQ ID NO: 468, SEQ ID NO: 470, SEQ ID NO: 471, SEQ ID NO: 473, SEQ ID NO: 484, SEQ ID NO: 500, SEQ ID NO: 512, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 526, SEQ ID NO: 540, SEQ ID NO: 541, SEQ ID NO: 543, SEQ ID NO: 551, SEQ ID NO: 553, SEQ ID NO: 605, SEQ ID NO: 606, SEQ ID NO: 607, SEQ ID NO: 608, SEQ ID NO: 610, SEQ ID NO: 611, SEQ ID NO: 614, SEQ ID NO: 615, SEQ ID NO: 619, SEQ ID NO: 624, SEQ ID NO: 635, SEQ ID NO: 651, SEQ ID NO: 681, SEQ ID NO: 685, SEQ ID NO: 698, SEQ ID NO: 701, SEQ ID NO: 702, SEQ ID NO: 717, SEQ ID NO: 718, SEQ ID NO: 719, SEQ ID NO: 720, SEQ ID NO: 729, SEQ ID NO: 731, SEQ ID NO: 732, SEQ ID NO: 735, SEQ ID NO: 737, SEQ ID NO: 738, SEQ ID NO: 743, SEQ ID NO: 746, SEQ ID NO: 747, SEQ ID NO: 748, SEQ ID NO: 751, SEQ ID NO: 755, SEQ ID NO: 758, SEQ ID NO: 759, SEQ ID NO: 760, SEQ ID NO: 764, SEQ ID NO: 766, SEQ ID NO: 767, SEQ ID NO: 768, SEQ ID NO: 769, SEQ ID NO: 770, SEQ ID NO: 773, SEQ ID NO: 777, SEQ ID NO: 779, SEQ ID NO: 782, SEQ ID NO: 783, SEQ ID NO: 786, SEQ ID NO: 793, SEQ ID NO: 795, SEQ ID NO: 798, SEQ ID NO: 810, SEQ ID NO: 813, SEQ ID NO: 828, SEQ ID NO: 831, SEQ ID NO: 832, SEQ ID NO: 833, SEQ ID NO: 834, SEQ ID NO: 835, SEQ ID NO: 836, SEQ ID NO: 839, SEQ ID NO: 841, SEQ ID NO: 844, SEQ ID NO: 848, SEQ ID NO: 849, SEQ ID NO: 853, SEQ ID NO: 855, SEQ ID NO: 863, SEQ ID NO: 865, SEQ ID NO: 868, SEQ ID NO: 873, SEQ ID NO: 874, SEQ ID NO: 883, SEQ ID NO: 884, SEQ ID NO: 886, SEQ ID NO: 890, SEQ ID NO: 892, SEQ ID NO: 902, SEQ ID NO: 904, SEQ ID NO: 909, SEQ ID NO: 917, SEQ ID NO: 919, SEQ ID NO: 920, SEQ ID NO: 922, SEQ ID NO: 925, SEQ ID NO: 927, SEQ ID NO: 931, SEQ ID NO: 932, SEQ ID NO: 933, SEQ ID NO: 936, SEQ ID NO: 937, SEQ ID NO: 941, SEQ ID NO: 942, SEQ ID NO: 961, SEQ ID NO: 972, SEQ ID NO: 978, SEQ ID NO: 981, SEQ ID NO: 982, SEQ ID NO: 983, SEQ ID NO: 991, SEQ ID NO: 997, SEQ ID NO: 998, SEQ ID NO: 999, SEQ ID NO: 1000, SEQ ID NO: 1004, SEQ ID NO: 1005, SEQ ID NO: 1017, SEQ ID NO: 1029, SEQ ID NO: 1035, SEQ ID NO: 1051, SEQ ID NO: 1052, SEQ ID NO: 1054, SEQ ID NO: 1056, SEQ ID NO: 1062, SEQ ID NO: 1067, and SEQ ID NO: 3934, as listed in Tables 5A-5D and 6.

[0078] In some embodiments, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’, i.e., abbreviated as Y1’RGDY2’ Y3’ Y4’ Y5’, each of Y1’, Y2’, Y3’, Y4’, and Y5’ is an amino acid residue.

[0079] In some embodiments, the amino acid sequence Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ of the present disclosure is selected from SEQ ID NOs: 4096-4193, as listed in Table 8.

[0080] In some embodiments, the viral capsid polypeptide comprising Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ of the present disclosure comprises an amino acid sequence selected from SEQ ID NO: 6, SEQ ID NO: 45, SEQ ID NO: 69, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 78, SEQ ID NO: 84, SEQ ID NO: 96, SEQ ID NO: 103, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 147, SEQ ID NO: 176, SEQ ID NO: 184, SEQ ID NO: 195, SEQ ID NO: 199, SEQ ID NO: 223, SEQ ID NO: 225, SEQ ID NO: 257, SEQ ID NO: 260, SEQ ID NO: 271, SEQ ID NO: 272, SEQ ID NO: 282, SEQ ID NO: 298, SEQ ID NO: 308, SEQ ID NO: 321, SEQ ID NO: 331, SEQ ID NO: 340, SEQ ID NO: 374, SEQ ID NO: 380, SEQ ID NO: 393, SEQ ID NO: 394, SEQ ID NO: 399, SEQ ID NO: 402, SEQ ID NO: 409, SEQ ID NO: 410, SEQ ID NO: 425, SEQ ID NO: 428, SEQ ID NO: 436, SEQ ID NO: 446, SEQ ID NO: 452, SEQ ID NO: 455, SEQ ID NO: 456, SEQ ID NO: 457, SEQ ID NO: 479, SEQ ID NO: 483, SEQ ID NO: 514, SEQ ID NO: 527, SEQ ID NO: 547, SEQ ID NO: 550, SEQ ID NO: 572, SEQ ID NO: 577, SEQ ID NO: 578, SEQ ID NO: 579, SEQ ID NO: 580, SEQ ID NO: 583, SEQ ID NO: 584, SEQ ID NO: 591, SEQ ID NO: 598, SEQ ID NO: 603, SEQ ID NO: 604, SEQ ID NO: 617, SEQ ID NO: 632, SEQ ID NO: 641, SEQ ID NO: 644, SEQ ID NO: 648, SEQ ID NO: 655, SEQ ID NO: 679, SEQ ID NO: 680, SEQ ID NO: 683, SEQ ID NO: 703, SEQ ID NO: 705, SEQ ID NO: 709, SEQ ID NO: 710, SEQ ID NO: 712, SEQ ID NO: 713, SEQ ID NO: 714, SEQ ID NO: 727, SEQ ID NO: 749, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 820, SEQ ID NO: 823, SEQ ID NO: 825, SEQ ID NO: 838, SEQ ID NO: 851, SEQ ID NO: 859, SEQ ID NO: 864, SEQ ID NO: 876, SEQ ID NO: 882, SEQ ID NO: 885, SEQ ID NO: 908, SEQ ID NO: 910, SEQ ID NO: 918, SEQ ID NO: 921, SEQ ID NO: 935, SEQ ID NO: 956, SEQ ID NO: 985, SEQ ID NO: 986, SEQ ID NO: 988, SEQ ID NO: 1032, SEQ ID NO: 1057, and SEQ ID NO: 3602, as listed in Tables 5A-5D and 6.

[0081] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ of the present disclosure is a viral capsid polypeptide of an adeno associated virus (AAV) .

[0082] In some embodiments, a viral capsid polypeptide sequence selected from the sequences of Tables 5A-5D and 6 is inserted into a wildtype or engineered AAV capsid protein.

[0083] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV. In some embodiments, the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV2v4, AAVDJ, AAVrh74, AAV12, AAV13, AAV8AIT, and AAV3B.

[0084] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ is a viral capsid polypeptide of engineered adeno associated virus which is engineered by insertion and optional deletion between the 571st residue and the 601st residue of a wildtype or engineered viral capsid protein selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV.

[0085] In a preferred embodiment, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ is a viral capsid polypeptide of engineered AAV9, which is engineered by insertion and optional deletion between the 582nd residue and the 592nd residue of a wildtype viral capsid protein, preferably a AAV9 capsid protein according to SEQ ID NO: 3325.

[0086] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to a target tissue. In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to multiple target tissues.

[0087] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to muscles.

[0088] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to a target organ. In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to multiple target organs.

[0089] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to skeletal muscles and / or heart.

[0090] In some embodiments, the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ has tropism to lung.

[0091] In another aspect, the present disclosure provides a polynucleotide encoding the viral capsid polypeptide comprising Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 or Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ according to the present disclosure.

[0092] In another aspect, the present disclosure provides an adeno associated virus (AAV) vector, comprising a polynucleotide described herein.

[0093] In another aspect, the present disclosure provides a kit comprising: a viral capsid polypeptide, a polynucleotide, or an adeno associated virus vector according to the present disclosure.

[0094] In another aspect, the present disclosure provides a cell comprising a viral capsid polypeptide described herein.

[0095] In another aspect, the present disclosure provides a pharmaceutical composition comprising a viral capsid polypeptide, a polynucleotide, or an adeno associated virus (AAV) vector described herein.

[0096] In another aspect, the present disclosure provides a method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with an adeno associated adeno associated virus (AAV) vector described herein, wherein the AAV vector is engineered to contain the payload polynucleotide.

[0097] In some embodiments, the cell is a somatic cell.

[0098] In some embodiments, the cell is a muscle cell.

[0099] In some embodiments, the adeno associated adeno associated virus vector comprises a capsid polypeptide which has tropism to the cell.

[0100] In some embodiments, the cell is a cardiomyocyte or a skeletal muscle cell.

[0101] In another aspect, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence Z1-Asn-Z2-Z3-Z4, i.e., abbreviated as Z1NZ2Z3Z4, each of Z1, Z2, Z3, and Z4 is an amino acid residue.

[0102] In some embodiments, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence Z1-Asn-Z2-Z3-Z4, i.e., abbreviated as Z1NZ2Z3Z4, each of Z1, Z2, Z3, and Z4 is an amino acid residue, and Z4 is R or K.

[0103] In some embodiments, Z1-Asn-Z2-Z3-Z4 is not Asn-Asn-Gly-Val-Lys (SEQ ID NO: 4862) , i.e., abbreviated as NNGVK (SEQ ID NO: 4862) .

[0104] In some embodiments, Z1 is absent or preferably selected from A, P, V, and T.

[0105] In some embodiments, Z2 is preferably selected from S, T, A, V, Q, N, and M.

[0106] In some embodiments, Z3 is selected from V, I, T, A, S, L, N, and G, preferably Z3 is V or I.

[0107] In some embodiments, Z4 is selected from R, K, S, Q, A, L, T, and V, preferably Z4 is R or K.

[0108] In some embodiments, the amino acid sequence Z1-Asn-Z2-Z3-Z4 of the present disclosure is selected from SEQ ID NOs: 4194-4342 of Table 9.

[0109] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 of the present disclosure comprises an amino acid sequence selected from SEQ ID NO: 861, SEQ ID NO: 1008, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114, SEQ ID NO: 1115, SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1123, SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1133, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO: 1138, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1145, SEQ ID NO: 1146, SEQ ID NO: 1147, SEQ ID NO: 1148, SEQ ID NO: 1150, SEQ ID NO: 1151, SEQ ID NO: 1161, SEQ ID NO: 1162, SEQ ID NO: 1163, SEQ ID NO: 1167, SEQ ID NO: 1169, SEQ ID NO: 1171, SEQ ID NO: 1172, SEQ ID NO: 1173, SEQ ID NO: 1174, SEQ ID NO: 1175, SEQ ID NO: 1176, SEQ ID NO: 1177, SEQ ID NO: 1178, SEQ ID NO: 1179, SEQ ID NO: 1185, SEQ ID NO: 1193, SEQ ID NO: 1195, SEQ ID NO: 1198, SEQ ID NO: 1199, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1223, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1245, SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1258, SEQ ID NO: 1263, SEQ ID NO: 1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1287, SEQ ID NO: 1288, SEQ ID NO: 1289, SEQ ID NO: 1290, SEQ ID NO: 1299, SEQ ID NO: 1300, SEQ ID NO: 1301, SEQ ID NO: 1302, SEQ ID NO: 1307, SEQ ID NO: 1320, SEQ ID NO: 1321, SEQ ID NO: 1326, SEQ ID NO: 1327, SEQ ID NO: 1328, SEQ ID NO: 1329, SEQ ID NO: 1330, SEQ ID NO: 1331, SEQ ID NO: 1334, SEQ ID NO: 1336, SEQ ID NO: 1340, SEQ ID NO: 1363, SEQ ID NO: 1364, SEQ ID NO: 1367, SEQ ID NO: 1369, SEQ ID NO: 1372, SEQ ID NO: 1373, SEQ ID NO: 1379, SEQ ID NO: 1381, SEQ ID NO: 1382, SEQ ID NO: 1383, SEQ ID NO: 1385, SEQ ID NO: 1387, SEQ ID NO: 1390, SEQ ID NO: 1391, SEQ ID NO: 1392, SEQ ID NO: 1393, SEQ ID NO: 1394, SEQ ID NO: 1402, SEQ ID NO: 1403, SEQ ID NO: 1404, SEQ ID NO: 1405, SEQ ID NO: 1406, SEQ ID NO: 1407, SEQ ID NO: 1408, SEQ ID NO: 1411, SEQ ID NO: 1412, SEQ ID NO: 1418, SEQ ID NO: 1419, SEQ ID NO: 1420, SEQ ID NO: 1421, SEQ ID NO: 1422, SEQ ID NO: 1424, SEQ ID NO: 1425, SEQ ID NO: 1426, SEQ ID NO: 1427, SEQ ID NO: 1428, SEQ ID NO: 1429, SEQ ID NO: 1434, SEQ ID NO: 1435, SEQ ID NO: 1436, SEQ ID NO: 1437, SEQ ID NO: 1439, SEQ ID NO: 1445, SEQ ID NO: 1447, SEQ ID NO: 1449, SEQ ID NO: 1451, SEQ ID NO: 1453, SEQ ID NO: 1455, SEQ ID NO: 1456, SEQ ID NO: 1491, SEQ ID NO: 1499, SEQ ID NO: 3346, SEQ ID NO: 3349, SEQ ID NO: 3355, SEQ ID NO: 3363, SEQ ID NO: 3365, SEQ ID NO: 3369, SEQ ID NO: 3384, SEQ ID NO: 3385, SEQ ID NO: 3389, SEQ ID NO: 3390, SEQ ID NO: 3393, SEQ ID NO: 3394, SEQ ID NO: 3395, SEQ ID NO: 3396, SEQ ID NO: 3397, SEQ ID NO: 3398, SEQ ID NO: 3399, SEQ ID NO: 3400, SEQ ID NO: 3403, SEQ ID NO: 3404, SEQ ID NO: 3405, SEQ ID NO: 3406, SEQ ID NO: 3407, SEQ ID NO: 3408, SEQ ID NO: 3409, SEQ ID NO: 3410, SEQ ID NO: 3411, SEQ ID NO: 3412, SEQ ID NO: 3413, SEQ ID NO: 3415, SEQ ID NO: 3417, SEQ ID NO: 3418, SEQ ID NO: 3420, SEQ ID NO: 3421, SEQ ID NO: 3422, SEQ ID NO: 3424, SEQ ID NO: 3425, SEQ ID NO: 3427, SEQ ID NO: 3428, SEQ ID NO: 3429, SEQ ID NO: 3430, SEQ ID NO: 3431, SEQ ID NO: 3432, SEQ ID NO: 3433, SEQ ID NO: 3434, SEQ ID NO: 3438, SEQ ID NO: 3439, SEQ ID NO: 3440, SEQ ID NO: 3441, SEQ ID NO: 3442, SEQ ID NO: 3443, SEQ ID NO: 3444, SEQ ID NO: 3445, SEQ ID NO: 3446, SEQ ID NO: 3447, SEQ ID NO: 3451, SEQ ID NO: 3457, SEQ ID NO: 3458, SEQ ID NO: 3459, SEQ ID NO: 3460, SEQ ID NO: 3461, SEQ ID NO: 3462, SEQ ID NO: 3464, SEQ ID NO: 3466, SEQ ID NO: 3467, SEQ ID NO: 3469, SEQ ID NO: 3470, SEQ ID NO: 3471, SEQ ID NO: 3472, SEQ ID NO: 3474, SEQ ID NO: 3479, SEQ ID NO: 3480, SEQ ID NO: 3483, SEQ ID NO: 3485, SEQ ID NO: 3486, SEQ ID NO: 3487, SEQ ID NO: 3488, SEQ ID NO: 3489, SEQ ID NO: 3490, SEQ ID NO: 3491, SEQ ID NO: 3500, SEQ ID NO: 3502, SEQ ID NO: 3503, SEQ ID NO: 3504, SEQ ID NO: 3505, SEQ ID NO: 3506, SEQ ID NO: 3507, SEQ ID NO: 3509, SEQ ID NO: 3510, SEQ ID NO: 3511, SEQ ID NO: 3512, SEQ ID NO: 3513, SEQ ID NO: 3514, SEQ ID NO: 3515, SEQ ID NO: 3516, SEQ ID NO: 3517, SEQ ID NO: 3518, SEQ ID NO: 3519, SEQ ID NO: 3523, SEQ ID NO: 3526, SEQ ID NO: 3529, SEQ ID NO: 3531, SEQ ID NO: 3532, SEQ ID NO: 3533, SEQ ID NO: 3535, SEQ ID NO: 3536, SEQ ID NO: 3537, SEQ ID NO: 3538, SEQ ID NO: 3539, SEQ ID NO: 3540, SEQ ID NO: 3541, SEQ ID NO: 3542, SEQ ID NO: 3543, SEQ ID NO: 3544, SEQ ID NO: 3545, SEQ ID NO: 3546, SEQ ID NO: 3547, SEQ ID NO: 3550, SEQ ID NO: 3551, SEQ ID NO: 3552, SEQ ID NO: 3553, SEQ ID NO: 3554, SEQ ID NO: 3555, SEQ ID NO: 3556, SEQ ID NO: 3557, SEQ ID NO: 3558, SEQ ID NO: 3559, SEQ ID NO: 3560, SEQ ID NO: 3561, SEQ ID NO: 3562, SEQ ID NO: 3568, SEQ ID NO: 3569, SEQ ID NO: 3572, SEQ ID NO: 3573, SEQ ID NO: 3574, SEQ ID NO: 3575, SEQ ID NO: 3577, SEQ ID NO: 3578, SEQ ID NO: 3579, SEQ ID NO: 3580, SEQ ID NO: 3581, SEQ ID NO: 3582, SEQ ID NO: 3583, SEQ ID NO: 3584, SEQ ID NO: 3586, SEQ ID NO: 3589, SEQ ID NO: 3590, SEQ ID NO: 3591, SEQ ID NO: 3592, SEQ ID NO: 3594, SEQ ID NO: 3595, SEQ ID NO: 3597, SEQ ID NO: 3608, SEQ ID NO: 3609, SEQ ID NO: 3610, SEQ ID NO: 3611, SEQ ID NO: 3613, SEQ ID NO: 3615, SEQ ID NO: 3616, SEQ ID NO: 3619, SEQ ID NO: 3620, SEQ ID NO: 3621, SEQ ID NO: 3622, SEQ ID NO: 3623, SEQ ID NO: 3624, SEQ ID NO: 3625, SEQ ID NO: 3628, SEQ ID NO: 3629, SEQ ID NO: 3630, SEQ ID NO: 3631, SEQ ID NO: 3634, SEQ ID NO: 3635, SEQ ID NO: 3642, SEQ ID NO: 3643, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO: 3649, SEQ ID NO: 3650, SEQ ID NO: 3651, SEQ ID NO: 3652, SEQ ID NO: 3659, SEQ ID NO: 3672, SEQ ID NO: 3674, SEQ ID NO: 3675, SEQ ID NO: 3680, SEQ ID NO: 3682, SEQ ID NO: 3683, SEQ ID NO: 3684, SEQ ID NO: 3687, SEQ ID NO: 3688, SEQ ID NO: 3690, SEQ ID NO: 3691, SEQ ID NO: 3692, SEQ ID NO: 3693, SEQ ID NO: 3695, SEQ ID NO: 3697, SEQ ID NO: 3699, SEQ ID NO: 3700, SEQ ID NO: 3702, SEQ ID NO: 3722, SEQ ID NO: 3725, SEQ ID NO: 3726, SEQ ID NO: 3727, SEQ ID NO: 3728, SEQ ID NO: 3729, SEQ ID NO: 3731, SEQ ID NO: 3732, SEQ ID NO: 3734, SEQ ID NO: 3735, SEQ ID NO: 3736, SEQ ID NO: 3742, SEQ ID NO: 3743, SEQ ID NO: 3744, SEQ ID NO: 3746, SEQ ID NO: 3747, SEQ ID NO: 3748, SEQ ID NO: 3749, SEQ ID NO: 3750, SEQ ID NO: 3751, SEQ ID NO: 3752, SEQ ID NO: 3753, SEQ ID NO: 3756, SEQ ID NO: 3757, SEQ ID NO: 3758, SEQ ID NO: 3759, SEQ ID NO: 3760, SEQ ID NO: 3761, SEQ ID NO: 3762, SEQ ID NO: 3763, SEQ ID NO: 3764, SEQ ID NO: 3765, SEQ ID NO: 3766, SEQ ID NO: 3767, SEQ ID NO: 3769, SEQ ID NO: 3770, SEQ ID NO: 3771, SEQ ID NO: 3772, SEQ ID NO: 3774, SEQ ID NO: 3775, SEQ ID NO: 3776, SEQ ID NO: 3777, SEQ ID NO: 3779, SEQ ID NO: 3780, SEQ ID NO: 3781, SEQ ID NO: 3782, SEQ ID NO: 3783, SEQ ID NO: 3784, SEQ ID NO: 3785, SEQ ID NO: 3786, SEQ ID NO: 3787, SEQ ID NO: 3789, SEQ ID NO: 3791, SEQ ID NO: 3792, SEQ ID NO: 3793, SEQ ID NO: 3794, SEQ ID NO: 3795, SEQ ID NO: 3797, SEQ ID NO: 3801, SEQ ID NO: 3803, SEQ ID NO: 3804, SEQ ID NO: 3809, SEQ ID NO: 3811, SEQ ID NO: 3812, SEQ ID NO: 3814, SEQ ID NO: 3815, SEQ ID NO: 3816, SEQ ID NO: 3818, SEQ ID NO: 3841, SEQ ID NO: 3855, SEQ ID NO: 3860, SEQ ID NO: 3869, SEQ ID NO: 3883, SEQ ID NO: 3889, SEQ ID NO: 3892, SEQ ID NO: 3894, SEQ ID NO: 3895, SEQ ID NO: 3897, SEQ ID NO: 3898, SEQ ID NO: 3899, SEQ ID NO: 3913, and SEQ ID NO: 3929.

[0110] In some embodiments, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence Z1’-Asn-Z2’-Z3’-Z4’, i.e., abbreviated as Z1’ NZ2’ Z3’ Z4’, each of Z1’, Z2’, Z3’, and Z4’ is an amino acid residue.

[0111] In some embodiments, the amino acid sequence Z1’-Asn-Z2’-Z3’-Z4’ of the present disclosure is selected from SEQ ID NOs: 4343-4496, as listed in Table 10.

