PAN-ELR+ CXC CHEMOKINE ANTIBODIES AND IL-23p19 ANTIBODIES FOR THE TREATMENT OF ULCERATIVE COLITIS
Combining antibodies targeting ELR+ CXC chemokines and IL-23p19 in specific dosing regimens addresses the limitations of existing ulcerative colitis treatments, achieving enhanced therapeutic effects in patients.
Patent Information
- Application Number
- PCT/US2025/046081
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-09-13
- Filing Date
- 2025-09-12
- Publication Date
- 2026-03-19
AI Technical Summary
There is a need for improved treatment options for ulcerative colitis that offer enhanced efficacy, safety, and tolerability, particularly in terms of dosage regimens, as conventional medications and existing biologics do not adequately address the disease in many patients.
A combination therapy using antibodies that bind to ELR+ CXC chemokines, such as eltrekibart, and antibodies that bind to human IL-23p19, such as mirikizumab, administered in various dosing regimens including simultaneous, separate, or sequential combinations during induction and maintenance periods to induce and maintain therapeutic effects in patients with ulcerative colitis.
The combination therapy leads to more rapid symptomatic, clinical, and histologic improvement in patients with ulcerative colitis, providing improved therapeutic outcomes.
Smart Images

Figure IMGF000009_0001 
Figure IMGF000031_0001 
Figure IMGF000033_0001
Abstract
Description
AND IL-23p19 ANTIBODIES FOR THE TREATMENT OF ULCERATIVE COLITIS REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY
[0001] The present application is filed along with a Sequence Listing in ST.26 XML format. The Sequence Listing is provided as a filed titled “31043_WO.xml”, created on 8 September 2025 and is 21 kilobytes in size. The Sequence Listing information in the ST.26 XML format is incorporated herein by reference in its entirety. FIELD OF THE INVENTION
[0002] The present invention relates to methods and uses of antibodies that bind to ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with antibodies that bind to human IL-23p19 for the treatment of ulcerative colitis. The present invention also relates to doses and dosing regimens for the methods and uses of antibodies that bind to ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with antibodies that bind to human IL-23p19 for the treatment of ulcerative colitis. BACKGROUND OF THE INVENTION
[0003] Ulcerative colitis (UC) is a chronic disease of unknown cause, characterized by inflammation in the colon. Patients have intermittent disease flares interspersed with periods of remission; the primary symptoms include blood in the stool, diarrhea, bowel urgency, and abdominal pain. Many patients with UC experience a severe clinical course: approximately 30% require colectomy within 10 years of diagnosis (Ordás et al., Lancet, Vol.380, No.9853, pp1606-1619, 2012). The treatment goal in UC is the induction and maintenance of remission (including steroid-free remission). Conventional medications used for treatment of UC include 5–aminosalicylic acid (5-ASA), steroids, and immunosuppressive drugs such as azathioprine (AZA) and 6-mercaptopurine (6-MP). However, as many as 40% of patients with UC do not respond or maintain a response to conventional medications and require secondary drug treatment or colectomy (Burger D et al., Gastroenterology, Vol.140, No.6, pp1827-1837, 2011). As a result, various biologics that target specific immunological pathways have been studied as potential therapeutics for UC.because members of the chemokine family all possess an E-L-R amino acid motif immediately adjacent to their CXC motif) play an important role in a variety of pathogenic mechanisms.
[0005] Chemokines are grouped into four subfamilies: CXC, CC, (X)C, and CX3C. In the CXC chemokines, one amino acid separates the first two cysteines (“the CXC motif”). ELR+ CXC chemokines are ligands for CXCR l and / or CXCR2 chemokine receptors, which are G-protein coupled seven transmembrane domain-type receptors that specifically bind ELR+ CXC chemokines. The seven human ELR+ CXC chemokines are human growth-regulated oncogene (“Gro”)-alpha (also known as CXCL1), human Gro- beta (also known as CXCL2), human Gro-gamma (also known as CXCL3), human ENA- 78 (also known as CXCL5 or human epithelial neutrophil activating peptide-78), human GCP-2 (also known as CXCL6 or human granulocyte chemotactic protein-2), human NAP-2 (also known as CXCL7 or human neutrophil activating protein-2), and human IL- 8 (also known as CXCL8 or human interleukin-8). All ELR+ CXC chemokines bind the CXCR2 receptor; moreover, some ELR+ CXC chemokines bind both CXCR l and CXCR2 receptors (i.e., CXCL6 and CXCL8), all of which contributes to redundancy in the activation pathways.