[0112] In some embodiments, the viral capsid polypeptide comprising Z1’-Asn-Z2’-Z3’-Z4’ of the present disclosure comprises an amino acid sequence selected from SEQ ID NO: 26, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 130, SEQ ID NO: 168, SEQ ID NO: 344, SEQ ID NO: 369, SEQ ID NO: 389, SEQ ID NO: 510, SEQ ID NO: 511, SEQ ID NO: 529, SEQ ID NO: 530, SEQ ID NO: 586, SEQ ID NO: 587, SEQ ID NO: 652, SEQ ID NO: 860, SEQ ID NO: 867, SEQ ID NO: 879, SEQ ID NO: 888, SEQ ID NO: 985, SEQ ID NO: 1007, SEQ ID NO: 1016, SEQ ID NO: 1033, SEQ ID NO: 1118, SEQ ID NO: 1122, SEQ ID NO: 1124, SEQ ID NO: 1125, SEQ ID NO: 1126, SEQ ID NO: 1143, SEQ ID NO: 1149, SEQ ID NO: 1152, SEQ ID NO: 1155, SEQ ID NO: 1159, SEQ ID NO: 1164, SEQ ID NO: 1165, SEQ ID NO: 1166, SEQ ID NO: 1168, SEQ ID NO: 1170, SEQ ID NO: 1184, SEQ ID NO: 1188, SEQ ID NO: 1190, SEQ ID NO: 1197, SEQ ID NO: 1204, SEQ ID NO: 1226, SEQ ID NO: 1227, SEQ ID NO: 1251, SEQ ID NO: 1254, SEQ ID NO: 1270, SEQ ID NO: 1278, SEQ ID NO: 1279, SEQ ID NO: 1293, SEQ ID NO: 1296, SEQ ID NO: 1304, SEQ ID NO: 1305, SEQ ID NO: 1308, SEQ ID NO: 1309, SEQ ID NO: 1310, SEQ ID NO: 1311, SEQ ID NO: 1312, SEQ ID NO: 1313, SEQ ID NO: 1314, SEQ ID NO: 1315, SEQ ID NO: 1319, SEQ ID NO: 1322, SEQ ID NO: 1323, SEQ ID NO: 1335, SEQ ID NO: 1362, SEQ ID NO: 1371, SEQ ID NO: 1377, SEQ ID NO: 1397, SEQ ID NO: 1398, SEQ ID NO: 1399, SEQ ID NO: 1400, SEQ ID NO: 1413, SEQ ID NO: 1417, SEQ ID NO: 1430, SEQ ID NO: 1448, SEQ ID NO: 1454, SEQ ID NO: 1497, SEQ ID NO: 1498, SEQ ID NO: 1500, SEQ ID NO: 3358, SEQ ID NO: 3360, SEQ ID NO: 3362, SEQ ID NO: 3370, SEQ ID NO: 3375, SEQ ID NO: 3386, SEQ ID NO: 3387, SEQ ID NO: 3388, SEQ ID NO: 3392, SEQ ID NO: 3401, SEQ ID NO: 3402, SEQ ID NO: 3414, SEQ ID NO: 3416, SEQ ID NO: 3419, SEQ ID NO: 3426, SEQ ID NO: 3435, SEQ ID NO: 3436, SEQ ID NO: 3437, SEQ ID NO: 3450, SEQ ID NO: 3455, SEQ ID NO: 3463, SEQ ID NO: 3465, SEQ ID NO: 3468, SEQ ID NO: 3475, SEQ ID NO: 3477, SEQ ID NO: 3478, SEQ ID NO: 3481, SEQ ID NO: 3482, SEQ ID NO: 3493, SEQ ID NO: 3494, SEQ ID NO: 3495, SEQ ID NO: 3496, SEQ ID NO: 3497, SEQ ID NO: 3498, SEQ ID NO: 3499, SEQ ID NO: 3501, SEQ ID NO: 3508, SEQ ID NO: 3521, SEQ ID NO: 3524, SEQ ID NO: 3534, SEQ ID NO: 3548, SEQ ID NO: 3549, SEQ ID NO: 3563, SEQ ID NO: 3564, SEQ ID NO: 3566, SEQ ID NO: 3567, SEQ ID NO: 3570, SEQ ID NO: 3585, SEQ ID NO: 3593, SEQ ID NO: 3602, SEQ ID NO: 3612, SEQ ID NO: 3614, SEQ ID NO: 3617, SEQ ID NO: 3618, SEQ ID NO: 3626, SEQ ID NO: 3627, SEQ ID NO: 3636, SEQ ID NO: 3640, SEQ ID NO: 3641, SEQ ID NO: 3644, SEQ ID NO: 3648, SEQ ID NO: 3653, SEQ ID NO: 3655, SEQ ID NO: 3657, SEQ ID NO: 3658, SEQ ID NO: 3661, SEQ ID NO: 3663, SEQ ID NO: 3664, SEQ ID NO: 3665, SEQ ID NO: 3666, SEQ ID NO: 3667, SEQ ID NO: 3668, SEQ ID NO: 3669, SEQ ID NO: 3671, SEQ ID NO: 3673, SEQ ID NO: 3678, SEQ ID NO: 3679, SEQ ID NO: 3685, SEQ ID NO: 3689, SEQ ID NO: 3696, SEQ ID NO: 3698, SEQ ID NO: 3717, SEQ ID NO: 3718, SEQ ID NO: 3720, SEQ ID NO: 3721, SEQ ID NO: 3733, SEQ ID NO: 3740, SEQ ID NO: 3754, SEQ ID NO: 3755, SEQ ID NO: 3768, SEQ ID NO: 3773, SEQ ID NO: 3778, SEQ ID NO: 3788, SEQ ID NO: 3790, SEQ ID NO: 3796, SEQ ID NO: 3798, SEQ ID NO: 3807, SEQ ID NO: 3808, SEQ ID NO: 3810, SEQ ID NO: 3813, SEQ ID NO: 3834, SEQ ID NO: 3858, SEQ ID NO: 3873, SEQ ID NO: 3884, SEQ ID NO: 3885, SEQ ID NO: 3890, SEQ ID NO: 3891, SEQ ID NO: 3893, SEQ ID NO: 3896, SEQ ID NO: 3900, SEQ ID NO: 3901, and SEQ ID NO: 3919, as listed in Tables 5A-5D and 6.

[0113] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ of the present disclosure is a viral capsid polypeptide of an adeno associated virus (AAV) .

[0114] In some embodiments, a viral capsid polypeptide sequence selected from the sequences of Tables 5A-5D and 6 is inserted into a wildtype or engineered AAV capsid protein.

[0115] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV. In some embodiments, the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV2v4, AAVDJ, AAVrh74, AAV12, AAV13, AAV8AIT, and AAV3B.

[0116] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ is a viral capsid polypeptide of engineered adeno associated virus which is engineered by insertion and optional deletion between the 571st residue and the 601st residue of a wildtype or engineered viral capsid protein selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV.

[0117] In a preferred embodiment, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ is a viral capsid polypeptide of engineered AAV9, which is engineered by insertion and optional deletion between the 582nd residue and the 592nd residue of a wildtype viral capsid protein, preferably a AAV9 capsid protein according to SEQ ID NO: 3325.

[0118] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ has tropism to a target tissue. In some embodiments, the viral capsid polypeptide Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ has tropism to multiple target tissues.

[0119] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ has tropism to nervous tissue.

[0120] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ has tropism to a target organ. In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ has tropism to multiple target organs.

[0121] In some embodiments, the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ has tropism to brain and / or spinal cord.

[0122] In another aspect, the present disclosure provides a polynucleotide encoding the viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ according to the present disclosure.

[0123] In another aspect, the present disclosure provides an adeno associated virus (AAV) vector, comprising a polynucleotide described herein.

[0124] In another aspect, the present disclosure provides a kit comprising: a viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’, a polynucleotide, or an adeno associated virus vector according to the present disclosure.

[0125] In another aspect, the present disclosure provides a cell comprising a viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ described herein.

[0126] In another aspect, the present disclosure provides a pharmaceutical composition comprising a viral capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’, a polynucleotide, or an adeno associated virus (AAV) vector described herein.

[0127] In another aspect, the present disclosure provides a method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with an adeno associated adeno associated virus (AAV) vector described herein, wherein the AAV vector is engineered to contain the payload polynucleotide.

[0128] In some embodiments, the cell is a somatic cell.

[0129] In some embodiments, the cell is a neuron cell.

[0130] In some embodiments, the adeno associated adeno associated virus vector comprises a capsid polypeptide comprising Z1-Asn-Z2-Z3-Z4 or Z1’-Asn-Z2’-Z3’-Z4’ which has tropism to the cell.

[0131] In another aspect, the present disclosure provides a viral capsid polypeptide comprising an amino acid sequence W1-Arg-Gly-Asp-W2-W3-W4-W5, i.e., also abbreviated as W1RGDW2W3W4W5, each of W1, W2, W3, W4, and W5 is an amino acid residue.

[0132] In some embodiments, W2 is selected from L, M, V, A, G, I, N, P, Q, and T (Leucine, Methionine, Valine, Alanine, Glycine, Isoleucine, Asparagine, Proline, Glutamine, and Threonine) , preferably, W2 is L or M.

[0133] In some embodiments, W5 is selected from Q, L, F, V, I, M, Y, K, N, W, and T (Glutamine, Leucine, Phenylalanine, Valine, Isoleucine, Methionine, Tyrosine, Lysine, Asparagine, Tryptophan, and Threonine) , preferably, W5 is selected from Q, L, F, V, I, M, Y, K, N, and W.

[0134] In some embodiments, the amino acid sequence W1-Arg-Gly-Asp-W2-W3-W4-W5 of the present disclosure is selected from SEQ ID NOs: 4497-4854 as listed in Table 11.

[0135] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 of the present disclosure comprises an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 10, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 58, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 75, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 86, SEQ ID NO: 93, SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 128, SEQ ID NO: 129, SEQ ID NO: 130, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 136, SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, SEQ ID NO: 148, SEQ ID NO: 152, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 165, SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 170, SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, SEQ ID NO: 175, SEQ ID NO: 178, SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 186, SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 193, SEQ ID NO: 194, SEQ ID NO: 195, SEQ ID NO: 198, SEQ ID NO: 200, SEQ ID NO: 203, SEQ ID NO: 207, SEQ ID NO: 210, SEQ ID NO: 212, SEQ ID NO: 213, SEQ ID NO: 214, SEQ ID NO: 216, SEQ ID NO: 217, SEQ ID NO: 220, SEQ ID NO: 221, SEQ ID NO: 222, SEQ ID NO: 223, SEQ ID NO: 225, SEQ ID NO: 229, SEQ ID NO: 232, SEQ ID NO: 234, SEQ ID NO: 246, SEQ ID NO: 248, SEQ ID NO: 252, SEQ ID NO: 269, SEQ ID NO: 274, SEQ ID NO: 278, SEQ ID NO: 282, SEQ ID NO: 283, SEQ ID NO: 284, SEQ ID NO: 290, SEQ ID NO: 303, SEQ ID NO: 304, SEQ ID NO: 305, SEQ ID NO: 310, SEQ ID NO: 311, SEQ ID NO: 312, SEQ ID NO: 316, SEQ ID NO: 317, SEQ ID NO: 318, SEQ ID NO: 321, SEQ ID NO: 322, SEQ ID NO: 323, SEQ ID NO: 326, SEQ ID NO: 332, SEQ ID NO: 336, SEQ ID NO: 337, SEQ ID NO: 343, SEQ ID NO: 344, SEQ ID NO: 346, SEQ ID NO: 347, SEQ ID NO: 348, SEQ ID NO: 351, SEQ ID NO: 352, SEQ ID NO: 353, SEQ ID NO: 354, SEQ ID NO: 355, SEQ ID NO: 358, SEQ ID NO: 363, SEQ ID NO: 364, SEQ ID NO: 365, SEQ ID NO: 367, SEQ ID NO: 369, SEQ ID NO: 389, SEQ ID NO: 408, SEQ ID NO: 411, SEQ ID NO: 418, SEQ ID NO: 420, SEQ ID NO: 423, SEQ ID NO: 428, SEQ ID NO: 431, SEQ ID NO: 432, SEQ ID NO: 433, SEQ ID NO: 434, SEQ ID NO: 435, SEQ ID NO: 436, SEQ ID NO: 438, SEQ ID NO: 441, SEQ ID NO: 442, SEQ ID NO: 443, SEQ ID NO: 444, SEQ ID NO: 446, SEQ ID NO: 447, SEQ ID NO: 448, SEQ ID NO: 452, SEQ ID NO: 456, SEQ ID NO: 460, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 478, SEQ ID NO: 484, SEQ ID NO: 486, SEQ ID NO: 487, SEQ ID NO: 488, SEQ ID NO: 490, SEQ ID NO: 497, SEQ ID NO: 498, SEQ ID NO: 499, SEQ ID NO: 501, SEQ ID NO: 504, SEQ ID NO: 505, SEQ ID NO: 508, SEQ ID NO: 511, SEQ ID NO: 517, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 522, SEQ ID NO: 525, SEQ ID NO: 526, SEQ ID NO: 527, SEQ ID NO: 542, SEQ ID NO: 544, SEQ ID NO: 545, SEQ ID NO: 546, SEQ ID NO: 547, SEQ ID NO: 549, SEQ ID NO: 550, SEQ ID NO: 555, SEQ ID NO: 557, SEQ ID NO: 558, SEQ ID NO: 559, SEQ ID NO: 560, SEQ ID NO: 568, SEQ ID NO: 569, SEQ ID NO: 570, SEQ ID NO: 571, SEQ ID NO: 575, SEQ ID NO: 576, SEQ ID NO: 577, SEQ ID NO: 580, SEQ ID NO: 583, SEQ ID NO: 599, SEQ ID NO: 601, SEQ ID NO: 605, SEQ ID NO: 615, SEQ ID NO: 616, SEQ ID NO: 617, SEQ ID NO: 618, SEQ ID NO: 620, SEQ ID NO: 621, SEQ ID NO: 622, SEQ ID NO: 623, SEQ ID NO: 624, SEQ ID NO: 636, SEQ ID NO: 639, SEQ ID NO: 640, SEQ ID NO: 641, SEQ ID NO: 642, SEQ ID NO: 643, SEQ ID NO: 650, SEQ ID NO: 652, SEQ ID NO: 653, SEQ ID NO: 654, SEQ ID NO: 656, SEQ ID NO: 657, SEQ ID NO: 658, SEQ ID NO: 661, SEQ ID NO: 669, SEQ ID NO: 673, SEQ ID NO: 674, SEQ ID NO: 676, SEQ ID NO: 677, SEQ ID NO: 679, SEQ ID NO: 680, SEQ ID NO: 681, SEQ ID NO: 682, SEQ ID NO: 683, SEQ ID NO: 684, SEQ ID NO: 687, SEQ ID NO: 689, SEQ ID NO: 691, SEQ ID NO: 698, SEQ ID NO: 699, SEQ ID NO: 700, SEQ ID NO: 701, SEQ ID NO: 702, SEQ ID NO: 712, SEQ ID NO: 714, SEQ ID NO: 716, SEQ ID NO: 727, SEQ ID NO: 732, SEQ ID NO: 742, SEQ ID NO: 747, SEQ ID NO: 748, SEQ ID NO: 749, SEQ ID NO: 751, SEQ ID NO: 752, SEQ ID NO: 755, SEQ ID NO: 759, SEQ ID NO: 762, SEQ ID NO: 764, SEQ ID NO: 769, SEQ ID NO: 770, SEQ ID NO: 773, SEQ ID NO: 777, SEQ ID NO: 782, SEQ ID NO: 783, SEQ ID NO: 785, SEQ ID NO: 786, SEQ ID NO: 794, SEQ ID NO: 808, SEQ ID NO: 810, SEQ ID NO: 827, SEQ ID NO: 836, SEQ ID NO: 840, SEQ ID NO: 843, SEQ ID NO: 855, SEQ ID NO: 856, SEQ ID NO: 857, SEQ ID NO: 858, SEQ ID NO: 859, SEQ ID NO: 861, SEQ ID NO: 864, SEQ ID NO: 868, SEQ ID NO: 877, SEQ ID NO: 888, SEQ ID NO: 889, SEQ ID NO: 896, SEQ ID NO: 903, SEQ ID NO: 911, SEQ ID NO: 913, SEQ ID NO: 917, SEQ ID NO: 920, SEQ ID NO: 921, SEQ ID NO: 924, SEQ ID NO: 925, SEQ ID NO: 929, SEQ ID NO: 936, SEQ ID NO: 943, SEQ ID NO: 953, SEQ ID NO: 955, SEQ ID NO: 967, SEQ ID NO: 985, SEQ ID NO: 991, SEQ ID NO: 1001, SEQ ID NO: 1006, SEQ ID NO: 1013, SEQ ID NO: 1018, SEQ ID NO: 1027, SEQ ID NO: 1028, SEQ ID NO: 1032, SEQ ID NO: 1033, SEQ ID NO: 1035, SEQ ID NO: 1036, SEQ ID NO: 1041, SEQ ID NO: 1044, SEQ ID NO: 1047, SEQ ID NO: 1048, SEQ ID NO: 1052, SEQ ID NO: 1053, SEQ ID NO: 1058, SEQ ID NO: 1059, SEQ ID NO: 1063, SEQ ID NO: 3345, SEQ ID NO: 3383, SEQ ID NO: 3437, SEQ ID NO: 3438, SEQ ID NO: 3449, SEQ ID NO: 3462, SEQ ID NO: 3464, SEQ ID NO: 3484, SEQ ID NO: 3492, SEQ ID NO: 3493, SEQ ID NO: 3505, SEQ ID NO: 3506, SEQ ID NO: 3571, SEQ ID NO: 3604, SEQ ID NO: 3681, SEQ ID NO: 3703, SEQ ID NO: 3705, SEQ ID NO: 3706, SEQ ID NO: 3707, SEQ ID NO: 3708, SEQ ID NO: 3714, SEQ ID NO: 3796, SEQ ID NO: 3811, SEQ ID NO: 3819, SEQ ID NO: 3822, SEQ ID NO: 3823, SEQ ID NO: 3824, SEQ ID NO: 3825, SEQ ID NO: 3826, SEQ ID NO: 3827, SEQ ID NO: 3828, SEQ ID NO: 3829, SEQ ID NO: 3830, SEQ ID NO: 3831, SEQ ID NO: 3832, SEQ ID NO: 3846, SEQ ID NO: 3847, SEQ ID NO: 3853, SEQ ID NO: 3855, SEQ ID NO: 3858, SEQ ID NO: 3863, SEQ ID NO: 3866, SEQ ID NO: 3869, SEQ ID NO: 3878, SEQ ID NO: 3880, SEQ ID NO: 3884, SEQ ID NO: 3902, SEQ ID NO: 3903, SEQ ID NO: 3904, SEQ ID NO: 3905, SEQ ID NO: 3906, SEQ ID NO: 3913, SEQ ID NO: 3919, SEQ ID NO: 3924, and SEQ ID NO: 3929, as listed in Tables 5A-5D and 6.

[0136] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 of the present disclosure is a viral capsid polypeptide of an adeno associated virus (AAV) .

[0137] In some embodiments, a viral capsid polypeptide sequence selected from the sequences of Tables 5A-5D and 6 is inserted into a wildtype or engineered AAV capsid protein.

[0138] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV. In some embodiments, the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV2v4, AAVDJ, AAVrh74, AAV12, AAV13, AAV8AIT, and AAV3B.

[0139] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 is a viral capsid polypeptide of engineered adeno associated virus which is engineered by insertion and optional deletion between the 571st residue and the 601st residue of a wildtype or engineered viral capsid protein selected from AAV1, AAV2, AAV3, AAV3A, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV.

[0140] In a preferred embodiment, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 is a viral capsid polypeptide of engineered AAV9, which is engineered by insertion and optional deletion between the 582nd residue and the 592nd residue of a wildtype viral capsid protein, preferably a AAV9 capsid protein according to SEQ ID NO: 3325.

[0141] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to a target tissue. In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to multiple target tissues.

[0142] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to muscles and / or nervous tissue, such as heart and / or brain.

[0143] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to a target organ. In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to multiple target organs.

[0144] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to skeletal muscles and / or heart.

[0145] In some embodiments, the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 has tropism to brain and / or spinal cord.

[0146] In another aspect, the present disclosure provides a polynucleotide encoding the viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 according to the present disclosure.

[0147] In another aspect, the present disclosure provides an adeno associated virus (AAV) vector, comprising a polynucleotide described herein.

[0148] In another aspect, the present disclosure provides a kit comprising: a viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5, a polynucleotide, or an adeno associated virus vector according to the present disclosure.

[0149] In another aspect, the present disclosure provides a cell comprising a viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 described herein.

[0150] In another aspect, the present disclosure provides a pharmaceutical composition comprising a viral capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5, a polynucleotide, or an adeno associated virus (AAV) vector described herein.

[0151] In another aspect, the present disclosure provides a method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with an adeno associated adeno associated virus (AAV) vector described herein, wherein the AAV vector is engineered to contain the payload polynucleotide.

[0152] In some embodiments, the cell is a somatic cell.

[0153] In some embodiments, the cell is a muscle cell or a neuron cell.

[0154] In some embodiments, the adeno associated adeno associated virus vector comprises a capsid polypeptide comprising W1-Arg-Gly-Asp-W2-W3-W4-W5 which has tropism to the cell.

[0155] In some embodiments, the cell is a cardiomyocyte or a skeletal muscle cell.

[0156] In another aspect, the viral capsid polypeptide described herein can also be implemented in other delivery systems to deliver a payload to one or more target organs selected from skeletal muscles, lung, brain, spinal cord, and heart. In some embodiments, sequences disclosed in Tables 1-13 and motifs such as X1X2RGDX3X4X5, X1’X2’RGDX3’X4’X5’, Y1RGDY2Y3Y4Y5, Y1'RGDY2'Y3'Y4'Y5', Z1NZ2Z3Z4, Z1'NZ2'Z3'Z4', and W1RGDW2W3W4W5 of the present application are isolated sequences which function as targeting moieties for one or more target organs selected from skeletal muscles, lung, brain, spinal cord, and heart. Specifically, any one or combination of the sequences disclosed in Tables 1-13 and motifs such as X1X2RGDX3X4X5, X1’X2’RGDX3’X4’X5’, Y1RGDY2Y3Y4Y5, Y1'RGDY2'Y3'Y4'Y5', Z1NZ2Z3Z4, Z1'NZ2'Z3'Z4', and W1RGDW2W3W4W5 of the present application can be introduced into any feasible delivery systems and serve as a targeting moiety or part thereof. In some embodiments, sequences disclosed in Tables 1-13 and motifs X1X2RGDX3X4X5, X1’X2’RGDX3’X4’X5’, Y1RGDY2Y3Y4Y5, Y1'RGDY2'Y3'Y4'Y5', Z1NZ2Z3Z4, Z1'NZ2'Z3'Z4', and W1RGDW2W3W4W5of the present application are targeting moieties or part thereof for a nanobody. In some embodiments, sequences disclosed in Tables 1-13 and motifs X1X2RGDX3X4X5, X1’X2’RGDX3’X4’X5’, Y1RGDY2Y3Y4Y5, Y1'RGDY2'Y3'Y4'Y5', Z1NZ2Z3Z4, Z1'NZ2'Z3'Z4', and W1RGDW2W3W4W5of the present application are targeting moieties or part thereof for peptide nucleic acids. In some embodiments, a targeting moiety comprises one of more (e.g., 2, 3, or 4, etc. ) of the sequences disclosed in Tables 1-13. In some embodiments, a targeting moiety comprises one or more (e.g., 2, 3, or 4, etc. ) motifs selected from X1X2RGDX3X4X5, X1’X2’RGDX3’X4’X5’, Y1RGDY2Y3Y4Y5, Y1'RGDY2'Y3'Y4'Y5', Z1NZ2Z3Z4, Z1'NZ2'Z3'Z4', and W1RGDW2W3W4W5 and any combinations thereof. In some embodiments, the targeting moiety disclosed herein further comprises a polypeptide, a polynucleotide, a peptide nucleic acid, a lipid, a polymer, a sugar, or any combination thereof. In some embodiments, a composition comprises a targeting moiety disclosed herein and a payload. In some embodiments, the payload can be any known therapy that is effective for treating muscle diseases, lung diseases, CNS diseases, and heart diseases. The payload may be a small molecule drug, a therapeutic peptide, a therapeutic transgene, an antisense oligonucleotide, an antibody, or a polynucleotide that encodes a therapy. The payload may be attached to the targeting moiety by covalent linkage or is associated with the targeting moiety non-covalently. BRIEF DESCRIPTION OF THE FIGURES

[0157] Fig. 1 illustrates an exemplary workflow and results of capsid screening and evolution in vitro and in non-human primate (NHP) . Fig. 1A shows the workflow of capsid screening and evolution. The oligo sequences of G0 or G1 library encode capsid variants, which replace the cap gene in the virus packing constructs. Oligos are amplified and cloned into backbone vectors, which are then used to pack the virion library. The transduction efficiencies of AAV variant in the virion library is estimated in various human cell types and used to train the prediction and generative deep-learning models. New sequences are generated, scored and filtered by these models before entering the next cycle of evolution. The G1 virion library is then intravenously injected into cynomolgus monkeys to determine the in vivo transduction efficiencies of the evolved AAV variants. Fig. 1B shows the percentages of superior AAV variants that emerged in the G1 library compared to the number in the G0 library, and the results are plotted for each cell type. Fig. 1C shows the maximum fitness of the superior AAV variants that emerged in the G1 library compared to the number in the G0 library, and the results are plotted for each cell type. Fig. 1D shows the viral genome copies of the AAV variants normalized to the numbers of the wild-type AAV9 in different skeletal muscles, heart, lung, and liver collected from NHP after four weeks of intravenous injection of the G1 library. Six evolved AAV variants are included. Fig. 1E shows the viral genome copies of the AAV variants normalized to the numbers of the wild-type AAV9 in different skeletal muscles, heart, and liver collected in NHP after four weeks of virion library injection intravenously. Six AAV variants evolved and four reported MyoAAV variants are included.

[0158] Fig. 2 illustrates the results of capsid validation in rhabdomyosarcoma (RD) cells and primary human skeletal muscle cells (SMCs) . Fig. 2A shows the workflow of capsid validation, in which RD cells are transduced by AAV serotypes at MOI = 1 × 101 -1 × 104, and primary skeletal muscle cells are transduced at MOI = 1 × 101 -1 × 105. Fig. 2B shows the fluorescent RD cells transduced by various AAV serotypes, and each row represents one AAV MOI. Fig. 2C shows the percentage of green fluorescent protein (GFP) fluorescent RD cells in (B) analyzed by flow cytometry. Fig. 2D shows the mean fluorescent intensity (MFI) of GFP fluorescent RD cells in (B) analyzed by flow cytometry. Fig. 2E shows the fluorescent human primary SMCs transduced by various AAV serotypes, and each row represents one AAV MOI. Fig. 2F shows the percentage of GFP fluorescent SMCs in (D) and two other donors analyzed by flow cytometry. Fig. 2G shows the MFI of GFP fluorescent SMCs in (D) and two other donors analyzed by flow cytometry.

[0159] Fig. 3 illustrates the identification of host cell receptors and ligand motifs. Fig. 3A shows the workflow of CRISPR screening of identifying genes contributing to virus entry to host cells. The lenti-Brunello CRISPR library with customized backbone are transduced to Cas9-expressing RD cells grown from mono clone. Puromycin-selected RD cells are further transduced with various AAV serotypes carrying eGFP payload. The cell population is sorted according to the expressed eGFP signals, and both the top 20%and the bottom 20%cells are collected for NGS. Figs. 3B and 3C show volcano plots illustrating the distribution of genes given their FDR (y-axis) and log2 fold-change (x-axis) obtained in CRISPR screening conducted in RD cells transduced by AAV-MUS001-eGFP (B) or AAV-MUS002-eGFP (C) . The top ten candidate genes are marked with colorful rectangles. Fig. 3D and 3E show the percentage of GFP fluorescent knock-out RD cells transduced by AAV-MUS001-eGFP (D) and AAV-MUS002-eGFP (E) . The RD cells were knocked out with AAVR, TM9SF2, ITGB5, ITGAV, or SLC35B2. No sgRNA: RD cells without gene knock-out. NT: RD cells were knocked out with a sgRNA without a target in the genome. Fig. 3F shows a Seq-logo plot illustrating the motifs represented by the top muscle-, heart-, and lung-tropic capsid variants identified from the G1 screening in NHP.

[0160] Fig. 4 illustrates the validation of muscle-tropic AAV variants in NHP. Fig. 4A shows the workflow of NHP validation of muscle-tropic AAV variants, in which AAV-WT-mCherry is mixed at equal amount with AAV-MUS001-eGFP or AAV-MUS002-eGFP. The mixed virion particles are intravenously injected into cynomolgus monkey at 1.5 × 1013 vg / kg per serotype. Fig. 4B shows eGFP signals from tissue samples collected from the experimental animal injected with the mixed AAV-MUS002-eGFP and AAV-WT-mCherry, which is illustrated by immunostaining. Fig. 4C shows a bar plot illustrating the viral genome copies of the AAV variants normalized to the numbers of the wild-type AAV9 in different skeletal muscles, heart, and liver collected from NHP after four weeks of intravenous injection. Figs. 4D and 4E show bar plots illustrating the viral genome copies per diploid genome delivered by the wild-type and AAV-MUS001 (D) or AAV-MUS002 (E) in major muscle tissues, heart, and the liver. Figs. 4F and 4G show bar plots illustrating the viral genome copies per diploid genome delivered by the wild-type and AAV-MUS001 (F) or AAV-MUS002 (G) in other muscle tissues, organs, and CNS.

[0161] Fig. 5 shows three positions (Position 1, Position 2, and Position 3) in the cap gene of AAV that could accommodate inserted polypeptide sequences. Fig. 5A shows the three-dimensional structure of the wild-type AAV9, with Position 1 (S448-K462) , Position 2 (Q486-L511) , and Position 3 (T582-Q592) marked. Fig. 5B lists the corresponding positions of the Position 1, Position 2, and Position 3 of the wild-type Cas9 in other AAV serotypes. Fig. 5C shows a region of the multiple sequence alignment of the amino acid sequences of capsids from 27 serotypes. In that region, the Position 1, Position 2, and Position 3 of the wild-type Cas9 and their corresponding positions in the other 26 serotypes were marked in rectangles.

[0162] Fig. 6 shows Seq-logo plots illustrating alternative motifs represented by the top muscle-, heart-, and lung-tropic capsid variants (A) , and motifs represented by the top brain-, heart, and muscle-tropic capsid variants (B) and motifs represented by the top brain-and heart-tropic capsid variants (C) identified from the screening in NHP.

[0163] Fig. 7 illustrates a capsid validation workflow in human cell lines, such as, hCMEC cells, SH-SY5Y cells, and HMC3 cells, which were transduced by AAV variants at MOI = 1 × 103 -1 × 105.

[0164] Fig. 8 shows the images of fluorescent hCMEC cells (A) , SH-SY5Y cells (B) , and HMC3 (C) cells transduced by the wild-type AAV9 and various AAV9 variants, in which each row represented one AAV MOI. AAV variants illustrated herein include: AAV9, AAV-BBB001, AAV-BBB002, AAV-BBB003, AAV-BBB004, AAV-BBB005, and AAV-BBB006.

[0165] Fig. 9 shows the percentage of GFP fluorescent cells (A, C, E) and MFI (E, D, F) measured from the transduced hCMEC cells (A-B) , SH-SY5Y cells (C-D) , and HMC3 cells (E-F) . AAV variants illustrated herein include: AAV9, AAV-BBB001, AAV-BBB002, AAV-BBB003, AAV-BBB004, AAV-BBB005, and AAV-BBB006.

[0166] Fig. 10 shows the images of fluorescent hCMEC cells (A) , SH-SY5Y cells (B) , and HMC3 (C) cells transduced by various the wild-type AAV9 and AAV9 variants. Each row represented one AAV MOI. AAV variants illustrated herein include: AAV9, AAV-BBB001, AAV-BBB007, AAV-BBB008, AAV-BBB009, AAV-BBB010, AAV-BBB011, AAV-BBB012, AAV-BBB013, and AAV-BBB014.

[0167] Fig. 11 shows the percentage of GFP fluorescent cells (A, C, E) and MFI (E, D, F) measured from the transduced hCMEC cells (A-B) , SH-SY5Y cells (C-D) , and HMC3 cells (E-F) . AAV variants illustrated herein include: AAV9, AAV-BBB001, AAV-BBB007, AAV-BBB008, AAV-BBB009, AAV-BBB010, AAV-BBB011, AAV-BBB012, AAV-BBB013, and AAV-BBB014.

[0168] Fig. 12 shows validation of CNS-tropic AAV variants in NHP. Fig. 12A illustrates a workflow of NHP validation of CNS-tropic AAV variants, in which AAV-WT-SMN1 was mixed in equal amounts with AAV-BBB001-eGFP, and the mixed virion particles were intravenously injected into a cynomolgus monkey at 3 × 1013 vg / kg per variant. Fig. 12B is a bar plot illustrating the viral genome copies of the AAV variants normalized by the numbers of the wild-type AAV9 in different brain regions and peripheral organs. The actual viral copies delivered into various brain regions by AAV9-WT and AAV-BBB001 were quantified by Taqman qPCR. The ratio of viral copies delivered by AAV9-WT andAAV-BBB001 were shown in the x-axis, while the bar length indicates the mean value, and the error bars indicates the standard deviation. The mean value of the viral copies delivered by each AAV serotype was used to calculate the fold-change.DETAILED DESCRIPTION

[0169] All publications, patents, and patent applications referred to herein are incorporated by reference in their entirety to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference in its entirety.

[0170] In the present disclosure, unless otherwise specified, the scientific and technical terms used herein have meanings generally understood by a person skilled in the art. Although any methods and materials similar or equivalent to those described herein find use in the practice of the present disclosure, the preferred methods and materials are described herein. Accordingly, the terms defined herein are more fully described by reference to the Specification as a whole.

[0171] As used herein, the singular terms “a, ” “an, ” and “the” include the plural reference unless the context clearly indicates otherwise.

[0172] As used herein, “and / or” refers to and encompasses any and all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted in the alternative ( “or” ) . Moreover, the present invention also contemplates that in some embodiments of the invention, any feature or combination of features set forth herein can be excluded or omitted.

[0173] Unless the context requires otherwise, the terms “comprise, ” “comprises, ” and “comprising, ” or similar terms are intended to mean a non-exclusive inclusion, such that a recited list of elements or features does not include those stated or listed elements solely, but may include other elements or features that are not listed or stated.

[0174] Unless otherwise indicated amino acid sequences are written left to right in amino to carboxy orientation, respectively. A number “n” , when used in the context of an amino acid sequence, refers to the nth amino acid in the amino acid sequence counting from the amino end. For example, “amino acid 15” refers to the 15th amino acid in a certain amino acid sequence. For example, “R15” refers to the 15th amino acid, which is an arginine (R) , in a certain amino acid sequence.

[0175] It is to be understood that this disclosure is not limited to the particular methodology, protocols, and reagents described, as these may vary, depending upon the context in which they are used by those skilled in the art.

[0176] As used herein, the term “about” will be understood by persons of ordinary skill in the art and will vary to some extent depending on the context in which it is used. In some embodiments, the term “about” when referring to a value is meant to encompass art-accepted variations. In some embodiments, the term “about” when referring to such values, is meant to encompass variations of ±20%or ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1%from the specified value, as such variations are appropriate in the context in which the term “about” is used.

[0177] As used herein, the terms “percent identity” and “%identity, ” as applied to nucleic acid or polynucleotide sequences, refer to the percentage of residue matches between at least two nucleic acid or polynucleotide sequences aligned using a standardized algorithm. Such an algorithm may insert, in a standardized and reproducible way, gaps in the sequences being compared in order to optimize alignment between two sequences, and therefore achieve a more meaningful comparison of the two sequences.

[0178] Percent identity between nucleic acid or polynucleotide sequences may be determined using a suite of commonly used and freely available sequence comparison algorithms provided by the National Center for Biotechnology Information (NCBI) Basic Local Alignment Search Tool (BLAST) (Altschul, S. F. et al. J. Mol. Biol. 215: 403-410, (1990) ) , which is available from several sources, including the NCBI, Bethesda, Md., and on the Internet at http:  / / www. ncbi. nlm. nih. gov / BLAST / .

[0179] Nucleic acid or polynucleotide sequences that do not show a high degree of identity may nevertheless encode similar amino acid sequences due to the degeneracy of the genetic code. It is understood that changes in a nucleic acid sequence can be made using this degeneracy to produce multiple nucleic acid sequences that all encode substantially the same protein. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and / or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res 19: 5081; Ohtsuka et al. (1985) J Biol Chem 260: 2605-2608; Cassol et al. (1992) ; Rossolini et al. (1994) Mol Cell Probes 8: 91-98) . The term “nucleic acid” refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single-or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. The term nucleic acid is used interchangeably with polynucleotide, and (in appropriate contexts) gene, cDNA, and mRNA encoded by a gene.

[0180] As used herein, “percent (%) amino acid sequence identity” with respect to a peptide, polypeptide or protein sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in another peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Percent amino acid sequence identity in the current disclosure is measured using BLAST software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.

[0181] An amino acid substitution refers to the replacement of one amino acid in a polypeptide with another amino acid. Amino acid substitutions can be conservative or non-conservative substitutions. Amino acid substitutions may be introduced into a protein of interest and the products screened for a desired activity, for example, retained / improved biological activity.

[0182] Amino acids may be grouped according to common side-chain properties:

[0183] (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile;

[0184] (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln;

[0185] (3) acidic: Asp, Glu;

[0186] (4) basic: His, Lys, Arg;

[0187] (5) residues that influence chain orientation: Gly, Pro;

[0188] (6) aromatic: Trp, Tyr, Phe.

[0189] The term “nucleic acid” or “polynucleotide” refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single-or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) , alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and / or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19: 5081 (1991) ; Ohtsuka et al., J. Biol. Chem. 260: 2605-2608 (1985) ; and Rossolini et al., Mol. Cell. Probes 8: 91-98 (1994) ) .

[0190] The term “polypeptide” is intended to encompass a singular “polypeptide” as well as plural “polypeptides, ” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds) . The term “polypeptide” refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product. Thus, “peptides, ” “protein” , or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of “polypeptide, ” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms. The term “polypeptide” is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting / blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis.

[0191] As used herein, the term “encode” or “encoding” as it is applied to polynucleotides refers to a polynucleotide which is said to “encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and / or translated to produce the mRNA for the polypeptide and / or a fragment thereof. The antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.

[0192] The term “genetic modification” and its grammatical equivalents, as used herein can refer to one or more alterations of a nucleic acid, e.g., the nucleic acid within an organism’s genome. For example, genetic modification can refer to alterations, additions, and / or deletion of genes or portions of genes or other nucleic acid sequences. A genetically modified cell can also refer to a cell with an added, deleted, and / or altered gene or portion of a gene. A genetically modified cell can also refer to a cell with an added nucleic acid sequence that is not a gene or gene portion. Genetic modifications include, for example, both transient knock-in or knock-down mechanisms, and mechanisms that result in permanent knock-in, knock-down, or knock-out of target genes or portions of genes or nucleic acid sequences. Genetic modifications include, for example, both transient knock-in and mechanisms that result in permanent knock-in of nucleic acids sequences. Genetic modifications also include, for example, reduced or increased transcription, reduced or increased mRNA stability, reduced or increased translation, and reduced or increased protein stability.

[0193] Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron (s) .

[0194] The term “expression” refers to the transcription and / or translation of a particular nucleotide sequence driven by its promoter.

[0195] The term “effective amount” or “therapeutically effective amount” is used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result. The term “endogenous” refers to any material from or produced inside an organism, cell, tissue or system.

[0196] As used herein, a composition refers to any mixture of two or more products, substances, or compounds, including cells.

[0197] The term “subject” means any animal such as a mammal, e.g., a human.

[0198] The term “transfer vector” or “vector” refers to a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell. Numerous vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses. Thus, the term “transfer vector” includes an autonomously replicating plasmid or a virus. The term should also be construed to further include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, a polylysine compound, liposome, and the like. Examples of viral transfer vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.

[0199] Engineered viral capsids can be variants of a parental viral capsid such as a wild-type viral capsid. For example, in some embodiments, the engineered AAV capsids can be variants of wild-type AAV capsids. In some embodiments, the wild-type AAV capsids can be composed of VP1, VP2, VP3 capsid proteins or a combination thereof. In other words, the engineered AAV capsids can include one or more variants of a wild-type VP1, wild-type VP2, and / or wild-type VP3 capsid proteins. In some embodiments, the serotype of the reference (also called “parental” herein) wild-type AAV capsid can be AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-8, AAV-9, etc., or any combination thereof. In some embodiments, the serotype of the wild-type AAV capsid can be AAV-9. The engineered AAV capsids can have a different tropism than that of the reference wild-type AAV capsid.

[0200] As used herein, the term "serotype" is a distinction used to refer to an AAV having a capsid that is serologically distinct from other AAV serotypes. Serologic distinctiveness is determined on the basis of the lack of cross-reactivity between antibodies to one AAV as compared to another AAV. Such cross-reactivity differences are usually due to differences in capsid protein sequences / antigenic determinants (e.g., due to VP1, VP2, and / or VP3 sequence differences of AAV serotypes) .

[0201] As used herein, the engineered AAV capsid polypeptide contains a sequence which is inserted between two amino acids in a variable amino acid region in an AAV capsid protein, whether it is wild type or a variant thereof. In addition to the insertion, flanking amino acids in the variable amino acid region of the wild-type or engineered capsid protein can optionally be deleted.

[0202] The core of each wild-type AAV viral protein contains an eight-stranded beta-barrel motif (betaB to betaI) and an alpha-helix (alphaA) that are conserved in autonomous parvovirus capsids (see e.g., DiMattia et al. J. Virol. 86 (12) : 6947-6958, (2012) ) . Structural variable regions (VRs) occur in the surface loops that connect the beta-strands, which cluster to produce local variations in the capsid surface. AAVs have 12 variable regions (also referred to as hypervariable regions) (see e.g., Weitzman and Linden. 2011. “Adeno-Associated Virus Biology. ” In Snyder, R.O., Moullier, P. (eds. ) Totowa, N.J.: Humana Press) .

[0203] In some embodiments, one or more engineered polypeptide sequences can be inserted between two amino acids in one or more of the 12 variable regions in the wild-type AVV capsid proteins. In some embodiments, the one or more engineered polypeptide sequences contains motifs each being inserted between any two amino acid residues located in the region from position 571 to position 601 of a viral protein. Optionally, 1-30 flanking amino acids can be deleted from the same region before the insertion. For example, the one or more engineered polypeptide sequences contains motifs each being inserted between two amino acids 582 and 592 of an AAV9 viral protein.

[0204] MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLP GYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQE RLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGI GKSGAQPAKKRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNN EGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISNSTSGGSSND NAYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTD NNGVKTIANNLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYGYLTLND GSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENVPFHSSYAHSQSLDRLMNPLID QYLYYLSKTINGSGQNQQTLKFSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNN NSEFAWPGASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQGTGRDNV DADKVMITNEEEIKTTNPVATESYGQVATNHQSAQAQAQTGWVQNQGILPGMVW QDRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNK DKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVY SEPRPIGTRYLTRNL (SEQ ID NO: 3325) is a reference AAV9 capsid sequence where exemplary insertion sites are highlighted (bolded and underlined) . It will be appreciated that engineered polypeptide sequences can be inserted in analogous positions in AAV viral proteins of other serotypes. In some embodiments, the engineered polypeptide sequences can be inserted between any two contiguous amino acids within the AAV viral protein and in some embodiments the insertion is made in a variable region.

[0205] As used herein, “tropism” or “tropic” refers to increased target cell specificity as compared to a parental or wildtype capsid polypeptide, and / or reduced non-target cell specificity compared to a parental or wildtype capsid polypeptide. The target cell can be any cells of a subject, such as a neuronal cell, a neural stem cell, an astrocyte, an oligodendrocyte, a microglia cell, a retinal cell, a tumor cell, a hematopoietic stem cell, an insulin producing beta cell, a lung epithelium cell, an endothelial cell, a liver cell, a skeletal muscle cell, a muscle stem cell, a muscle satellite cell, or a cardiac muscle cell.

[0206] As used herein, a viral capsid polypeptide having tropism to a tissue or an organ means that a viral particle containing the viral capsid polypeptide can have an increased uptake, delivery rate, transduction rate, efficiency, amount, or a combination thereof in a target cell, a target tissue, or a target organ, as compared to other cell / tissue / organ types, relative to other virus particles (including but not limited to AAVs) and other compositions that do not contain the viral capsid polypeptide sequences disclosed herein.

[0207] As used herein, the engineered viral capsid polypeptide sequences can be encoded by engineered polynucleotides which can be included in a polynucleotide that is configured to be a viral genome donor in a viral vector system that can be used to generate engineered viral particles described elsewhere herein.

[0208] In some embodiments, the engineered AAV capsid encoding polynucleotide can be included in a polynucleotide that is configured to be an AAV genome donor in an AAV vector system that can be used to generate engineered AAV particles described elsewhere herein. In some embodiments, the engineered AAV capsid encoding polynucleotide can be operably coupled to a poly adenylation tail. In some embodiments, the poly adenylation tail can be an SV40 poly adenylation tail. In some embodiments, the AAV capsid encoding polynucleotide can be operably coupled to a promoter. In some embodiments, the promoter can be a tissue specific promoter. In some embodiments, the tissue specific promoter is specific for muscle (e.g., cardiac, skeletal, and / or smooth muscle) , neurons and supporting cells (e.g., astrocytes, glial cells, Schwann cells, etc. ) , fat, spleen, liver, kidney, immune cells, spinal fluid cells, synovial fluid cells, skin cells, cartilage, tendons, connective tissue, bone, pancreas, adrenal gland, blood cell, bone marrow cells, placenta, endothelial cells, and combinations thereof. In some embodiments, the promoter can be a constitutive promoter. Suitable tissue specific promoters and constitutive promoters are discussed elsewhere herein and are generally known in the art and can be commercially available.

[0209] Suitable muscle specific promoters include, but are not limited to CK8, MHCK7, Myoglobin promoter (Mb) , Desmin promoter, muscle creatine kinase promoter (MCK) and variants thereof, and SPc5-12 synthetic promoter.

[0210] Suitable immune cell specific promoters include, but are not limited to, B29 promoter (B cells) , CD14 promoter (monocytic cells) , CD43 promoter (leukocytes and platelets) , CD68 (macrophages) , and SV40 / CD43 promoter (leukocytes and platelets) .

[0211] Suitable blood cell specific promoters include, but are not limited to, CD43 promoter (leukocytes and platelets) , CD45 promoter (hematopoietic cells) , INF-beta (hematopoietic cells) , WASP promoter (hematopoietic cells) , SV40 / CD43 promoter (leukocytes and platelets) , and SV40 / CD45 promoter (hematopoietic cells) .

[0212] Suitable pancreatic specific promoters include, but are not limited to, the Elastase-1 promoter.

[0213] Suitable endothelial cell specific promoters include, but are not limited to, Fit-1 promoter and ICAM-2 promoter.

[0214] Suitable neuronal tissue / cell specific promoters include, but are not limited to, GFAP promoter (astrocytes) , SYN1 promoter (neurons) , and NSE / RU5’ (mature neurons) .

[0215] Suitable kidney specific promoters include, but are not limited to, NphsI promoter (podocytes) .

[0216] Suitable bone specific promoters include, but are not limited to, OG-2 promoter (osteoblasts, odontoblasts) .

[0217] Suitable lung specific promoters include, but are not limited to, SP-B prompter (lung) .

[0218] Suitable liver specific promoters include, but are not limited to, SV40 / Alb promoter.

[0219] Suitable heart specific promoters include, but are not limited to, alpha-MHC.

[0220] Suitable constitutive promoters include, but are not limited to CMV, RSV, SV40, EF1alpha, CAG, and beta-actin.

[0221] In some embodiments, the viral capsid polypeptide sequences described herein are inserted into an AAV protein (e.g., an AAV capsid protein) that has reduced specificity (or no detectable, measurable, or clinically relevant interaction) for one or more non-muscle cell types. Exemplary non-muscle cell types include, but are not limited to, liver, kidney, lung, heart, spleen, central or peripheral nervous system cells, bone, immune, stomach, intestine, eye, skin cells and the like. In some embodiments, the non-muscle cells are liver cells. In certain example embodiments, the AAV capsid protein is an engineered AAV capsid protein having reduced or eliminated uptake in a non-muscle cell as compared to a corresponding wild-type AAV capsid polypeptide. In certain example embodiments, the non-muscle cell is a liver cell. In certain example embodiments, the wild-type capsid polypeptide is an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV2v4, AAVDJ, AAVrh74, AAV12, AAV13, AAV8AIT, and AAV3B capsid polypeptide.

[0222] In certain example embodiments, the engineered AAV capsid protein comprises one or more mutations that result in reduced or eliminated uptake in a non-muscle cell.

[0223] In certain example embodiments, the one or more mutations are  31. between position 448 and 462, 32. between position 439 and 455, 33. between position 440 and 456, 34. between position 449 and 464, 35. between position 447 and 462, 36. between position 446 and 461, 37. between position 446 and 462, 38. between position 448 and 464, 39. between position 448 and 463, 40. between position 445 and 459, 41. between position 439 and 448, 42. between position 486 and 511, 43. between position 479 and 509, 44. between position 488 and 518, 45. between position 480 and 510, 46. between position 488 and 513, 47. between position 485 and 510, 48. between position 487 and 512, 49. between position 483 and 508, 50. between position 472 and 479, 51. between position 582 and 592, 52. between position 579 and 589, 53. between position 588 and 598, 54. between position 580 and 590, 55. between position 582 and 599, 56. between position 584 and 594, 57. between position 583 and 593, 58. between position 581 and 591, 59. between position 581 and 601, 60. between position 571 and 581, or any combination thereof, in the wild-type or engineered viral capsid protein, for example AAV9 capsid protein (SEQ ID  NO: 3325) or in one or more positions corresponding thereto in a non-AAV9 capsid polypeptide.

[0224] In certain example embodiments, the engineered AAV capsid protein is an engineered AAV capsid polypeptide comprising an insertion between position 582 and 592 of a wild-type AAV capsid protein. In some embodiments, the insertion is a sequence selected from the sequences of Tables 5A-5D and 6 of the present disclosure.

[0225] In certain example embodiments, the engineered AAV capsid protein is an engineered AAV9 capsid polypeptide comprising an insertion between position 582 and 592 of a wild-type AAV9 capsid protein.

[0226] In certain embodiments, the engineered AAV capsid protein comprises one or more sequences selected from Tables 1-6.

[0227] Table 1 Arg-Gly-Asp-X3-X4 Sequences

[0228] Table 2 X2-Arg-Gly-Asp-X3-X4 Sequences

[0229] Table 3 X1-X2-Arg-Gly-Asp-X3-X4 Sequences

[0230] Table 4 X1-X2-Arg-Gly-Asp-X3-X4-X5 and X1’-X2’-Arg-Gly-Asp-X3’-X4’-X5’ Sequences

[0231] Table 5A Sequences of capsid polypeptides (Part 1)

[0232] Table 5B Sequences of capsid polypeptides (Part 2)

[0233] Table 5C Sequences of capsid polypeptides (Part 3)

[0234] Table 5D Sequences of capsid polypeptides

[0235] Table 6 Alternative Sequences of capsid polypeptides in Fig. 6B

[0236] Table 7 Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 Sequences

[0237] Table 8 Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ Sequences

[0238] Table 9 Z1-Asn-Z2-Z3-Z4 Sequences

[0239] Table 10 Z1’-Asn-Z2’-Z3’-Z4’ Sequences

[0240] Table 11 W1-Arg-Gly-Asp-W2-W3-W4-W5 Sequences

[0241] While the disclosure has been particularly shown and described with reference to specific embodiments, it should be understood by those having skill in the art that various changes in form and detail may be made therein without departing from the spirit and scope of the present disclosure as disclosed herein. EXAMPLES Preparation Example 1: AAV virion library constructionPlasmid library preparation

[0242] Capsid variant sequences were collected from, e.g., literature, which were further diversified to 480,000 sequences. These sequences covered the variable region VIII in VP3 (amino acids 582-592) of the wild-type AAV9 serotype. The designed oligo sequences were synthesized by a commercial provider. To prepare the plasmid library, oligos were firstly amplified by PCR as following conditions: 1 uL (15 ng / uL) template, 25 uL NEBNext UltraII Q5 Master Mix (NEB M0544S) , 250 nM primers, and nuclease-free H2O up to 50 uL. Thermal cycling was set as: 98 ℃ 30 s; 6 cycles of 98 ℃ 10 sec, 65 ℃ 30 sec, 72 ℃ 30 sec; then 72℃ 2 min. The amplification products were purified by DNA Clean and Concentrator Kit (Zymo D4033) . The purified products were then cloned into the pAAV9_Rep2-Cap9-582-592-lib backbone through Golden Gate Assembly (GGA) using the following condition: 37 ℃, 5 min and 22 ℃, 5 min for 90 cycles; 65 ℃ for 30 min. The ligation products were purified by Beckman Coulter Ampure XP beads (Beckman A63882) and transformed into NEB stable competent E. coli cells (WeidiBio DE1080) by electroporation. E. coli was propagated on plate at 30 ℃. Clones were then collected, and plasmids of capsid library were extracted using QIAGEN plasmid Plus Midi Kit (QIAGEN 12945) .AAV virion library preparation

[0243] HEK293T cells were seeded and cultured in 150 mm dish and transfected by AAV packing plasmids at 80-90%confluency. In brief, the AAV Helper plasmid and AAV Rep-Cap library plasmid were mixed, and 3-fold amount of total plasmid of PEI were mixed and placed at room temperature for 15 mins before added into the HEK293T cells by gently dropping and mixing. Fresh culture media supplemented with 2%FBS and Advanced DMEM (Gibco 12491015) was used to replace the old media 18 hours post-transfection. Cells and supernatant were collected separately 72 hours post-transfection. The pelleted cells were resuspended in SAN digestion buffer (500 mM NaCl, 40 mM Tris base, and 10 mM MgCl2) and through three freeze-thaw cycles. 100 U / mL Benzonase was added and incubated with the resuspension at 37 ℃ for 1 hr. For the supernatant, 40%PEG8000 (Sigma 89510-1KG-F) was added to 8%final concentration, and the sample was incubated at 4 ℃ for 1 hr, 180 rpm rotation then overnight. In the next day, the supernatant was spun with PEG8000 at 4000 g at 4 ℃ for 30 min. The supernatant was removed, and the pellet was resuspended with SAN digestion buffer. Benzonase was added to the resuspension, then the resuspension was mixeded with the products from the previous freeze-thaw cycles for additional 0.5 hr at 37 ℃.

[0244] Virions were purified by OptiPrep and concentrated by centrifuging at 350,000 g at 18 ℃ for 2 hr 25 min. The concentrated virions were resuspended in DPBS with 0.001%Pluronic F68, concentrated using 100 KDa column (Merck UFC910096) , filtered by 0.22 filter (LABSELECT CTF-02-CA-22-S) , and stored in -80 ℃.

[0245] The individual AAV serotype for validation was packed with three plasmids at a molar ratio of 1: 1: 1. Specifically, about 20 ug AAV Helper plasmid, 8 ug of transfer plasmid, and 12 ug of the capsid plasmid to be verified were added per 150 mm dish. Other steps were the same as the above mentioned AAV virion library packing.Titration of the AAV virion library

[0246] Virions were treated with DNase in a reaction containing 5 μL virion, 5 μL 10×DNase Buffer (Invitrogen 4022G) , 1 μL TURBO DNase (Invitrogen AM2238) , and 39 μL nuclease-free H2O, incubating at 37℃ for 30 min and then 95 ℃ for 10 min. Another 2 μL proteinase K (TIANGEN 20 mg / mL) was added for additional 60 min at 56 ℃, then 20 min at 95 ℃. Virions were diluted at proper concentrations for titration.

[0247] Linearized plasmids were also diluted to proper concentrations and used as templates in qPCR to establish a standard curve. In a 20 μL qPCR reaction, add 2 μL template (virion or linearized plasmid) , 10 μL NEBNext Ultra II Q5 Master Mix (NEB M0544S) , 1 μL 10 μM forward primer and 1 μL of 10 μM reverse primer, 1 μL 20× SYBR (Thermo S7563) and 5 μL nuclease-free H2O. The thermal cycling reaction was conducted in the following conditions: 98 ℃ 30 s; 40 cycles of 98 ℃ 10 s, 68 ℃ 30 s, 72 ℃ 10 s.

[0248] The following primers were used: AAV virion library NGS preparation

[0249] The AAV virion plasmid library was amplified in the following reaction: 2.5 uL (20 ng / uL) template, 25 μL NEBNext Ultra II Q5 Master Mix (NEB M0544S) , 1.25 μL 10 μM forward primer and 1.25 μL 10 μM reverse primer, and H2O up to 50 μL. The thermal cycling reaction was conducted in the following conditions: 98 ℃ 30 s; 6 cycles of 98 ℃ 10 s, 68 ℃ 30 s, 72 ℃ 30 s; 8 cycles of 98 ℃ 10 s, 72 ℃ 30 s, 72 ℃ 30 s, andthen 72℃ 2 min.

[0250] The following primers were used (the letter N represents any nucleotide and serve as barcode in NGS) :

[0251] The amplified products were purified by AMPure XP beads, which were subjected to high-throughput sequencing.

[0252] The AAV virion library was treated to release the virus genome for NGS library preparation. The virion library was treated with DNase at 37 ℃ for 30 min in a reaction containing 5 μL virion, 5 μL 10× DNase Buffer (Invitrogen 4022G) , 1 μL TURBO DNase (Invitrogen AM2238) , and nuclease-free H2O up to 50 μL. Addition 5 μL Proteinase K (TIANGEN 20 mg / mL) was added, and the reaction was continued for another 60 min at 56 ℃, then 20 min at 95 ℃ to inactivate the enzymes. The amplification procedure remains consistent with the aforementioned process. Preparation Example 2: AAV virion library screening and candidate validationCultured cells

[0253] Recommended conditions were used to culture various cells, including HSC, T, B, NK, PBMC, HEK293T, RD, HeLa, HepG2, SH-SY5Y, ARPE-19, Huh-7, hCMEC / D3, HMC-3, iPSC, H1, and H9 cells. One million cells were transduced by AAV libary at MOI=1E4 and were harvested 72 hours post-transduction. QIAamp DNA Mini Kit (QIAGEN 51306) was used to extract the cellular DNA, in which the cap gene sequence and abundance were determined by high-throughput sequencing.RD cells and primary muscle cells

[0254] To verify the transduction efficiencies of the top candidates of novel capsids in RD cells. The RD cells were a gift from the Dong lab at Institute of Medical Biology, Chinese Academy of Medical Sciences. The RD cells were grown in high-glucose DMEM supplemented with 10%FBS and 1%penicillin / streptomycin.

[0255] To verify the transduction efficiencies of the top candidates of novel capsids in primary cells, human muscle tissues were collected from muscle biopsies from three donors. Tissue samples were dissociated according to Alexander, M. S. et al. Cell Stem Cell 19, 800-807(2016) , and dissociated cells were cultured in high-glucose DMEM supplemented with 20%FBS and 1%penicillin / streptomycin.

[0256] To prepare AAV for the validation experiments, eGFP were packed into AAV virions using the wild-type AAV9, wild-type AAVrh74, and MUS001 capsid, respectively. The skeletal muscle cells were transduced by AAV at MOI of 1 × 101, 1 × 102, 1 × 103, 1 × 104, 1 × 105 at 60%confluency in 12-well plates, in which the culture media was changed 24 hr post-transduction. Images were taken 7 days post-transduction to examine the fluorescent cells. The same batch of cells were then collected and analyzed on CytoFLEX flow cytometer, and the data was analyzed with FlowJo_V10.Mouse model

[0257] To conduct the capsid screening in mouse, AAV virion library was injected through the tail vein of the experimental animal at the amount of 1 × 1012 vg. Animals were euthanized two weeks post-injection and perfused with cold DPBS. Organs were collected and stored at -80 ℃.Non-human primate model

[0258] All of macaque experiments were performed at the Innostar Biotechnology facility and approved by their Institutional Animal Care and Use Committees (IACUCs) . The experimental animals are cynomolgus macaques aged from 1.5 to 2 years old.

[0259] To conduct the capsid screening in non-human primates, AAV virion library was intravenously injected into the experimental animals at the amount of 1× 1014 vg / kg. Four weeks post-injection, the animals were sacrificed (euthanized with Ketamine 5 mg / kg and Cyperazine 0.4 mg / kg, and perfused with PBS) , and multiple organs were collected for gDNA extraction and then NGS quantification.

[0260] To conduct the capsid validation in non-human primates, RFP and GFP were packed into AAV virions using the wild-type AAV9 capsid or variants according to the present disclosure such as MUS001 capsid, respectively. Equal amount of AAV9-RFP and variants according to the present disclosure such as AAV-MUS001-GFP was mixed, and the mixture was intravenously injected into the experimental animals at the amount of 1.5 × 1013 vg / kg per variant (3.0 × 1013 vg / kg per animal) . Four weeks post-injection, the animals were sacrificed, and multiple organs were collected for downstream analysis.AAV virion screening library NGS preparation

[0261] The virus genome in the different organs of the experimental animals were collected using Trizol (REF, 2020NMeth, 2016NBT) . Tissues were homogenized before nucleic acid extraction by RNAiso Plus (TAKARA 9109) . The extraction products were treated with RNase cocktail (Thermo Scientific AM2286) to remove RNA, then the virion library was enriched by PCR in the following reaction: 5 μg cellular DNA, 25 μL NEBNext UltraII Q5 Master Mix, 250 nM forward and 250 nM reverse primers, and nuclear-free H2O up to 50 μL. The thermal cycling reaction was conducted in the following conditions: 98 ℃ 30 s; 20 cycles of 98 ℃ 10 s, 68 ℃ 30 s, 72 ℃ 10 s; 72 ℃ 2 min.

[0262] The following primers were used:

[0263] The PCR products were amplified by AMPureXP beads and NGS adaptor sequences were added as the above mentioned “AAV virion library NGS preparation” .Quantification of AAV copy numbers in the host cells

[0264] To quantify the viral genome copies, 100-300 mg animal tissues were homogenized in Buffer ATL (Qiagen) using tissue grinder, and both gDNA and viral DNA were isolated using DNeasy Blood &Tissue Kits (Qiagen) according to manufacturer’s protocol. Quantitative PCR (qPCR) was used to quantify the copies of ACTB gene, mCherry, and eGFP in the homogenized samples using three pairs of primers. The amplification efficiencies of the three pairs of primers were examined before sample processing. Three technical replicates were conducted in qPCR. Each qPCR reaction was conducted as a 25 uL with 12.5 μL NEBNext UltraII Q5 Master Mix, 100 ng DNA template, 500 nM primer mix, 1 uL 25x SYBR Green, and nuclease-free H2O. The thermal cycling reaction was conducted in the following conditions: 98 ℃ 30 s; 40 cycles of 98 ℃ 10 s, 66 ℃ 30 s, 72 ℃ 10 s. Histology analysis of the NHP tissues

[0265] Histology analysis was outsourced to HaoKe (Hangzhou) Biotechnology Inc. In brief, tissues were fixed in 4%paraformaldehyde (PFA) for more than 24 hrs before embedded in paraffin. The paraffin-embedded tissues were cut into 3-4 μm in thickness. Three primary antibodies were used for immunofluorescence staining, including anti-rat mCherry (Thermo, M11217) , anti-mouse eGFP (Thermo, MA1-952) , and anti-rabbit dystrophin (Abcam, ab15277) .CRISPR screening

[0266] Cas9-expressing RD cells were established by transducing lentivirus to wild-type RD cells. Lentivirus Brunello CRISPR library was used to transduce ～23 million RD-Cas9 cells at MOI 0.3. About 30%transduction efficiency was confirmed by mKate2+%cells using flow cytometry at 72 h post-transduction. Cells were expanded and selected with the presence of 2 μg / mL puromycin. When the mKate2-positive cells reached or were above 95%in a cell population, ～23 million RD-Cas9 cells were further transduced with scAAV-CAG-eGFP at MOI = 2.5 ×104. After another 72 h, RD-Cas9 cells were collected according to the intensity of the eGFP fluorescent signals by cell sorter (BD FACSAriaTM Fusion Flow Cytometer) . Both the bottom 20%and the top 20%were collected. Genomic DNA was extracted (TIANGEN DP304-03) from NGS library preparation and sequencing.

[0267] The screening was conducted on two genotypes of RD-Cas9 cells expanded from two independent mono clones, and each genotype of RD-Cas9 cells was used to generate data of two technical replicates. Preparation Example 3: NGS data analysisQuantification of the viral DNA copy number in samples

[0268] The sequencing reads aligned to the variable region of the cap gene in the viral genome were retained for further analysis. The capsid variants with less than 10 sequencing reads were removed. To quantify the abundance of capsid variants recovered from the screening experiment, the number of the aligned sequencing reads of each capsid variant was normalized to the sequencing depth (RPM, reads per million reads) . The ratio was calculated between the count of each capsid recovered from an organ in the screening library and the count in the virion library and ranked in descending order to represent the transduction efficiency or in vivo tropism of that capsid variant.Analysis of CRISPR screening The NGS libraries were sequenced as 150-bp paired-end. The sequencing reads were firstly  undergone adapter removal by ‘cutadapter’ with parameter ‘-n 1 -e 0.11 -O 15 -m 16’. The sequences were then aligned to the designed CRISPR library sequences using bowtie2 with ‘–np 0 –n-ceil L, 0, 0.2 –very-sensitive’. We counted the reads number of each gRNA from the Brunello CRISPR library in both the mgSrtA labeled sample and the control sample (starting reference) . The reads numbers were then normalized according to the sequencing depth of each NGS library, and an enrichment score was calculated for each gRNA (thus the targeted gene) using. Test ExampleTest Example 1: Evolve AAV9 variants by AI models trained on sequence-to-fitness in vitro data

[0269] 480k oligonucleotides were synthesized according to the preparation examples, spanning the variable region between the amino acid 582-592 of the cap gene in the genome of wild-type AAV9. These oligos were PCR amplified and cloned into an AAV backbone vector, which were packed as an AAV virion library (G0) (Fig. 1) . AAV variants in the virion library were assembled with various cap proteins encoded by different cap sequences, which presumably exhibit distinct transduction efficiencies to host cells. We then conducted in vitro screening by transducing the library G0 to eight human cell types representing diverse origin. The capsid abundances from the successfully transduced cells were quantified by next generation sequencing (NGS) and used to train prediction models.

[0270] The abovementioned quantifications established labels representing the multi-trait fitness of capsid sequences, reflecting the overall advantages of the corresponding AAV variants over the course of virus production, transduction, cellular trafficking, and transgene expression (Bryant, D. H. et al. Deep diversification of an AAV capsid protein by machine learning. Nat Biotechnol 39, 691-696, (2021) ) . However, the sequence-to-fitness correspondences are not obvious to directly prioritize the uncharacterized capsids from the huge sequence space, which is the key challenge in capsid evolution. To tackle this question, eight prediction models were trained from the sequence-to-fitness data obtained from each cell type, which leveraged the power of AI to learn complex patterns from large datasets and the diversity of the training data. In brief, transformer was employed to build up the prediction models (Fig. 1A) . The nucleotides representing capsid sequences were tokenized by 3-mer with non-overlapping setting, and we set 30 as the length of the tokenized sequence. The DNABERT-base version was chosen as the encoder. The output of transformer was further converted to a single value between 0-1 for each input sequence. The predicted fitness scores are highly correlated to the observed scores in the validation set (SCC: 0.77-0.90, PCC=0.76-0.90) , suggesting the high performance of the models to predict capsid fitness.

[0271] To enable in silico evolution, three generative models were also trained, named G0_VAE, G0_GPT, and G0_Diffusion, based on the sequence-to-fitness data as described in the preparation examples. Each model generated 90 million sequences per cell type, and fitness scores were assigned to the sequences by the prediction models. In total, a set of 372, 588 new sequences were assembled with high fitness scores across various cell types and different models. To increase the chance of identifying muscle-tropic capsids, twice as many sequences generated by the models trained on RD cells were included, compared to the other cell types. Also, as the binding between the RGD-containing motif and integrin appears to contribute to muscle tropism of AAV, 150 million RGD-containing sequences were also randomly generated and 96, 897 of them were retained after scoring and filtering using the prediction models. Another 2, 485 sequences showed high fitness scores from the seed library (G0) were also included. Altogether, a new set of 480k oligonucleotides were obtained, which were packed as an in silico evolved AAV virion library G1.

[0272] To evaluate the transduction efficiencies of the evolved variants, the G1 library was transduced to the same eight human cell types. The quantifications of fitness of the evolved AAV variants were compared to those in the G0 library. Remarkably, 49.3%-87.9%evolved variants from the G1 library showed superior transduction efficiencies compared to 3.3%-28.2%in the G0 library, with 62.2%increase in average (Fig. 1B) . Among these superior variants, the maximum transduction efficiency also increased from G0 to G1 (Fig. 1C) . Both the percentage of superior variants and the maximum transduction efficiency demonstrated that the AAV variants from the G1 library outperformed those from the G0 library, indicating in silico capsid evolution by prediction and generative AI models could effectively prioritize capsid sequences with high fitness from the large sequence space.Test Example 2: Transduction efficiencies of the evolved G1 library in NHP

[0273] The G1 variants were examined in vivo for transduction efficiencies in non-human primate (NHP) (Fig. 1A) . The G1 virion library was intravenously (i.v. ) injected into cynomolgus macaque, and tissue samples were collected four weeks post-injection. The viral DNA were examined in tissue samples of different skeletal muscles, heart, and the liver. The transduction efficiency of each AAV variant in tissues was estimated as a relative fold-change of the viral DNA copies between that AAV variant and the wild-type AAV9. In skeletal muscles, heart, and lung, the top variants showed increased transduction efficiency. For example, 5.56-10.65-fold more variants viral copies presented in the heart, compared to AAV9 and 3.78-9.04-fold more copies presented in diaphragm. The viral copies of AAV variants also enriched in other skeletal muscles, ranging from 4.20 to 18.23-fold of the wild-type AAV9 (Fig. 1D) . Importantly, these AAV variants exhibited decreased liver tropism (0.04 to 0.10-fold of AAV9) , suggesting lower toxicity to the liver. Benchmark with the previously reported muscle-tropic AAV9 variant (MyoAAV) also demonstrated the superior transduction efficiencies of the evolved AAV variants in NHP (Fig. 1E) . Collectively, the viral genome copies in tissues of non-human primate demonstrated that the in vitro capsid screening can provide high-value capsid candidates with altered tissue tropism.Test example 3: AAV-MUS001 transduced primary human skeletal muscles cell in vitro

[0274] The transduction efficiencies of the six AAV variants that exhibited high transduction efficiencies were also verified in NHP, named AAV-MUS001 to AAV-MUS006 (AAV-MUS00x) . The polypeptide sequences comprised in AAV-MUS001 to AAV-MUS006 are listed in below Table 12:

[0275] Table 12 Polypeptide sequences of exemplary variants

[0276] The AAVs carrying constructs encoding eGFP were also packed, either with wild-type capsids or novel capsids from the capsid evolution, resulted in AAV9-eGFP, AAVrh74-eGFP, and six AAV-MUS00x-eGFP (Fig. 2A) . Both AAV9-eGFP and AAVrh74-eGFP were included as they represented AAV serotypes currently used in clinic to treat neuromuscular diseases. All AAV-MUS00x-eGFP showed comparable packing efficiencies with the wild-type AAVs during the AAV production in HEK293T cells, indicating that the evolved capsids are not defect in AAV production.

[0277] The eight AAV serotypes were then transduced into Rhabdomyosarcoma (RD) cells according to McAllister, Robert M., et al. "Cultivation in vitro of cells derived from a human rhabdomyosarcoma. " Cancer 24.3: 520-526, (1969) , using viral MOI = 1 × 101 -104, and more fluorescent cells reflect higher transduction rates of a given AAV serotype to RD cells. Images showed that the percentages of fluorescence gradually increased in the RD cells transduced with AAV-MUS00x-eGFP, along with the MOI increases, while very few fluorescent signals were observed in cells transduced with AAV9-eGFP and AAVrh74-eGFP (Fig. 2B) . We further quantified both the positive percentage of fluorescent cells and the mean fluorescent intensity (MFI) on these cells using flow cytometry (Fig. 2C-D) . 5.5%-14.8%of RD cells were GFP-positive when transduced with AAV-MUS00x-eGFP at MOI = 1 × 102, while cells transduced with AAV9-eGFP and AAVrh74-eGFP showed less than 5.5%GFP-positive rates when using two orders of magnitude higher MOI (1 × 104) . About half RD cells were GFP-positive by transduced with AAV-MUS00x-eGFP at MOI = 1 × 103, and 88.7-97.9%cells were GFP-positive at MOI = 1 × 104.

[0278] The same assays were conducted in primary skeletal muscle cells (SMCs) isolated from tissues of three donors using viral MOI = 1 × 101 -105. A similar pattern of gradually increased fluorescent signals were seen under microscopy in cells transduced with AAV-MUS00x-eGFP (Fig. 2E) . Quantitatively, 2.6%and 11.3%of SMCs were GFP-positive when transduced with AAV-MUS00x-eGFP at MOI = 1 × 103 respectively (Fig. 2F) . At MOI = 1 ×105, 70.3%SMCs cells transduced with AAV-MUS00x-eGFP were identified as GFP positive. In contrast, AAV9-eGFP and AAVrh74-eGFP transduced less than 2%of SMCs across all five MOIs. The MFI analysis confirmed the same trend as observed in the analysis on GFP positive cells (Fig. 2G) . Together, the superior transduction efficiencies of the six AAV-MUS00x variants demonstrated that the in vivo quantifications of the transduction efficiencies in NHP is effective to discover novel capsids with altered tissue tropisms.Test Example 4: Investigation of ITGB5 as a co-receptor responsible for the high transduction efficiency of AAV-MUS001 to muscle cells

[0279] To investigate the genes that contribute to the superior transduction efficiencies of AAV-MUS00x to muscle cells in vivo and in vitro, CRISPR screening to RD cells were performed (Fig. 3A) . Lenti-Brunello library according to Doench, John G., et al. "Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. " Nature biotechnology 34.2: 184-191, (2016) , were transduced to Cas9-expressing RD cells, which were furthered infected by AAV-MUS001-eGFP or AAV-MUS002-eGFP. We reasoned that some gRNAs from the lenti-Brunello library will disrupt the function of genes in RD cells that are essential to AAV transduction, resulted in diverse eGFP signals in the RD cells. Thus, we sorted RD cells according to the eGFP signals. Both the top 20%and the bottom 20%fluorescent cells were collected, and the integrated gRNAs in both cell populations were retrieved by NGS. For each serotype, the CRISPR screening was conducted in two populations of RD cells, each expanded from an independent mono clone, and with two technical replicates for each clone. The RD cells infected by AAV9-mCherry were included as the control samples.

[0280] We scanned for genes, of which the corresponding gRNAs enriched in the bottom 20%of RD cells compared to the top 20%. Remarkably, the AAV-MUS001-eGFP and the AAV-MUS002-eGFP CRISPR screening resulted to the same lists of top five genes, including TM9SF2, ITGB5, SLC35B2, KIAA0319L, and GPR108 (Fig. 3B-C) . Among them, TM9SF2, KIAA0319L, and GPR108 are factors that were identified in multiple genetic screenings and responsible for the entry of AAV at a post-attachment step (Pillay, S. et al. An essential receptor for adeno-associated virus infection. Nature 530, 108-112, (2016) ; Pillay, S. et al. Adeno-associated Virus (AAV) Serotypes Have Distinctive Interactions with Domains of the Cellular AAV Receptor. J Virol 91, (2017) ; Dudek, A. M. et al. GPR108 Is a Highly Conserved AAV Entry Factor. Mol Ther 28, 367-381, (2020) .; Meisen, W.H. et al. Pooled Screens Identify GPR108 and TM9SF2 as Host Cell Factors Critical for AAV Transduction. Mol Ther Methods Clin Dev 17, 601-611, (2020) ) . SLC35B2 was also emerged in CRISPR screening for AAV2 infection (Pillay, S. et al. An essential receptor for adeno-associated virus infection. Nature 530, 108-112, 2016) and later recognized to be required for the entry of enterovirus 71 (EV71) to host cells (Guo, D. et al. SLC35B2 Acts in a Dual Role in the Host Sulfation Required for EV71 Infection. J Virol 96, (2022) ) . ITGB5 encodes the beta 5 (β5) subunit of integrin heterodimer, which is one of the beta subunits constituting the RGD (Arg-Gly-Asp) -binding receptor in the integrin family (Hynes, R.O. Integrins: bidirectional, allosteric signaling machines. Cell 110, 673-687, (2002) ) . The αvβ5 integrin has been reported to mediate the internalization of adenovirus, AAV2, and Zika virus (Summerford, C., Bartlett, J.S. &Samulski, R.J. AlphaVbeta5 integrin: a co-receptor for adeno-associated virus type 2 infection. Nat Med 5, 78-82, (1999) ; Wickham, T.J., Mathias, P., Cheresh, D.A. &Nemerow, G.R. Integrins alpha v beta 3 and alpha v beta 5 promote adenovirus internalization but not virus attachment. Cell 73, 309-319, (1993) ; Wang, S. et al. Integrin alphavbeta5 Internalizes Zika Virus during Neural Stem Cells Infection and Provides a Promising Target for Antiviral Therapy. Cell Rep 30, 969-983 e964, (2020) ) , but ligands are unclear. The identification of virus-entry related genes demonstrated that the CRISPR screening assay conducted in this study is effective to pinpoint genes mediating the transduction of AAV into host cells.

[0281] However, there is still a gap as to understand the superior transduction efficiencies of AAV-MUS001 and AAV-MUS002 compared to the wild-type AAV9. RGD-containing peptide has been considered responsible for the high binding affinity of MyoAAV, a muscle-tropic AAV serotype, to the αvβ6 integrin (Tabebordbar, M. et al. Directed evolution of a family of AAV capsid variants enabling potent muscle-directed gene delivery across species. Cell 184, 4919-4938, (2021) ) . As a distinct integrin subunit β5 appeared from our screening, we wonder whether there is a different and more specific motif responsible for binding β5-containing integrin. Interestingly, knocking out ITGB5 in RD cells significantly decreased the transduction efficiencies of AAV-MUS001 and AAV-MUS002 to RDitgb5 (Fig. 3D-E) . Moreover, we found that both the MUS001 and MUS002 capsids contain an RGDXF motif. As previous structural analysis has showed that the C-terminal residues of RGD-containing ligand interacts with the beta subunit of integrin heterodimer (Schumacher, S. et al. Structural insights into integrin alpha (5) beta (1) opening by fibronectin ligand. Sci Adv 7, (2021) ) , thus, without wishing to be bound by theory, it is reasoned that the RGDXF-containing ligand, compared to RGD, has higher binding affinity to β5-containing integrin, which contributed to the superior muscle tropism of AAV-MUS001 and AAV-MUS002. The top capsid sequences in the G1 library showed higher transduction efficiencies compared to wild-type AAV9. By aggregating the top skeletal muscle-tropic sequences, it was found that an RGDX3X4, X4=Y / F / P / , motif significantly enriched (Fig. 3F) . Among the six evolved AAV serotypes which were investigated for their in vitro transduction (Fig. 2) , each of the identified motif (RGDXY (SEQ ID NO: 3340) , RGDXF (SEQ ID NO: 3341) , and RGDXP (SEQ ID NO: 3342) ) was represented by two evolved AAV variants. It was also observed that an RGDX3X4, X4=Y / F / P / W was a preferred motif (Fig. 3F) . Collectively, it was found that ITGB5 is responsible for the muscle tropism of AAV-MUS001 and AAV-MUS002, potentially mediated by the high binding affinity with RGDX3X4, X4=Y / F / P / W-containing motif encoded in the AI-generated capsids.Test Example 5: Pan-muscle tropism and decreased liver tropism of AAV-MUS001 in NHP

[0282] To further verify the therapeutic potential of the muscle-tropic AAV variants, AAV-MUS001-eGFP and AAV-MUS002-eGFP were administered into cynomolgus monkey by intravenous injection (Fig. 4A) . For direct comparison, wild-type AAV9 carrying construct encoding mCherry (AAV9-mCherry) was also packed. Equal amount of AAV9-mCherry and AAV-MUS001-eGFP or AAV-MUS002-eGFP were mixed and infused to the experimental animal at the dose of 1.5 × 1013 vg / kg per serotype, and various tissue samples were collected four weeks post-injection. The expression of the transduced genes was confirmed by immunohistochemistry (IHC) (Fig. 4B) .

[0283] The biodistribution of AAV-MUS001 and AAV-MUS002 were examined by examining the viral DNA across various tissues (Fig. 4C) . For each tissue, the amount of viral DNA was normalized to the number of AAV9-mCherry in the same tissue. Less than 40%of the liver cells were infected by AAV-MUS001-eGFP compared to AAV9-mCherry, implying a significantly reduced hepatoxicity of AAV-MUS001 by systematic administration. 5.4-fold viral DNA copies were delivered to the lung by AAV-MUS001. Remarkably, 7.2-and 4.2-fold viral DNA copies were delivered to the heart and the diaphragm, respectively, in which dysfunctional skeletal muscles are life-threaten in many neuromuscular disease, e.g., Duchenne Muscular Dystrophy (DMD) . All muscle samples presented a higher eGFP copy number compared to mCherry, ranging from 2.4 to 10.2-fold.

[0284] By normalizing the viral DNA copies to ACTB from the matched samples, the absolute viral DNA copies per diploid genome was quantified (Fig. 4D-E) . In the liver, AAV9 delivered 19.6-21.4 copies of mCherry, while AAV-MUS001 delivered 7.8-8.3 copies of eGFP given 1.5 × 1013 vg / kg systematic administration, compared to ～300 viral copies in patents’ livers by 1.1 × 1014 vg / kg intravenous infusion (Thomsen, G. et al. Biodistribution of onasemnogene abeparvovec DNA, mRNA and SMN protein in human tissue. Nat Med 27, 1701-1711, (2021) ) . In the heart, AAV-MUS001 delivered ～1.2 viral copies per diploid genome, compared to ～0.2 viral copies delivered by AAV9. And in the diaphragm, AAV-MUS001 delivered ～1.9 viral copies while AAV9 delivered ～0.5 copies. For other types of muscle tissues, AAV-MUS001 delivered ～0.7-3.6 viral copies, compared to ～0.1-1.5 copies by AAV9. In the lung, AAV-MUS001 delivered 0.73 viral copies, compared to 0.13 copies delivered by AAV9 (Fig. 4F-G) . The biodistribution of AAV-MUS002 showed a similar pattern and efficiencies. Together, both AAV-MUS001 and AAV-MUS002 demonstrated their superior transduction efficiencies and clinic-favored biodistribution compared to the parental AAV9 as a delivery vector, suggesting that AI model trained on in vitro data could generate tissue-tropic capsids with promising translational potential.

[0285] The capsid screening and evolution platform identified other tissue-tropic AAV variants in NHP

[0286] Besides the AAV variants that showed tropism to skeletal muscles, we also identified other tissue-tropic AAV variants and their corresponding capsid sequences from the capsid screening in NHP animals. The tropisms of these AAV variants include heart, brain, lung, and others. Interestingly, some AAV variants show multiple tissue-tropisms, for example, tropisms to skeletal muscles, heart, and lung, or tropisms to skeletal muscles and heart, or tropisms to heart and brain, or tropisms to brain, heart, and skeletal muscles.

[0287] In addition, the corresponding capsid sequences were aggregated and we identified the representative alternative motifs. The representative motif of AAV variants showing tropisms to skeletal muscles, heart, and lung includes RGDX [Y / F / P / W] (Fig. 3F) . An alternative representative motif of AAV variants showing tropisms to skeletal muscles, heart, and lung includes [K / R] RGDXX [D / E] (Fig. 6A) . The representative motif of AAV variants showing tropisms to brain, heart, and skeletal muscles includes NXX [R / K] (Fig. 6B) . It is noted that tropism to brain means that an AAV variant could pass through blood brain barrier and get into the central nerve system (CNS) by intravenous injection of a NHP animal.Discussion

[0288] From a moderate-sized seed library and screening for AAV capsids related to high transduction efficiencies in various human cell lines, we leveraged ML-guided capsid evolution and identified AAV variants showing altered organ or tissue tropism compared to the parental wild-type AAV. The specific organ or tissue tropism we observed from these AAV variants included skeletal muscles, brain, heart, and lung.

[0289] For example, the superior transduction efficiencies of the muscle-tropic AAV were verified in primary human skeletal muscle cells. And biodistribution of the top novel AAV serotypes in non-human primates demonstrated the effective delivery of viral DNA copies to heart, lung, diaphragm, and various skeletal muscles with decreased liver tropism. Motif analysis and host cell receptors identified from CRISPR screening further elucidated the possible mechanism of the muscle tropism of these novel AAV serotypes.

[0290] The wild-type AAV requires engineering to alter the natural tropism to fit the broad applications as a delivery vector in gene therapy. The key challenges in this domain include establishing a high-throughput approach to characterize the fitness of proteins and prioritizing the protein sequences, out of an almost uncountable space, to plug into the characterization pipeline. To this end, mRNA-based capsid screening (Tabebordbar, M. et al. Directed evolution of a family of AAV capsid variants enabling potent muscle-directed gene delivery across species. Cell 184, 4919-4938 e4922, (2021) ) , CRE-based screening (Chan, K. Y. et al. Engineered AAVs for efficient noninvasive gene delivery to the central and peripheral nervous systems. Nat Neurosci 20, 1172-1179, (2017) ) , and machine-learning-assisted (ML-assisted) methods have been applied (Ogden, P. J., Kelsic, E. D., Sinai, S. &Church, G. M. Comprehensive AAV capsid fitness landscape reveals a viral gene and enables machine-guided design. Science 366, 1139-1143, (2019) ) . Both the mRNA-and CRE-based approaches efficiently boosted the viral signals from background through selective quantification on the expressed viral mRNA from the targeted tissues. However, it is possible that neglected AAV variants have internalized into other tissue and cells but not expressed due to transcriptional control. Considering these internalized but not expressed AAV variants could also induce the activation of DNA sensory pathways in host cells, inclusion of all internalized AAV variants in the screening step regardless of their expression may provide a better viral transduction landscape in the clinic setting. Recent progresses in ML-assisted protein engineering have also accelerated the discovery of novel AAV capsids with altered tropism. The training of ML models benefits from large and diversified datasets, including both the positive and negative data, e.g., capsids that either tropic or not-tropic to a certain cell type. The trained models learned correspondences between sequence patterns and tropisms, usually not obvious to humans, and guided the sequence prioritization to reduce the burden of screening. This workflow, ML-guided screening based on viral DNA, worked well as described herein, as demonstrated by the effective discovery of a group of pan-muscle-tropic AAV serotypes in one round of screening.

[0291] The cross-species effectiveness of the identified AAV serotype is important to translational studies. Advanced understandings to the underlying mechanism of the superior transduction efficiencies are required to accurately predict whether a tissue-tropic AAV variant would work well in another species. The effective viral transduction involves complex interactions between AAV and host cells, which regulated virus attachment, internalization, transgene expression et al, and few of them has been clearly characterized. Among them, receptors display in ECM (extra cellular matrix) or on surface of host cells have been proved to contribute to the selective virus transduction. For example, systematic injection of AAV-PHP. B showed remarkable CNS tropism in C57BL / 6J mouse but not in BALB / cJ because of a strain-specific expression of a receptor LY6A (Chan, K. Y. et al. Engineered AAVs for efficient noninvasive gene delivery to the central and peripheral nervous systems. Nat Neurosci 20, 1172-1179, (2017) ; Hordeaux, J. et al. The Neurotropic Properties of AAV-PHP. B Are Limited to C57BL / 6J Mice. Mol Ther 26, 664-668, (2018) ; Matsuzaki, Y. et al. Intravenous administration of the adeno-associated virus-PHP. B capsid fails to upregulate transduction efficiency in the marmoset brain. Neurosci Lett 665, 182-188, (2018) ; Huang, Q. et al. Delivering genes across the blood-brain barrier: LY6A, a novel cellular receptor for AAV-PHP. B capsids. PLoS One 14, (2019) ; Hordeaux, J. et al. The GPI-Linked Protein LY6A Drives AAV-PHP. B Transport across the Blood-Brain Barrier. Mol Ther 27, 912-921, (2019) ) . MyoAAV, a class of novel AAV serotype assembled with RGD-containing capsids, showed the highest affinity with αvβ6 integrin heterodimer, which was hypothesized as required but not sufficient to mediate the muscle-tropism of MyoAAV (Tabebordbar, M. et al. Directed evolution of a family of AAV capsid variants enabling potent muscle-directed gene delivery across species. Cell 184, 4919-4938 e4922, (2021) ) . Whole-genome CRISPR screening identified another beta subunit of integrin, β5 (ITGB5) , is responsible for the superior transduction efficiency of AAV-MUS001 and MUS002. Capsid sequences of MUS001 (SEQ ID. NO: 907) and MUS002 (SEQ ID. NO: 266) from this disclosure suggested that Phe (F) is the fourth amino acid that is required for the AAV capsid binding with integrin. By conducting motif analysis on a group of muscle-tropic capsids identified and verified in this study, we retrieved RGDX [F / W / Y / P] as the specific core motif that could promote the transduction efficiency of capsid to integrins with β5 subunit. Multiple genes encoding for the alpha unit of integrin (e.g., ITGAV) also popped out from the CRISPR screening, but with less enrichment in the superior capsids compared to the ITGB5. Structure analysis on the interaction between fibronectin and the αvβ1 integrin suggested that it is the beta unit of integrin heterodimer interacts with the C-terminal residues of RGD (Schumacher, S. et al. Structural insights into integrin alpha (5) beta (1) opening by fibronectin ligand. Sci Adv 7, (2021) ) , which explains ITGB5 as one of the top candidates from a CRISPR screening based on the binding affinity to the RGDX [F / W / Y / P] -containing motif. As RGD-binding integrin involves at least four alpha subunits and five beta subunits and represent a broad biodistribution of integrin (Ludwig, B. S., Kessler, H., Kossatz, S. &Reuning, U. RGD-Binding Integrins Revisited: How Recently Discovered Functions and Novel Synthetic Ligands (Re-) Shape an Ever-Evolving Field. Cancers (Basel) 13, (2021) ) , a more sophisticated motif would greatly improve the tissue-specific tropism of AAV capsid and guide the capsid engineering. Moreover, the RGDX [F / W / Y / P] -containing peptide may serve as a specific ligand and used combinatorial with other therapeutic modalities, such as nanobodies and peptide nucleic acids, to increase the binding specificity to target with β5 integrin expression.Test Example 6: CNS-tropic AAV variants

[0292] To demonstrate the effectiveness of the screening approach in identifying AAV variants with tissue-specific tropisms, 14 AAV variants (AAV-BBB001 to AAV-BBB014) showing CNS tropisms were selected and validated in vitro and in non-human primates) . The polypeptide sequences comprised in AAV-BBB001 to AAV-BBB014 are listed in below Table 13:

[0293] Table 13 Polypeptide sequences of exemplary variants with CNS tropism

[0294] To conduct in vitro validation, the wild-type AAV9 and the 14 AAV variants carrying construct encoding eGFP were transduced to three human cell lines (Figure 7) . The hCMEC was derived from endothelial cells and used to mimic the endothelial cell layer of the blood-brain barrier (BBB) . The SH-SY5Y is a neuroblastoma and was considered a neuroblast-like cell type. The HMC3 was derived from microglia cells. Each of these three cell lines was transduced by AAV9-WT-eGFP and AAV-BBB001-eGFP to AAV-BBB014-eGFP at different MOIs. For practical purposes, the 14 variants were divided into two experimental batches, and the AAV9-WT-eGFP and AAV-BBB001-eGFP were included in both batches (Figure 8-11) . After 72 hours, the fluorescence signals were visible under a microscope (Figures 8 and 10) . The percentage of positively transduced cells and MFI were quantified by flow cytometry (Figures 9 and 11) . All AAV variants showed higher transduction efficiencies than the wild-type AAV9 in all three cell line models. Among them, AAV-BBB001 and AAV-BBB013 are the superior variants to transduce all three cell line models, and AAV-BBB014 showed the highest transduction efficiencies in HMC3 cells. These data collectively demonstrated the superior transduction efficiencies of variants in cell line models representing endothelial cells in BBB, neuroblast-like cells, and microglia cells.

[0295] Further, the biodistribution of AAV-BBB001-eGFP in non-human primates (NHP) was investigated. AAV9-WT carrying a construct encoding SMN1 protein (AAV9-WT-SMN1) was packed, which is the serotype and transgene used in Zolgensma developed by Novartis to cure spinal muscular atrophy (SMA) . AAV9-WT-SMN1 and AAV-BBB001-eGFP were mixed at equal amounts and intravenously injected the virus mix into a cynomolgus mamacaque at the dose of 3 ×1013 vg / kg per variant (Figure 12A) . Four weeks after injection, the animal was sacrificed, and tissue samples were collected. Taqman qPCR was used to determine the viral copies of AAV9-WT-SMN1 and AAV-BBB001-eGFP in various tissues (Figure 12B-C) . Compared to AAV9-WT, AAV-BBB001 delivered 5.3 to 13.8-fold viral DNA copies to spinal cords, 8.6 to 14.1-fold to the cortex, and 3.4 to 22.7-fold to other brain regions. Less than 0.4-fold of viral DNA was delivered to the liver by AAV-BBB001. The eGFP expression in various regions of the central nerve system were confirmed by immunohistochemistry (IHC) , and images representing the spinal cord, hippocampus, and left brain (coronal plan) were shown as examples (Figure 12D-F) .

Claims

1.A viral capsid polypeptide, comprising an amino acid sequence X1-X2-Arg-Gly-Asp-X3-X4-X5,wherein X1, X2, X3, X4, and X5 are each an amino acid residue;whereinX4 is one selected from Phenylalanine, Proline, Tyrosine, and Tryptophan;with the proviso that:X3-X4 is not Arg-Tyr,X2-Arg-Gly-Asp-X3-X4-X5 is not Gly-Arg-Gly-Asp-Gln-Tyr-Thr (SEQ ID NO: 3323) , andX1-X2-Arg-Gly-Asp-X3-X4-X5 is not Val-Gly-Arg-Gly-Asp-Thr-Tyr-Pro (SEQ ID NO: 3324) .2.The viral capsid polypeptide according to claim 1, wherein X2 is absent or selected from Lysine, Alanine, Arginine, Glycine, Proline, Threonine, Glutamine, Serine, and Valine.3.The viral capsid polypeptide according to claim 1 or 2, wherein X3 is selected from Threonine, Serine, Valine, Alanine, Methionine, Asparagine, Glutamine, Arginine, Tyrosine, and Glycine.4.The viral capsid polypeptide according to any one of claims 1 to 3, wherein X5 is absent or selected from Aspartic acid, Glutamic acid, Proline, Alanine, Asparagine, Histidine, Valine, Threonine, Glutamine, Methionine, and Glycine.5.The viral capsid polypeptide according to any one of claims 1 to 4, wherein the amino acid sequence Arg-Gly-Asp-X3-X4 is selected from SEQ ID NOs: 2511-2542.6.The viral capsid polypeptide according to claim 1, wherein the amino acid sequence X2-Arg-Gly-Asp-X3-X4 is selected from SEQ ID NOs: 2543-2752.7.The viral capsid polypeptide according to claim 1, wherein the amino acid sequence X1-X2-Arg-Gly-Asp-X3-X4 is selected from SEQ ID NOs: 2753-3322.8.The viral capsid polypeptide according to claim 1, wherein the amino acid sequence X1-X2-Arg-Gly-Asp-X3-X4-X5 is selected from SEQ ID NOs: 1531-2375.9.The viral capsid polypeptide according to claim 1, comprising an amino acid sequence selected from SEQ ID NOs: 1-930.10.A viral capsid polypeptide, comprising an amino acid sequence X1’-X2’-Arg-Gly-Asp-X3’-X4’-X5’,wherein X1’, X2’, X3’, X4’, and X5’ are each an amino acid residue;wherein the amino acid sequence X1’-X2’-Arg-Gly-Asp-X3’-X4’-X5’ is selected from SEQ ID NOs: 2376-2435, 2437-2481, 2483-2502, and 2504-2510.11.The viral capsid polypeptide according to claim 10, comprising an amino acid sequence selected from SEQ ID NOs: 931-991, 993-1037, 1039-1060, and 1062-1068.12.A viral capsid polypeptide, comprising an amino acid sequence selected from SEQ ID NOs: 1069-1129, 1132-1193, 1195-1199, 1201-1285, 1287-1530, 3343-3932, and 4911-6478.13.The viral capsid polypeptide according to any one of claims 1 to 12, wherein the viral capsid polypeptide is a viral capsid polypeptide of an adeno associated virus (AAV) .14.The viral capsid polypeptide according to claim 13, wherein the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV.15.The viral capsid polypeptide according to any one of claims 1 to 14, wherein the viral capsid polypeptide is a viral capsid polypeptide of engineered AAV9.16.The viral capsid polypeptide according to any one of claims 1 to 15, wherein the viral capsid polypeptide has tropism to one or more target tissues.17.The viral capsid polypeptide according to any one of claims 1 to 16, wherein the viral capsid polypeptide has tropism to a muscle.18.The viral capsid polypeptide according to any one of claims 1 to 17, wherein the viral capsid polypeptide has tropism to one or more target organs.19.The viral capsid polypeptide according to any one of claims 1 to 18, wherein the viral capsid polypeptide has tropism to one or more target organs selected from skeletal muscles, lung, brain, spinal cord, and heart.20.A polynucleotide encoding the viral capsid polypeptide according to any one of claims 1 to 19.21.An adeno associated virus (AAV) vector, comprising the polynucleotide according to claim 20.22.A kit comprising: the viral capsid polypeptide according to any one of claims 1 to 19, the polynucleotide according to claim 19, or the adeno associated virus vector according to claim 21.23.A cell comprising the viral capsid polypeptide according to any one of claims 1 to 19, or the polynucleotide according to claim 19.24.A pharmaceutical composition comprising the viral capsid polypeptide according to any one of claims 1 to 19, the polynucleotide according to claim 20, or the adeno associated virus (AAV) vector according to claim 21.25.A method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with the adeno associated adeno associated virus (AAV) vector according to claim 21, wherein the AAV vector further comprises payload polynucleotide.26.The method according to claim 25, wherein the cell is a somatic cell.27.The method according to claim 25 or 26, wherein the cell is a muscle cell or a brain cell.28.The method according to any one of claims 25 to 27, wherein the cell is a cardiomyocyte or a skeletal muscle cell.29.A viral capsid polypeptide, comprising an amino acid sequence Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5,wherein Y1, Y2, Y3, Y4, and Y5 are each an amino acid residue;whereinY4 is Asp or Glu; andY1 is Lys or Arg;with the proviso that:Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 is not Arg-Arg-Gly-Asp-Lys-Ala-Asp-Ile (SEQ ID NO: 4855) , Arg-Arg-Gly-Asp-Met-Gly-Asp-Asn (SEQ ID NO: 4856) , Arg-Arg-Gly-Asp-Leu-Asn-Asp-Ser (SEQ ID NO: 4857) , Arg-Arg-Gly-Asp-Lys-Thr-Glu-Leu (SEQ ID NO: 4858) , Arg-Arg-Gly-Asp-Ile-Lys-Glu-Tyr (SEQ ID NO: 4859) , Arg-Arg-Gly-Asp-Tyr-Ser-Glu-Gln (SEQ ID NO: 4860) , or Arg-Arg-Gly-Asp-Tyr-Gln-Glu-Leu (SEQ ID NO: 4861) .30.The viral capsid polypeptide according to claim 29, wherein amino acid sequence Y1-Arg-Gly-Asp-Y2-Y3-Y4-Y5 is selected from SEQ ID NO: 3935-4095.31.The viral capsid polypeptide according to claim 29 or 30, comprising an amino acid sequence selected from SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 27, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 34, SEQ ID NO: 38, SEQ ID NO: 44, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 61, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95, SEQ ID NO: 99, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 110, SEQ ID NO: 113, SEQ ID NO: 117, SEQ ID NO: 141, SEQ ID NO: 145, SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 154, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO: 166, SEQ ID NO: 167, SEQ ID NO: 200, SEQ ID NO: 206, SEQ ID NO: 310, SEQ ID NO: 312, SEQ ID NO: 314, SEQ ID NO: 315, SEQ ID NO: 316, SEQ ID NO: 317, SEQ ID NO: 319, SEQ ID NO: 358, SEQ ID NO: 359, SEQ ID NO: 360, SEQ ID NO: 361, SEQ ID NO: 371, SEQ ID NO: 372, SEQ ID NO: 433, SEQ ID NO: 464, SEQ ID NO: 466, SEQ ID NO: 467, SEQ ID NO: 468, SEQ ID NO: 470, SEQ ID NO: 471, SEQ ID NO: 473, SEQ ID NO: 484, SEQ ID NO: 500, SEQ ID NO: 512, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 526, SEQ ID NO: 540, SEQ ID NO: 541, SEQ ID NO: 543, SEQ ID NO: 551, SEQ ID NO: 553, SEQ ID NO: 605, SEQ ID NO: 606, SEQ ID NO: 607, SEQ ID NO: 608, SEQ ID NO: 610, SEQ ID NO: 611, SEQ ID NO: 614, SEQ ID NO: 615, SEQ ID NO: 619, SEQ ID NO: 624, SEQ ID NO: 635, SEQ ID NO: 651, SEQ ID NO: 681, SEQ ID NO: 685, SEQ ID NO: 698, SEQ ID NO: 701, SEQ ID NO: 702, SEQ ID NO: 717, SEQ ID NO: 718, SEQ ID NO: 719, SEQ ID NO: 720, SEQ ID NO: 729, SEQ ID NO: 731, SEQ ID NO: 732, SEQ ID NO: 735, SEQ ID NO: 737, SEQ ID NO: 738, SEQ ID NO: 743, SEQ ID NO: 746, SEQ ID NO: 747, SEQ ID NO: 748, SEQ ID NO: 751, SEQ ID NO: 755, SEQ ID NO: 758, SEQ ID NO: 759, SEQ ID NO: 760, SEQ ID NO: 764, SEQ ID NO: 766, SEQ ID NO: 767, SEQ ID NO: 768, SEQ ID NO: 769, SEQ ID NO: 770, SEQ ID NO: 773, SEQ ID NO: 777, SEQ ID NO: 779, SEQ ID NO: 782, SEQ ID NO: 783, SEQ ID NO: 786, SEQ ID NO: 793, SEQ ID NO: 795, SEQ ID NO: 798, SEQ ID NO: 810, SEQ ID NO: 813, SEQ ID NO: 828, SEQ ID NO: 831, SEQ ID NO: 832, SEQ ID NO: 833, SEQ ID NO: 834, SEQ ID NO: 835, SEQ ID NO: 836, SEQ ID NO: 839, SEQ ID NO: 841, SEQ ID NO: 844, SEQ ID NO: 848, SEQ ID NO: 849, SEQ ID NO: 853, SEQ ID NO: 855, SEQ ID NO: 863, SEQ ID NO: 865, SEQ ID NO: 868, SEQ ID NO: 873, SEQ ID NO: 874, SEQ ID NO: 883, SEQ ID NO: 884, SEQ ID NO: 886, SEQ ID NO: 890, SEQ ID NO: 892, SEQ ID NO: 902, SEQ ID NO: 904, SEQ ID NO: 909, SEQ ID NO: 917, SEQ ID NO: 919, SEQ ID NO: 920, SEQ ID NO: 922, SEQ ID NO: 925, SEQ ID NO: 927, SEQ ID NO: 931, SEQ ID NO: 932, SEQ ID NO: 933, SEQ ID NO: 936, SEQ ID NO: 937, SEQ ID NO: 941, SEQ ID NO: 942, SEQ ID NO: 961, SEQ ID NO: 972, SEQ ID NO: 978, SEQ ID NO: 981, SEQ ID NO: 982, SEQ ID NO: 983, SEQ ID NO: 991, SEQ ID NO: 997, SEQ ID NO: 998, SEQ ID NO: 999, SEQ ID NO: 1000, SEQ ID NO: 1004, SEQ ID NO: 1005, SEQ ID NO: 1017, SEQ ID NO: 1029, SEQ ID NO: 1035, SEQ ID NO: 1051, SEQ ID NO: 1052, SEQ ID NO: 1054, SEQ ID NO: 1056, SEQ ID NO: 1062, SEQ ID NO: 1067, and SEQ ID NO: 3934.32.A viral capsid polypeptide, comprising an amino acid sequence Y1’-Arg-Gly-Asp-Y2’-Y3’-Y4’-Y5’ selected from SEQ ID NOs: 4096-4193.33.The viral capsid polypeptide according to claim 32, comprising an amino acid sequence selected from: SEQ ID NO: 6, SEQ ID NO: 45, SEQ ID NO: 69, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 78, SEQ ID NO: 84, SEQ ID NO: 96, SEQ ID NO: 103, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO: 147, SEQ ID NO: 176, SEQ ID NO: 184, SEQ ID NO: 195, SEQ ID NO: 199, SEQ ID NO: 223, SEQ ID NO: 225, SEQ ID NO: 257, SEQ ID NO: 260, SEQ ID NO: 271, SEQ ID NO: 272, SEQ ID NO: 282, SEQ ID NO: 298, SEQ ID NO: 308, SEQ ID NO: 321, SEQ ID NO: 331, SEQ ID NO: 340, SEQ ID NO: 374, SEQ ID NO: 380, SEQ ID NO: 393, SEQ ID NO: 394, SEQ ID NO: 399, SEQ ID NO: 402, SEQ ID NO: 409, SEQ ID NO: 410, SEQ ID NO: 425, SEQ ID NO: 428, SEQ ID NO: 436, SEQ ID NO: 446, SEQ ID NO: 452, SEQ ID NO: 455, SEQ ID NO: 456, SEQ ID NO: 457, SEQ ID NO: 479, SEQ ID NO: 483, SEQ ID NO: 514, SEQ ID NO: 527, SEQ ID NO: 547, SEQ ID NO: 550, SEQ ID NO: 572, SEQ ID NO: 577, SEQ ID NO: 578, SEQ ID NO: 579, SEQ ID NO: 580, SEQ ID NO: 583, SEQ ID NO: 584, SEQ ID NO: 591, SEQ ID NO: 598, SEQ ID NO: 603, SEQ ID NO: 604, SEQ ID NO: 617, SEQ ID NO: 632, SEQ ID NO: 641, SEQ ID NO: 644, SEQ ID NO: 648, SEQ ID NO: 655, SEQ ID NO: 679, SEQ ID NO: 680, SEQ ID NO: 683, SEQ ID NO: 703, SEQ ID NO: 705, SEQ ID NO: 709, SEQ ID NO: 710, SEQ ID NO: 712, SEQ ID NO: 713, SEQ ID NO: 714, SEQ ID NO: 727, SEQ ID NO: 749, SEQ ID NO: 787, SEQ ID NO: 797, SEQ ID NO: 820, SEQ ID NO: 823, SEQ ID NO: 825, SEQ ID NO: 838, SEQ ID NO: 851, SEQ ID NO: 859, SEQ ID NO: 864, SEQ ID NO: 876, SEQ ID NO: 882, SEQ ID NO: 885, SEQ ID NO: 908, SEQ ID NO: 910, SEQ ID NO: 918, SEQ ID NO: 921, SEQ ID NO: 935, SEQ ID NO: 956, SEQ ID NO: 985, SEQ ID NO: 986, SEQ ID NO: 988, SEQ ID NO: 1032, SEQ ID NO: 1057, and SEQ ID NO: 3602.34.The viral capsid polypeptide according to any one of claims 29 to 33, wherein the viral capsid polypeptide is a viral capsid polypeptide of an adeno associated virus (AAV) .35.The viral capsid polypeptide according to claim 34, wherein the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, and Avian AAV.36.The viral capsid polypeptide according to any one of claims 29 to 35, wherein the viral capsid polypeptide is a viral capsid polypeptide of engineered AAV9.37.The viral capsid polypeptide according to any one of claims 29 to 36, wherein the viral capsid polypeptide has tropism to one or more target tissues.38.The viral capsid polypeptide according to any one of claims 29 to 37, wherein the viral capsid polypeptide has tropism to a muscle.39.The viral capsid polypeptide according to any one of claims 29 to 38, wherein the viral capsid polypeptide has tropism to one or more target organs.40.The viral capsid polypeptide according to any one of claims 29 to 39, wherein the viral capsid polypeptide has tropism to one or more target organs selected from skeletal muscles, lung, and heart.41.A polynucleotide encoding the viral capsid polypeptide according to any one of claims 29 to 40.42.An adeno associated virus (AAV) vector, comprising the polynucleotide according to claim 41.43.A kit comprising: the viral capsid polypeptide according to any one of claims 29 to 40, the polynucleotide according to claim 41, or the adeno associated virus vector according to claim 42.44.A cell comprising the viral capsid polypeptide according to any one of claims 29 to 40, or the polynucleotide according to claim 41.45.A pharmaceutical composition comprising the viral capsid polypeptide according to any one of claims 29 to 40, the polynucleotide according to claim 41, or the adeno associated virus (AAV) vector according to claim 42.46.A method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with the adeno associated adeno associated virus (AAV) vector according to claim 42, wherein the AAV vector further comprises payload polynucleotide.47.The method according to claim 46, wherein the cell is a somatic cell.48.The method according to claim 46 or 47, wherein the cell is a muscle cell.49.The method according to any one of claims 46 to 48, wherein the cell is a cardiomyocyte or a skeletal muscle cell.50.A viral capsid polypeptide, comprising an amino acid sequence Z1-Asn-Z2-Z3-Z4,wherein Z1, Z2, Z3, and Z4 are each an amino acid residue;whereinZ3 is Val or Ile, andZ4 is Arg or Lys,with the proviso that:Z1-Asn-Z2-Z3-Z4 is not Asn-Asn-Gly-Val-Lys (SEQ ID NO: 4862) .51.The viral capsid polypeptide according to claim 50, wherein amino acid sequence Z1-Asn-Z2-Z3-Z4 is selected from SEQ ID NOs: 4194-4342.52.The viral capsid polypeptide according to claim 50 or 51, comprising an amino acid sequence selected from: SEQ ID NO: 861, SEQ ID NO: 1008, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114, SEQ ID NO: 1115, SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1123, SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1133, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO: 1138, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1145, SEQ ID NO: 1146, SEQ ID NO: 1147, SEQ ID NO: 1148, SEQ ID NO: 1150, SEQ ID NO: 1151, SEQ ID NO: 1161, SEQ ID NO: 1162, SEQ ID NO: 1163, SEQ ID NO: 1167, SEQ ID NO: 1169, SEQ ID NO: 1171, SEQ ID NO: 1172, SEQ ID NO: 1173, SEQ ID NO: 1174, SEQ ID NO: 1175, SEQ ID NO: 1176, SEQ ID NO: 1177, SEQ ID NO: 1178, SEQ ID NO: 1179, SEQ ID NO: 1185, SEQ ID NO: 1193, SEQ ID NO: 1195, SEQ ID NO: 1198, SEQ ID NO: 1199, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1223, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1245, SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1258, SEQ ID NO: 1263, SEQ ID NO:1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1287, SEQ ID NO: 1288, SEQ ID NO: 1289, SEQ ID NO: 1290, SEQ ID NO: 1299, SEQ ID NO: 1300, SEQ ID NO: 1301, SEQ ID NO: 1302, SEQ ID NO: 1307, SEQ ID NO:1320, SEQ ID NO: 1321, SEQ ID NO: 1326, SEQ ID NO: 1327, SEQ ID NO: 1328, SEQ ID NO: 1329, SEQ ID NO: 1330, SEQ ID NO: 1331, SEQ ID NO: 1334, SEQ ID NO: 1336, SEQ ID NO: 1340, SEQ ID NO: 1363, SEQ ID NO: 1364, SEQ ID NO: 1367, SEQ ID NO: 1369, SEQ ID NO: 1372, SEQ ID NO: 1373, SEQ ID NO: 1379, SEQ ID NO: 1381, SEQ ID NO:1382, SEQ ID NO: 1383, SEQ ID NO: 1385, SEQ ID NO: 1387, SEQ ID NO: 1390, SEQ ID NO: 1391, SEQ ID NO: 1392, SEQ ID NO: 1393, SEQ ID NO: 1394, SEQ ID NO: 1402, SEQ ID NO: 1403, SEQ ID NO: 1404, SEQ ID NO: 1405, SEQ ID NO: 1406, SEQ ID NO: 1407, SEQ ID NO: 1408, SEQ ID NO: 1411, SEQ ID NO: 1412, SEQ ID NO: 1418, SEQ ID NO:1419, SEQ ID NO: 1420, SEQ ID NO: 1421, SEQ ID NO: 1422, SEQ ID NO: 1424, SEQ ID NO: 1425, SEQ ID NO: 1426, SEQ ID NO: 1427, SEQ ID NO: 1428, SEQ ID NO: 1429, SEQ ID NO: 1434, SEQ ID NO: 1435, SEQ ID NO: 1436, SEQ ID NO: 1437, SEQ ID NO: 1439, SEQ ID NO: 1445, SEQ ID NO: 1447, SEQ ID NO: 1449, SEQ ID NO: 1451, SEQ ID NO:1453, SEQ ID NO: 1455, SEQ ID NO: 1456, SEQ ID NO: 1491, SEQ ID NO: 1499, SEQ ID NO: 3346, SEQ ID NO: 3349, SEQ ID NO: 3355, SEQ ID NO: 3363, SEQ ID NO: 3365, SEQ ID NO: 3369, SEQ ID NO: 3384, SEQ ID NO: 3385, SEQ ID NO: 3389, SEQ ID NO: 3390, SEQ ID NO: 3393, SEQ ID NO: 3394, SEQ ID NO: 3395, SEQ ID NO: 3396, SEQ ID NO:3397, SEQ ID NO: 3398, SEQ ID NO: 3399, SEQ ID NO: 3400, SEQ ID NO: 3403, SEQ ID NO: 3404, SEQ ID NO: 3405, SEQ ID NO: 3406, SEQ ID NO: 3407, SEQ ID NO: 3408, SEQ ID NO: 3409, SEQ ID NO: 3410, SEQ ID NO: 3411, SEQ ID NO: 3412, SEQ ID NO: 3413, SEQ ID NO: 3415, SEQ ID NO: 3417, SEQ ID NO: 3418, SEQ ID NO: 3420, SEQ ID NO:3421, SEQ ID NO: 3422, SEQ ID NO: 3424, SEQ ID NO: 3425, SEQ ID NO: 3427, SEQ ID NO: 3428, SEQ ID NO: 3429, SEQ ID NO: 3430, SEQ ID NO: 3431, SEQ ID NO: 3432, SEQ ID NO: 3433, SEQ ID NO: 3434, SEQ ID NO: 3438, SEQ ID NO: 3439, SEQ ID NO: 3440, SEQ ID NO: 3441, SEQ ID NO: 3442, SEQ ID NO: 3443, SEQ ID NO: 3444, SEQ ID NO:3445, SEQ ID NO: 3446, SEQ ID NO: 3447, SEQ ID NO: 3451, SEQ ID NO: 3457, SEQ ID NO: 3458, SEQ ID NO: 3459, SEQ ID NO: 3460, SEQ ID NO: 3461, SEQ ID NO: 3462, SEQ ID NO: 3464, SEQ ID NO: 3466, SEQ ID NO: 3467, SEQ ID NO: 3469, SEQ ID NO: 3470, SEQ ID NO: 3471, SEQ ID NO: 3472, SEQ ID NO: 3474, SEQ ID NO: 3479, SEQ ID NO:3480, SEQ ID NO: 3483, SEQ ID NO: 3485, SEQ ID NO: 3486, SEQ ID NO: 3487, SEQ ID NO: 3488, SEQ ID NO: 3489, SEQ ID NO: 3490, SEQ ID NO: 3491, SEQ ID NO: 3500, SEQ ID NO: 3502, SEQ ID NO: 3503, SEQ ID NO: 3504, SEQ ID NO: 3505, SEQ ID NO: 3506, SEQ ID NO: 3507, SEQ ID NO: 3509, SEQ ID NO: 3510, SEQ ID NO: 3511, SEQ ID NO:3512, SEQ ID NO: 3513, SEQ ID NO: 3514, SEQ ID NO: 3515, SEQ ID NO: 3516, SEQ ID NO: 3517, SEQ ID NO: 3518, SEQ ID NO: 3519, SEQ ID NO: 3523, SEQ ID NO: 3526, SEQ ID NO: 3529, SEQ ID NO: 3531, SEQ ID NO: 3532, SEQ ID NO: 3533, SEQ ID NO: 3535, SEQ ID NO: 3536, SEQ ID NO: 3537, SEQ ID NO: 3538, SEQ ID NO: 3539, SEQ ID NO:3540, SEQ ID NO: 3541, SEQ ID NO: 3542, SEQ ID NO: 3543, SEQ ID NO: 3544, SEQ ID NO: 3545, SEQ ID NO: 3546, SEQ ID NO: 3547, SEQ ID NO: 3550, SEQ ID NO: 3551, SEQ ID NO: 3552, SEQ ID NO: 3553, SEQ ID NO: 3554, SEQ ID NO: 3555, SEQ ID NO: 3556, SEQ ID NO: 3557, SEQ ID NO: 3558, SEQ ID NO: 3559, SEQ ID NO: 3560, SEQ ID NO:3561, SEQ ID NO: 3562, SEQ ID NO: 3568, SEQ ID NO: 3569, SEQ ID NO: 3572, SEQ ID NO: 3573, SEQ ID NO: 3574, SEQ ID NO: 3575, SEQ ID NO: 3577, SEQ ID NO: 3578, SEQ ID NO: 3579, SEQ ID NO: 3580, SEQ ID NO: 3581, SEQ ID NO: 3582, SEQ ID NO: 3583, SEQ ID NO: 3584, SEQ ID NO: 3586, SEQ ID NO: 3589, SEQ ID NO: 3590, SEQ ID NO:3591, SEQ ID NO: 3592, SEQ ID NO: 3594, SEQ ID NO: 3595, SEQ ID NO: 3597, SEQ ID NO: 3608, SEQ ID NO: 3609, SEQ ID NO: 3610, SEQ ID NO: 3611, SEQ ID NO: 3613, SEQ ID NO: 3615, SEQ ID NO: 3616, SEQ ID NO: 3619, SEQ ID NO: 3620, SEQ ID NO: 3621, SEQ ID NO: 3622, SEQ ID NO: 3623, SEQ ID NO: 3624, SEQ ID NO: 3625, SEQ ID NO:3628, SEQ ID NO: 3629, SEQ ID NO: 3630, SEQ ID NO: 3631, SEQ ID NO: 3634, SEQ ID NO: 3635, SEQ ID NO: 3642, SEQ ID NO: 3643, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO: 3649, SEQ ID NO: 3650, SEQ ID NO: 3651, SEQ ID NO: 3652, SEQ ID NO: 3659, SEQ ID NO: 3672, SEQ ID NO: 3674, SEQ ID NO: 3675, SEQ ID NO:3680, SEQ ID NO: 3682, SEQ ID NO: 3683, SEQ ID NO: 3684, SEQ ID NO: 3687, SEQ ID NO: 3688, SEQ ID NO: 3690, SEQ ID NO: 3691, SEQ ID NO: 3692, SEQ ID NO: 3693, SEQ ID NO: 3695, SEQ ID NO: 3697, SEQ ID NO: 3699, SEQ ID NO: 3700, SEQ ID NO: 3702, SEQ ID NO: 3722, SEQ ID NO: 3725, SEQ ID NO: 3726, SEQ ID NO: 3727, SEQ ID NO:3728, SEQ ID NO: 3729, SEQ ID NO: 3731, SEQ ID NO: 3732, SEQ ID NO: 3734, SEQ ID NO: 3735, SEQ ID NO: 3736, SEQ ID NO: 3742, SEQ ID NO: 3743, SEQ ID NO: 3744, SEQ ID NO: 3746, SEQ ID NO: 3747, SEQ ID NO: 3748, SEQ ID NO: 3749, SEQ ID NO: 3750, SEQ ID NO: 3751, SEQ ID NO: 3752, SEQ ID NO: 3753, SEQ ID NO: 3756, SEQ ID NO:3757, SEQ ID NO: 3758, SEQ ID NO: 3759, SEQ ID NO: 3760, SEQ ID NO: 3761, SEQ ID NO: 3762, SEQ ID NO: 3763, SEQ ID NO: 3764, SEQ ID NO: 3765, SEQ ID NO: 3766, SEQ ID NO: 3767, SEQ ID NO: 3769, SEQ ID NO: 3770, SEQ ID NO: 3771, SEQ ID NO: 3772, SEQ ID NO: 3774, SEQ ID NO: 3775, SEQ ID NO: 3776, SEQ ID NO: 3777, SEQ ID NO:3779, SEQ ID NO: 3780, SEQ ID NO: 3781, SEQ ID NO: 3782, SEQ ID NO: 3783, SEQ ID NO: 3784, SEQ ID NO: 3785, SEQ ID NO: 3786, SEQ ID NO: 3787, SEQ ID NO: 3789, SEQ ID NO: 3791, SEQ ID NO: 3792, SEQ ID NO: 3793, SEQ ID NO: 3794, SEQ ID NO: 3795, SEQ ID NO: 3797, SEQ ID NO: 3801, SEQ ID NO: 3803, SEQ ID NO: 3804, SEQ ID NO:3809, SEQ ID NO: 3811, SEQ ID NO: 3812, SEQ ID NO: 3814, SEQ ID NO: 3815, SEQ ID NO: 3816, SEQ ID NO: 3818, SEQ ID NO: 3841, SEQ ID NO: 3855, SEQ ID NO: 3860, SEQ ID NO: 3869, SEQ ID NO: 3883, SEQ ID NO: 3889, SEQ ID NO: 3892, SEQ ID NO: 3894, SEQ ID NO: 3895, SEQ ID NO: 3897, SEQ ID NO: 3898, SEQ ID NO: 3899, SEQ ID NO:3913, and SEQ ID NO: 3929.53.A viral capsid polypeptide comprising an amino acid sequence Z1’-Asn-Z2’-Z3’-Z4’ selected from SEQ ID NOs: 4343-4496.54.The viral capsid polypeptide according to claim 53, wherein Z4’ is R or K; and Z1’-Asn-Z2’-Z3’-Z4’ selected from SEQ ID NOs: SEQ ID NO: 4343, SEQ ID NO: 4345, SEQ ID NO: 4346, SEQ ID NO: 4347, SEQ ID NO: 4349, SEQ ID NO: 4363, SEQ ID NO: 4373, SEQ ID NO: 4374, SEQ ID NO: 4375, SEQ ID NO: 4376, SEQ ID NO: 4377, SEQ ID NO: 4379, SEQ ID NO: 4382, SEQ ID NO: 4388, SEQ ID NO: 4391, SEQ ID NO: 4393, SEQ ID NO:4395, SEQ ID NO: 4399, SEQ ID NO: 4401, SEQ ID NO: 4402, SEQ ID NO: 4408, SEQ ID NO: 4409, SEQ ID NO: 4410, SEQ ID NO: 4412, SEQ ID NO: 4415, SEQ ID NO: 4423, SEQ ID NO: 4430, SEQ ID NO: 4433, SEQ ID NO: 4440, SEQ ID NO: 4443, SEQ ID NO: 4444, SEQ ID NO: 4446, SEQ ID NO: 4447, SEQ ID NO: 4448, SEQ ID NO: 4449, SEQ ID NO:4450, SEQ ID NO: 4451, SEQ ID NO: 4452, SEQ ID NO: 4454, SEQ ID NO: 4455, SEQ ID NO: 4457, SEQ ID NO: 4458, SEQ ID NO: 4459, SEQ ID NO: 4460, SEQ ID NO: 4461, SEQ ID NO: 4462, SEQ ID NO: 4463, SEQ ID NO: 4467, SEQ ID NO: 4470, SEQ ID NO: 4472, SEQ ID NO: 4473, SEQ ID NO: 4476, SEQ ID NO: 4477, SEQ ID NO: 4482, SEQ ID NO:4483, SEQ ID NO: 4484, SEQ ID NO: 4487, SEQ ID NO: 4489, SEQ ID NO: 4490, SEQ ID NO: 4491, SEQ ID NO: 4492, SEQ ID NO: 4494, SEQ ID NO: 4495, and SEQ ID NO: 4496.55.The viral capsid polypeptide according to claim 53, comprising an amino acid sequence selected from: SEQ ID NO: 26, SEQ ID NO: 110, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO: 118, SEQ ID NO: 119, SEQ ID NO: 130, SEQ ID NO: 168, SEQ ID NO:331, SEQ ID NO: 344, SEQ ID NO: 369, SEQ ID NO: 389, SEQ ID NO: 390, SEQ ID NO:391, SEQ ID NO: 466, SEQ ID NO: 467, SEQ ID NO: 481, SEQ ID NO: 505, SEQ ID NO:510, SEQ ID NO: 511, SEQ ID NO: 521, SEQ ID NO: 529, SEQ ID NO: 530, SEQ ID NO:586, SEQ ID NO: 587, SEQ ID NO: 629, SEQ ID NO: 652, SEQ ID NO: 663, SEQ ID NO:680, SEQ ID NO: 690, SEQ ID NO: 700, SEQ ID NO: 717, SEQ ID NO: 737, SEQ ID NO:803, SEQ ID NO: 804, SEQ ID NO: 834, SEQ ID NO: 851, SEQ ID NO: 858, SEQ ID NO:860, SEQ ID NO: 861, SEQ ID NO: 862, SEQ ID NO: 863, SEQ ID NO: 864, SEQ ID NO:866, SEQ ID NO: 867, SEQ ID NO: 868, SEQ ID NO: 879, SEQ ID NO: 888, SEQ ID NO:889, SEQ ID NO: 911, SEQ ID NO: 917, SEQ ID NO: 955, SEQ ID NO: 980, SEQ ID NO:981, SEQ ID NO: 985, SEQ ID NO: 1000, SEQ ID NO: 1007, SEQ ID NO: 1008, SEQ ID NO: 1016, SEQ ID NO: 1033, SEQ ID NO: 1101, SEQ ID NO: 1102, SEQ ID NO: 1105, SEQ ID NO: 1106, SEQ ID NO: 1107, SEQ ID NO: 1108, SEQ ID NO: 1109, SEQ ID NO: 1110, SEQ ID NO: 1111, SEQ ID NO: 1112, SEQ ID NO: 1113, SEQ ID NO: 1114, SEQ ID NO:1115, SEQ ID NO: 1116, SEQ ID NO: 1117, SEQ ID NO: 1118, SEQ ID NO: 1119, SEQ ID NO: 1120, SEQ ID NO: 1121, SEQ ID NO: 1122, SEQ ID NO: 1123, SEQ ID NO: 1124, SEQ ID NO: 1125, SEQ ID NO: 1126, SEQ ID NO: 1127, SEQ ID NO: 1128, SEQ ID NO: 1129, SEQ ID NO: 1133, SEQ ID NO: 1135, SEQ ID NO: 1136, SEQ ID NO: 1137, SEQ ID NO:1138, SEQ ID NO: 1139, SEQ ID NO: 1140, SEQ ID NO: 1141, SEQ ID NO: 1143, SEQ ID NO: 1145, SEQ ID NO: 1146, SEQ ID NO: 1147, SEQ ID NO: 1148, SEQ ID NO: 1149, SEQ ID NO: 1150, SEQ ID NO: 1151, SEQ ID NO: 1152, SEQ ID NO: 1155, SEQ ID NO: 1159, SEQ ID NO: 1160, SEQ ID NO: 1161, SEQ ID NO: 1162, SEQ ID NO: 1163, SEQ ID NO:1164, SEQ ID NO: 1165, SEQ ID NO: 1166, SEQ ID NO: 1167, SEQ ID NO: 1168, SEQ ID NO: 1169, SEQ ID NO: 1170, SEQ ID NO: 1171, SEQ ID NO: 1172, SEQ ID NO: 1173, SEQ ID NO: 1174, SEQ ID NO: 1175, SEQ ID NO: 1176, SEQ ID NO: 1177, SEQ ID NO: 1178, SEQ ID NO: 1179, SEQ ID NO: 1184, SEQ ID NO: 1185, SEQ ID NO: 1188, SEQ ID NO:1190, SEQ ID NO: 1193, SEQ ID NO: 1195, SEQ ID NO: 1197, SEQ ID NO: 1198, SEQ ID NO: 1199, SEQ ID NO: 1202, SEQ ID NO: 1203, SEQ ID NO: 1204, SEQ ID NO: 1205, SEQ ID NO: 1206, SEQ ID NO: 1207, SEQ ID NO: 1208, SEQ ID NO: 1209, SEQ ID NO: 1210, SEQ ID NO: 1211, SEQ ID NO: 1214, SEQ ID NO: 1215, SEQ ID NO: 1223, SEQ ID NO:1226, SEQ ID NO: 1227, SEQ ID NO: 1231, SEQ ID NO: 1232, SEQ ID NO: 1233, SEQ ID NO: 1234, SEQ ID NO: 1235, SEQ ID NO: 1237, SEQ ID NO: 1238, SEQ ID NO: 1239, SEQ ID NO: 1241, SEQ ID NO: 1242, SEQ ID NO: 1245, SEQ ID NO: 1251, SEQ ID NO: 1252, SEQ ID NO: 1253, SEQ ID NO: 1254, SEQ ID NO: 1258, SEQ ID NO: 1263, SEQ ID NO:1267, SEQ ID NO: 1268, SEQ ID NO: 1269, SEQ ID NO: 1270, SEQ ID NO: 1272, SEQ ID NO: 1273, SEQ ID NO: 1274, SEQ ID NO: 1275, SEQ ID NO: 1276, SEQ ID NO: 1278, SEQ ID NO: 1279, SEQ ID NO: 1280, SEQ ID NO: 1281, SEQ ID NO: 1282, SEQ ID NO: 1287, SEQ ID NO: 1288, SEQ ID NO: 1289, SEQ ID NO: 1290, SEQ ID NO: 1292, SEQ ID NO:1293, SEQ ID NO: 1296, SEQ ID NO: 1299, SEQ ID NO: 1300, SEQ ID NO: 1301, SEQ ID NO: 1302, SEQ ID NO: 1304, SEQ ID NO: 1305, SEQ ID NO: 1307, SEQ ID NO: 1308, SEQ ID NO: 1309, SEQ ID NO: 1310, SEQ ID NO: 1311, SEQ ID NO: 1312, SEQ ID NO: 1313, SEQ ID NO: 1314, SEQ ID NO: 1315, SEQ ID NO: 1319, SEQ ID NO: 1320, SEQ ID NO:1321, SEQ ID NO: 1322, SEQ ID NO: 1323, SEQ ID NO: 1326, SEQ ID NO: 1327, SEQ ID NO: 1328, SEQ ID NO: 1329, SEQ ID NO: 1330, SEQ ID NO: 1331, SEQ ID NO: 1334, SEQ ID NO: 1335, SEQ ID NO: 1336, SEQ ID NO: 1340, SEQ ID NO: 1362, SEQ ID NO: 1363, SEQ ID NO: 1364, SEQ ID NO: 1367, SEQ ID NO: 1369, SEQ ID NO: 1370, SEQ ID NO:1371, SEQ ID NO: 1372, SEQ ID NO: 1373, SEQ ID NO: 1377, SEQ ID NO: 1379, SEQ ID NO: 1381, SEQ ID NO: 1382, SEQ ID NO: 1383, SEQ ID NO: 1385, SEQ ID NO: 1387, SEQ ID NO: 1390, SEQ ID NO: 1391, SEQ ID NO: 1392, SEQ ID NO: 1393, SEQ ID NO: 1394, SEQ ID NO: 1397, SEQ ID NO: 1398, SEQ ID NO: 1399, SEQ ID NO: 1400, SEQ ID NO:1402, SEQ ID NO: 1403, SEQ ID NO: 1404, SEQ ID NO: 1405, SEQ ID NO: 1406, SEQ ID NO: 1407, SEQ ID NO: 1408, SEQ ID NO: 1411, SEQ ID NO: 1412, SEQ ID NO: 1413, SEQ ID NO: 1417, SEQ ID NO: 1418, SEQ ID NO: 1419, SEQ ID NO: 1420, SEQ ID NO: 1421, SEQ ID NO: 1422, SEQ ID NO: 1424, SEQ ID NO: 1425, SEQ ID NO: 1426, SEQ ID NO:1427, SEQ ID NO: 1428, SEQ ID NO: 1429, SEQ ID NO: 1430, SEQ ID NO: 1434, SEQ ID NO: 1435, SEQ ID NO: 1436, SEQ ID NO: 1437, SEQ ID NO: 1439, SEQ ID NO: 1445, SEQ ID NO: 1447, SEQ ID NO: 1448, SEQ ID NO: 1449, SEQ ID NO: 1451, SEQ ID NO: 1453, SEQ ID NO: 1454, SEQ ID NO: 1455, SEQ ID NO: 1456, SEQ ID NO: 1491, SEQ ID NO:1494, SEQ ID NO: 1497, SEQ ID NO: 1498, SEQ ID NO: 1499, SEQ ID NO: 1500, SEQ ID NO: 3346, SEQ ID NO: 3349, SEQ ID NO: 3355, SEQ ID NO: 3358, SEQ ID NO: 3360, SEQ ID NO: 3362, SEQ ID NO: 3363, SEQ ID NO: 3365, SEQ ID NO: 3369, SEQ ID NO: 3370, SEQ ID NO: 3375, SEQ ID NO: 3384, SEQ ID NO: 3385, SEQ ID NO: 3386, SEQ ID NO:3387, SEQ ID NO: 3388, SEQ ID NO: 3389, SEQ ID NO: 3390, SEQ ID NO: 3392, SEQ ID NO: 3393, SEQ ID NO: 3394, SEQ ID NO: 3395, SEQ ID NO: 3396, SEQ ID NO: 3397, SEQ ID NO: 3398, SEQ ID NO: 3399, SEQ ID NO: 3400, SEQ ID NO: 3401, SEQ ID NO: 3402, SEQ ID NO: 3403, SEQ ID NO: 3404, SEQ ID NO: 3405, SEQ ID NO: 3406, SEQ ID NO:3407, SEQ ID NO: 3408, SEQ ID NO: 3409, SEQ ID NO: 3410, SEQ ID NO: 3411, SEQ ID NO: 3412, SEQ ID NO: 3413, SEQ ID NO: 3414, SEQ ID NO: 3415, SEQ ID NO: 3416, SEQ ID NO: 3417, SEQ ID NO: 3418, SEQ ID NO: 3419, SEQ ID NO: 3420, SEQ ID NO: 3421, SEQ ID NO: 3422, SEQ ID NO: 3424, SEQ ID NO: 3425, SEQ ID NO: 3426, SEQ ID NO:3427, SEQ ID NO: 3428, SEQ ID NO: 3429, SEQ ID NO: 3430, SEQ ID NO: 3431, SEQ ID NO: 3432, SEQ ID NO: 3433, SEQ ID NO: 3434, SEQ ID NO: 3435, SEQ ID NO: 3436, SEQ ID NO: 3437, SEQ ID NO: 3438, SEQ ID NO: 3439, SEQ ID NO: 3440, SEQ ID NO: 3441, SEQ ID NO: 3442, SEQ ID NO: 3443, SEQ ID NO: 3444, SEQ ID NO: 3445, SEQ ID NO:3446, SEQ ID NO: 3447, SEQ ID NO: 3450, SEQ ID NO: 3451, SEQ ID NO: 3455, SEQ ID NO: 3457, SEQ ID NO: 3458, SEQ ID NO: 3459, SEQ ID NO: 3460, SEQ ID NO: 3461, SEQ ID NO: 3462, SEQ ID NO: 3463, SEQ ID NO: 3464, SEQ ID NO: 3465, SEQ ID NO: 3466, SEQ ID NO: 3467, SEQ ID NO: 3468, SEQ ID NO: 3469, SEQ ID NO: 3470, SEQ ID NO:3471, SEQ ID NO: 3472, SEQ ID NO: 3474, SEQ ID NO: 3475, SEQ ID NO: 3477, SEQ ID NO: 3478, SEQ ID NO: 3479, SEQ ID NO: 3480, SEQ ID NO: 3481, SEQ ID NO: 3482, SEQ ID NO: 3483, SEQ ID NO: 3485, SEQ ID NO: 3486, SEQ ID NO: 3487, SEQ ID NO: 3488, SEQ ID NO: 3489, SEQ ID NO: 3490, SEQ ID NO: 3491, SEQ ID NO: 3493, SEQ ID NO:3494, SEQ ID NO: 3495, SEQ ID NO: 3496, SEQ ID NO: 3497, SEQ ID NO: 3498, SEQ ID NO: 3499, SEQ ID NO: 3500, SEQ ID NO: 3501, SEQ ID NO: 3502, SEQ ID NO: 3503, SEQ ID NO: 3504, SEQ ID NO: 3505, SEQ ID NO: 3506, SEQ ID NO: 3507, SEQ ID NO: 3508, SEQ ID NO: 3509, SEQ ID NO: 3510, SEQ ID NO: 3511, SEQ ID NO: 3512, SEQ ID NO:3513, SEQ ID NO: 3514, SEQ ID NO: 3515, SEQ ID NO: 3516, SEQ ID NO: 3517, SEQ ID NO: 3518, SEQ ID NO: 3519, SEQ ID NO: 3521, SEQ ID NO: 3523, SEQ ID NO: 3524, SEQ ID NO: 3526, SEQ ID NO: 3529, SEQ ID NO: 3531, SEQ ID NO: 3532, SEQ ID NO: 3533, SEQ ID NO: 3534, SEQ ID NO: 3535, SEQ ID NO: 3536, SEQ ID NO: 3537, SEQ ID NO:3538, SEQ ID NO: 3539, SEQ ID NO: 3540, SEQ ID NO: 3541, SEQ ID NO: 3542, SEQ ID NO: 3543, SEQ ID NO: 3544, SEQ ID NO: 3545, SEQ ID NO: 3546, SEQ ID NO: 3547, SEQ ID NO: 3548, SEQ ID NO: 3549, SEQ ID NO: 3550, SEQ ID NO: 3551, SEQ ID NO: 3552, SEQ ID NO: 3553, SEQ ID NO: 3554, SEQ ID NO: 3555, SEQ ID NO: 3556, SEQ ID NO:3557, SEQ ID NO: 3558, SEQ ID NO: 3559, SEQ ID NO: 3560, SEQ ID NO: 3561, SEQ ID NO: 3562, SEQ ID NO: 3563, SEQ ID NO: 3564, SEQ ID NO: 3566, SEQ ID NO: 3567, SEQ ID NO: 3568, SEQ ID NO: 3569, SEQ ID NO: 3570, SEQ ID NO: 3572, SEQ ID NO: 3573, SEQ ID NO: 3574, SEQ ID NO: 3575, SEQ ID NO: 3577, SEQ ID NO: 3578, SEQ ID NO:3579, SEQ ID NO: 3580, SEQ ID NO: 3581, SEQ ID NO: 3582, SEQ ID NO: 3583, SEQ ID NO: 3584, SEQ ID NO: 3585, SEQ ID NO: 3586, SEQ ID NO: 3589, SEQ ID NO: 3590, SEQ ID NO: 3591, SEQ ID NO: 3592, SEQ ID NO: 3593, SEQ ID NO: 3594, SEQ ID NO: 3595, SEQ ID NO: 3597, SEQ ID NO: 3602, SEQ ID NO: 3608, SEQ ID NO: 3609, SEQ ID NO:3610, SEQ ID NO: 3611, SEQ ID NO: 3612, SEQ ID NO: 3613, SEQ ID NO: 3614, SEQ ID NO: 3615, SEQ ID NO: 3616, SEQ ID NO: 3617, SEQ ID NO: 3618, SEQ ID NO: 3619, SEQ ID NO: 3620, SEQ ID NO: 3621, SEQ ID NO: 3622, SEQ ID NO: 3623, SEQ ID NO: 3624, SEQ ID NO: 3625, SEQ ID NO: 3626, SEQ ID NO: 3627, SEQ ID NO: 3628, SEQ ID NO:3629, SEQ ID NO: 3630, SEQ ID NO: 3631, SEQ ID NO: 3634, SEQ ID NO: 3635, SEQ ID NO: 3636, SEQ ID NO: 3639, SEQ ID NO: 3640, SEQ ID NO: 3641, SEQ ID NO: 3642, SEQ ID NO: 3643, SEQ ID NO: 3644, SEQ ID NO: 3645, SEQ ID NO: 3646, SEQ ID NO: 3647, SEQ ID NO: 3648, SEQ ID NO: 3649, SEQ ID NO: 3650, SEQ ID NO: 3651, SEQ ID NO:3652, SEQ ID NO: 3653, SEQ ID NO: 3654, SEQ ID NO: 3655, SEQ ID NO: 3657, SEQ ID NO: 3658, SEQ ID NO: 3659, SEQ ID NO: 3661, SEQ ID NO: 3663, SEQ ID NO: 3664, SEQ ID NO: 3665, SEQ ID NO: 3666, SEQ ID NO: 3667, SEQ ID NO: 3668, SEQ ID NO: 3669, SEQ ID NO: 3671, SEQ ID NO: 3672, SEQ ID NO: 3673, SEQ ID NO: 3674, SEQ ID NO:3675, SEQ ID NO: 3678, SEQ ID NO: 3679, SEQ ID NO: 3680, SEQ ID NO: 3682, SEQ ID NO: 3683, SEQ ID NO: 3684, SEQ ID NO: 3685, SEQ ID NO: 3687, SEQ ID NO: 3688, SEQ ID NO: 3689, SEQ ID NO: 3690, SEQ ID NO: 3691, SEQ ID NO: 3692, SEQ ID NO: 3693, SEQ ID NO: 3695, SEQ ID NO: 3696, SEQ ID NO: 3697, SEQ ID NO: 3698, SEQ ID NO:3699, SEQ ID NO: 3700, SEQ ID NO: 3702, SEQ ID NO: 3717, SEQ ID NO: 3718, SEQ ID NO: 3720, SEQ ID NO: 3721, SEQ ID NO: 3722, SEQ ID NO: 3725, SEQ ID NO: 3726, SEQ ID NO: 3727, SEQ ID NO: 3728, SEQ ID NO: 3729, SEQ ID NO: 3730, SEQ ID NO: 3731, SEQ ID NO: 3732, SEQ ID NO: 3733, SEQ ID NO: 3734, SEQ ID NO: 3735, SEQ ID NO:3736, SEQ ID NO: 3740, SEQ ID NO: 3742, SEQ ID NO: 3743, SEQ ID NO: 3744, SEQ ID NO: 3746, SEQ ID NO: 3747, SEQ ID NO: 3748, SEQ ID NO: 3749, SEQ ID NO: 3750, SEQ ID NO: 3751, SEQ ID NO: 3752, SEQ ID NO: 3753, SEQ ID NO: 3754, SEQ ID NO: 3755, SEQ ID NO: 3756, SEQ ID NO: 3757, SEQ ID NO: 3758, SEQ ID NO: 3759, SEQ ID NO:3760, SEQ ID NO: 3761, SEQ ID NO: 3762, SEQ ID NO: 3763, SEQ ID NO: 3764, SEQ ID NO: 3765, SEQ ID NO: 3766, SEQ ID NO: 3767, SEQ ID NO: 3768, SEQ ID NO: 3769, SEQ ID NO: 3770, SEQ ID NO: 3771, SEQ ID NO: 3772, SEQ ID NO: 3773, SEQ ID NO: 3774, SEQ ID NO: 3775, SEQ ID NO: 3776, SEQ ID NO: 3777, SEQ ID NO: 3778, SEQ ID NO:3779, SEQ ID NO: 3780, SEQ ID NO: 3781, SEQ ID NO: 3782, SEQ ID NO: 3783, SEQ ID NO: 3784, SEQ ID NO: 3785, SEQ ID NO: 3786, SEQ ID NO: 3787, SEQ ID NO: 3788, SEQ ID NO: 3789, SEQ ID NO: 3790, SEQ ID NO: 3791, SEQ ID NO: 3792, SEQ ID NO: 3793, SEQ ID NO: 3794, SEQ ID NO: 3795, SEQ ID NO: 3796, SEQ ID NO: 3797, SEQ ID NO:3798, SEQ ID NO: 3801, SEQ ID NO: 3803, SEQ ID NO: 3804, SEQ ID NO: 3807, SEQ ID NO: 3808, SEQ ID NO: 3809, SEQ ID NO: 3810, SEQ ID NO: 3811, SEQ ID NO: 3812, SEQ ID NO: 3813, SEQ ID NO: 3814, SEQ ID NO: 3815, SEQ ID NO: 3816, SEQ ID NO: 3817, SEQ ID NO: 3818, SEQ ID NO: 3834, SEQ ID NO: 3841, SEQ ID NO: 3851, SEQ ID NO:3855, SEQ ID NO: 3858, SEQ ID NO: 3860, SEQ ID NO: 3869, SEQ ID NO: 3873, SEQ ID NO: 3883, SEQ ID NO: 3884, SEQ ID NO: 3885, SEQ ID NO: 3887, SEQ ID NO: 3889, SEQ ID NO: 3890, SEQ ID NO: 3891, SEQ ID NO: 3892, SEQ ID NO: 3893, SEQ ID NO: 3894, SEQ ID NO: 3895, SEQ ID NO: 3896, SEQ ID NO: 3897, SEQ ID NO: 3898, SEQ ID NO:3899, SEQ ID NO: 3900, SEQ ID NO: 3901, SEQ ID NO: 3913, SEQ ID NO: 3919, and SEQ ID NO: 3929.56.The viral capsid polypeptide according to any one of claims 50 to 55, wherein the viral capsid polypeptide is a viral capsid polypeptide of an adeno associated virus (AAV) .57.The viral capsid polypeptide according to claim 56, wherein the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, andAvian AAV.58.The viral capsid polypeptide according to any one of claims 50 to 57, wherein the viral capsid polypeptide is a viral capsid polypeptide of engineered AAV9.59.The viral capsid polypeptide according to any one of claims 50 to 58, wherein the viral capsid polypeptide has tropism to one or more target tissues.60.The viral capsid polypeptide according to any one of claims 50 to 59, wherein the viral capsid polypeptide has tropism to central nervous systems.61.The viral capsid polypeptide according to any one of claims 50 to 60, wherein the viral capsid polypeptide has tropism to one or more target organs.62.The viral capsid polypeptide according to any one of claims 50 to 61, wherein the viral capsid polypeptide has tropism to one or more target organs selected from brain and spinal cord.63.A polynucleotide encoding the viral capsid polypeptide according to any one of claims 50 to 62.64.An adeno associated virus (AAV) vector, comprising the polynucleotide according to claim 63.65.A kit comprising: the viral capsid polypeptide according to any one of claims 50 to 62, the polynucleotide according to claim 63, or the adeno associated virus vector according to claim 64.66.A cell comprising the viral capsid polypeptide according to any one of claims 50 to 62, or the polynucleotide according to claim 63.67.A pharmaceutical composition comprising the viral capsid polypeptide according to any one of claims 50 to 62, the polynucleotide according to claim 63, or the adeno associated virus (AAV) vector according to claim 64.68.A method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with the adeno associated adeno associated virus (AAV) vector according to claim 64, wherein the AAV vector further comprises payload polynucleotide.69.The method according to claim 68, wherein the cell is a somatic cell.70.The method according to claim 68 or 69, wherein the cell is a neuron cell or a glia cell.71.A viral capsid polypeptide, comprising an amino acid sequence W1-Arg-Gly-Asp-W2-W3-W4-W5,wherein W1, W2, W3, W4, and W5 are each an amino acid residue;whereinW2 is Leu, Met, Val, Ala, Gly, Ile, Asn, Pro, Gln, or Thr; andW5 is Gln, Leu, Phe, Val, Ile, Met, Tyr, Lys, Asn, Trp, or Thr; andwherein W1-Arg-Gly-Asp-W2-W3-W4-W5 is any one selected from SEQ ID NOs: 4497-4854.72.The viral capsid polypeptide according to claim 71, comprising an amino acid sequence selected from: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 10, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 22, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 58, SEQ ID NO: 61, SEQ ID NO: 63, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 75, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 86, SEQ ID NO: 93, SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 106, SEQ ID NO: 107, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 113, SEQ ID NO: 114, SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, SEQ ID NO:118, SEQ ID NO: 124, SEQ ID NO: 125, SEQ ID NO: 126, SEQ ID NO: 128, SEQ ID NO:129, SEQ ID NO: 130, SEQ ID NO: 132, SEQ ID NO: 133, SEQ ID NO: 134, SEQ ID NO:136, SEQ ID NO: 137, SEQ ID NO: 138, SEQ ID NO: 142, SEQ ID NO: 143, SEQ ID NO:144, SEQ ID NO: 145, SEQ ID NO: 148, SEQ ID NO: 152, SEQ ID NO: 156, SEQ ID NO:157, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, SEQ ID NO:165, SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 170, SEQ ID NO: 171, SEQ ID NO:172, SEQ ID NO: 173, SEQ ID NO: 175, SEQ ID NO: 178, SEQ ID NO: 183, SEQ ID NO:184, SEQ ID NO: 186, SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 193, SEQ ID NO:194, SEQ ID NO: 195, SEQ ID NO: 198, SEQ ID NO: 200, SEQ ID NO: 203, SEQ ID NO:207, SEQ ID NO: 210, SEQ ID NO: 212, SEQ ID NO: 213, SEQ ID NO: 214, SEQ ID NO:216, SEQ ID NO: 217, SEQ ID NO: 220, SEQ ID NO: 221, SEQ ID NO: 222, SEQ ID NO:223, SEQ ID NO: 225, SEQ ID NO: 229, SEQ ID NO: 232, SEQ ID NO: 234, SEQ ID NO:246, SEQ ID NO: 248, SEQ ID NO: 252, SEQ ID NO: 269, SEQ ID NO: 274, SEQ ID NO:278, SEQ ID NO: 282, SEQ ID NO: 283, SEQ ID NO: 284, SEQ ID NO: 290, SEQ ID NO:303, SEQ ID NO: 304, SEQ ID NO: 305, SEQ ID NO: 310, SEQ ID NO: 311, SEQ ID NO:312, SEQ ID NO: 316, SEQ ID NO: 317, SEQ ID NO: 318, SEQ ID NO: 321, SEQ ID NO:322, SEQ ID NO: 323, SEQ ID NO: 326, SEQ ID NO: 332, SEQ ID NO: 336, SEQ ID NO:337, SEQ ID NO: 343, SEQ ID NO: 344, SEQ ID NO: 346, SEQ ID NO: 347, SEQ ID NO:348, SEQ ID NO: 351, SEQ ID NO: 352, SEQ ID NO: 353, SEQ ID NO: 354, SEQ ID NO:355, SEQ ID NO: 358, SEQ ID NO: 363, SEQ ID NO: 364, SEQ ID NO: 365, SEQ ID NO:367, SEQ ID NO: 369, SEQ ID NO: 389, SEQ ID NO: 408, SEQ ID NO: 411, SEQ ID NO:418, SEQ ID NO: 420, SEQ ID NO: 423, SEQ ID NO: 428, SEQ ID NO: 431, SEQ ID NO:432, SEQ ID NO: 433, SEQ ID NO: 434, SEQ ID NO: 435, SEQ ID NO: 436, SEQ ID NO:438, SEQ ID NO: 441, SEQ ID NO: 442, SEQ ID NO: 443, SEQ ID NO: 444, SEQ ID NO:446, SEQ ID NO: 447, SEQ ID NO: 448, SEQ ID NO: 452, SEQ ID NO: 456, SEQ ID NO:460, SEQ ID NO: 467, SEQ ID NO: 477, SEQ ID NO: 478, SEQ ID NO: 484, SEQ ID NO:486, SEQ ID NO: 487, SEQ ID NO: 488, SEQ ID NO: 490, SEQ ID NO: 497, SEQ ID NO:498, SEQ ID NO: 499, SEQ ID NO: 501, SEQ ID NO: 504, SEQ ID NO: 505, SEQ ID NO:508, SEQ ID NO: 511, SEQ ID NO: 517, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO:522, SEQ ID NO: 525, SEQ ID NO: 526, SEQ ID NO: 527, SEQ ID NO: 542, SEQ ID NO:544, SEQ ID NO: 545, SEQ ID NO: 546, SEQ ID NO: 547, SEQ ID NO: 549, SEQ ID NO:550, SEQ ID NO: 555, SEQ ID NO: 557, SEQ ID NO: 558, SEQ ID NO: 559, SEQ ID NO:560, SEQ ID NO: 568, SEQ ID NO: 569, SEQ ID NO: 570, SEQ ID NO: 571, SEQ ID NO:575, SEQ ID NO: 576, SEQ ID NO: 577, SEQ ID NO: 580, SEQ ID NO: 583, SEQ ID NO:599, SEQ ID NO: 601, SEQ ID NO: 605, SEQ ID NO: 615, SEQ ID NO: 616, SEQ ID NO:617, SEQ ID NO: 618, SEQ ID NO: 620, SEQ ID NO: 621, SEQ ID NO: 622, SEQ ID NO:623, SEQ ID NO: 624, SEQ ID NO: 636, SEQ ID NO: 639, SEQ ID NO: 640, SEQ ID NO:641, SEQ ID NO: 642, SEQ ID NO: 643, SEQ ID NO: 650, SEQ ID NO: 652, SEQ ID NO:653, SEQ ID NO: 654, SEQ ID NO: 656, SEQ ID NO: 657, SEQ ID NO: 658, SEQ ID NO:661, SEQ ID NO: 669, SEQ ID NO: 673, SEQ ID NO: 674, SEQ ID NO: 676, SEQ ID NO:677, SEQ ID NO: 679, SEQ ID NO: 680, SEQ ID NO: 681, SEQ ID NO: 682, SEQ ID NO:683, SEQ ID NO: 684, SEQ ID NO: 687, SEQ ID NO: 689, SEQ ID NO: 691, SEQ ID NO:698, SEQ ID NO: 699, SEQ ID NO: 700, SEQ ID NO: 701, SEQ ID NO: 702, SEQ ID NO:712, SEQ ID NO: 714, SEQ ID NO: 716, SEQ ID NO: 727, SEQ ID NO: 732, SEQ ID NO:742, SEQ ID NO: 747, SEQ ID NO: 748, SEQ ID NO: 749, SEQ ID NO: 751, SEQ ID NO:752, SEQ ID NO: 755, SEQ ID NO: 759, SEQ ID NO: 762, SEQ ID NO: 764, SEQ ID NO:769, SEQ ID NO: 770, SEQ ID NO: 773, SEQ ID NO: 777, SEQ ID NO: 782, SEQ ID NO:783, SEQ ID NO: 785, SEQ ID NO: 786, SEQ ID NO: 794, SEQ ID NO: 808, SEQ ID NO:810, SEQ ID NO: 827, SEQ ID NO: 836, SEQ ID NO: 840, SEQ ID NO: 843, SEQ ID NO:855, SEQ ID NO: 856, SEQ ID NO: 857, SEQ ID NO: 858, SEQ ID NO: 859, SEQ ID NO:861, SEQ ID NO: 864, SEQ ID NO: 868, SEQ ID NO: 877, SEQ ID NO: 888, SEQ ID NO:889, SEQ ID NO: 896, SEQ ID NO: 903, SEQ ID NO: 911, SEQ ID NO: 913, SEQ ID NO:917, SEQ ID NO: 920, SEQ ID NO: 921, SEQ ID NO: 924, SEQ ID NO: 925, SEQ ID NO:929, SEQ ID NO: 936, SEQ ID NO: 943, SEQ ID NO: 953, SEQ ID NO: 955, SEQ ID NO:967, SEQ ID NO: 985, SEQ ID NO: 991, SEQ ID NO: 1001, SEQ ID NO: 1006, SEQ ID NO:1013, SEQ ID NO: 1018, SEQ ID NO: 1027, SEQ ID NO: 1028, SEQ ID NO: 1032, SEQ ID NO: 1033, SEQ ID NO: 1035, SEQ ID NO: 1036, SEQ ID NO: 1041, SEQ ID NO: 1044, SEQ ID NO: 1047, SEQ ID NO: 1048, SEQ ID NO: 1052, SEQ ID NO: 1053, SEQ ID NO: 1058, SEQ ID NO: 1059, SEQ ID NO: 1063, SEQ ID NO: 3345, SEQ ID NO: 3383, SEQ ID NO:3437, SEQ ID NO: 3438, SEQ ID NO: 3449, SEQ ID NO: 3462, SEQ ID NO: 3464, SEQ ID NO: 3484, SEQ ID NO: 3492, SEQ ID NO: 3493, SEQ ID NO: 3505, SEQ ID NO: 3506, SEQ ID NO: 3571, SEQ ID NO: 3604, SEQ ID NO: 3681, SEQ ID NO: 3703, SEQ ID NO: 3705, SEQ ID NO: 3706, SEQ ID NO: 3707, SEQ ID NO: 3708, SEQ ID NO: 3714, SEQ ID NO:3796, SEQ ID NO: 3811, SEQ ID NO: 3819, SEQ ID NO: 3822, SEQ ID NO: 3823, SEQ ID NO: 3824, SEQ ID NO: 3825, SEQ ID NO: 3826, SEQ ID NO: 3827, SEQ ID NO: 3828, SEQ ID NO: 3829, SEQ ID NO: 3830, SEQ ID NO: 3831, SEQ ID NO: 3832, SEQ ID NO: 3846, SEQ ID NO: 3847, SEQ ID NO: 3853, SEQ ID NO: 3855, SEQ ID NO: 3858, SEQ ID NO:3863, SEQ ID NO: 3866, SEQ ID NO: 3869, SEQ ID NO: 3878, SEQ ID NO: 3880, SEQ ID NO: 3884, SEQ ID NO: 3902, SEQ ID NO: 3903, SEQ ID NO: 3904, SEQ ID NO: 3905, SEQ ID NO: 3906, SEQ ID NO: 3913, SEQ ID NO: 3919, SEQ ID NO: 3924, and SEQ ID NO:3929.73.The viral capsid polypeptide according to claim 71 or 72, wherein the viral capsid polypeptide is a viral capsid polypeptide of an adeno associated virus (AAV) .74.The viral capsid polypeptide according to claim 73, wherein the viral capsid polypeptide is a viral capsid polypeptide of an engineered adeno associated virus derived from a parental virus selected from AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrh74, AAVrh10, AAVDJ, AAVDJ / 8, AAV-PHP. eB, AAV-PHP. S, AAV2-retro, AAV2-QuadYF, AAV2.7m8, or Avian AAV.75.The viral capsid polypeptide according to any one of claims 71 to 74, wherein the viral capsid polypeptide is a viral capsid polypeptide of engineered AAV9.76.The viral capsid polypeptide according to any one of claims 71 to 75, wherein the viral capsid polypeptide has tropism to one or more target tissues.77.The viral capsid polypeptide according to any one of claims 71 to 76, wherein the viral capsid polypeptide has tropism to central nervous systems.78.The viral capsid polypeptide according to any one of claims 71 to 77, wherein the viral capsid polypeptide has tropism to heart.79.A polynucleotide encoding the viral capsid polypeptide according to any one of claims 71 to 78.80.An adeno associated virus (AAV) vector, comprising the polynucleotide according to claim 79.81.A kit comprising: the viral capsid polypeptide according to any one of claims 71 to 78, the polynucleotide according to claim 79, or the adeno associated virus vector according to claim 80.82.A cell comprising the viral capsid polypeptide according to any one of claims 71 to 78, or the polynucleotide according to claim 79.83.A pharmaceutical composition comprising the viral capsid polypeptide according to any one of claims 70 to 78, the polynucleotide according to claim 79, or the adeno associated virus (AAV) vector according to claim 80.84.A method of delivering a payload polynucleotide to a cell, comprising: contacting the cell with the adeno associated adeno associated virus (AAV) vector according to claim 80, wherein the AAV vector further comprises payload polynucleotide.85.The method according to claim 84, wherein the cell is a somatic cell.86.The method according to claim 84 or 85, wherein the cell is a glia cell or a neuron cell.87.The method according to any one of claims 84 or 85, wherein the cell is a cardiomyocyte.88.A targeting moiety comprising one or more motifs selected from the amino acid sequence X1X2RGDX3X4X5 of claim 1, the amino acid sequence X1’X2’RGDX3’X4’X5’ of claim 10, the amino acid sequence Y1RGDY2Y3Y4Y5 of claim 29, the amino acid sequence Y1'RGDY2'Y3'Y4'Y5' of claim 32, the amino acid sequence Z1NZ2Z3Z4 of claim 50, the amino acid sequence Z1'NZ2'Z3'Z4' of claim 53, and the amino acid sequence W1RGDW2W3W4W5 of claim 71 and any combinations thereof, and optionally a polypeptide, a polynucleotide, a lipid, a polymer, a sugar, or any combination thereof.89.The targeting moiety according to claim 88, wherein the targeting moiety comprises one or more of the sequences disclosed in Tables 1-13.90.A composition comprising the targeting moiety of claim 88 or 89 and a payload.

Images