[0006] Antibodies that bind to ELR+ CXC chemokines have been previously described, e.g., in WO 2014149733, EP 2970447B1, US 9290570, WO 2008130969, including eltrekibart described herein that binds and neutralizes all seven human ELR+ CXC chemokines. Given their ability to bind and neutralize all seven human ELR+ CXC chemokines, those antibodies may offer advantages over monotherapies targeting single human ELR+ CXC chemokines and combination therapies targeting multiple human ELR+ CXC chemokines.
[0007] Interleukin-23 (IL-23), a member of the interleukin-12 (IL-12) family of cytokines, is a heterodimeric protein composed of two subunits: the p40 subunit, which is shared by IL-12, and the p19 subunit, which is specific to IL-23. IL-23 receptor engagement leads to activation of JAKs (mainly TYK2 and JAK2) and signal transducer and activator of transcription 3 and 4 (STAT3 and STAT4), triggering transcription of downstream target genes. IL-23 promotes the differentiation, maintenance and stabilization of pathogenic T-cell lineages, including populations that simultaneously produce multiple pro-inflammatory cytokines, such as interferon-γ, IL-17A, IL-17F andof effector function of colitogenic innate lymphoid cells. Anti-IL-23p19 and IL-12 / IL-23p40 antibodies have been approved for the treatment of UC.
[0008] Antibodies that bind to human IL-23p19 include mirikizumab. Mirikizumab is a humanized IgG4 variant mAb that is directed against the p19 subunit of IL-23 and does not bind IL-12. Mirikizumab is approved for the treatment of UC in adult patients. Treatment of adult patients with mirikizumab has been reported in WO2019191464.
[0009] There remains a need for treatment options for ulcerative colitis that lead to improved outcomes for patients, for example, in terms of efficacy, safety and / or tolerability of the treatment. In particular, there remains a need for treatment options in the form of dosage regimen that provide improved efficacy. SUMMARY OF THE INVENTION
[0010] Combination therapy with antibodies that bind to ELR+ CXC chemokines, such as eltrekibart, and antibodies that bind to human IL-23p19, such as mirikizumab may induce improved therapeutic effects, such as more rapid symptomatic, clinical, and / or histologic improvement in patients with UC.
[0011] The present invention relates to methods and uses of antibodies that bind to ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with antibodies that bind to human IL-23p19 for the treatment of ulcerative colitis. All treatment methods and dosage regimens disclosed in the present invention require a combination of both active molecules administered simultaneously, separately, or sequentially. In some embodiments, antibodies that bind to ELR+ CXC chemokines are administered as part of an induction dose or induction period in combination with a maintenance dose or maintenance period comprising administration of antibodies that bind to human IL-23p19. In some embodiments, antibodies that bind to human IL-23p19 are administered as part of an induction dose or induction period in combination with a maintenance dose or maintenance period comprising administration of antibodies that bind to ELR+ CXC chemokines. In some embodiments, antibodies that bind to human IL-23p19 are administered in combination with antibodies that bind to ELR+ CXC chemokines as part of an induction dose or induction period, followed by a maintenance dose or maintenance period comprising administration of antibodies that bind to ELR+ CXC chemokines or antibodies that bind to human IL-23p19.comprise administration of at least one induction dose of an antibody that binds human ELR+ CXC chemokines, at least one induction dose of an anti-IL-23p19 antibody or at least one induction dose of an antibody that binds human ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of an anti- IL-23p19 antibody to a patient in need thereof in an induction period to induce a desired therapeutic effect(s). If the patient achieves a desired therapeutic effect at the end of the induction period, they are subsequently administered at least one maintenance dose of an antibody that binds human ELR+ CXC chemokines, at least one maintenance dose of an anti-IL-23p19 antibody or at least one maintenance dose of an antibody that binds human ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with at least one maintenance dose of an anti-IL-23p19 antibody to maintain at least one of the therapeutic effect(s) obtained during the induction period.
[0013] In some embodiments a therapeutic effect or response to treatment can include any one or more of, clinical response, clinical remission, endoscopic remission, histologic-endoscopic mucosal remission, symptomatic remission, symptomatic response, histologic-endoscopic mucosal improvement, corticosteroid free remission, bowel urgency remission, improvement in bowel urgency, improvement in stool frequency, decrease in nocturnal stools, improvement in fatigue, improvement in abdominal pain, improvement in rectal bleeding, improvement in endoscopic response and / or improvement in other symptoms associated with ulcerative colitis.
[0014] The present invention provides a method of treating ulcerative colitis comprising administering to a human patient an antibody that binds human ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody.
[0015] In some embodiments, the antibody that binds human ELR+ CXC chemokines binds one or more of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8. In some embodiments, the antibody that binds human ELR+ CXC chemokines binds two or more (2, 3, 4, 5, 6 or 7) of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, humanneutrophil activating protein-2 and human interleukin-8. In some embodiments, the antibody that binds human ELR+ CXC chemokines binds human pan-ELR+ CXC chemokines including all of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8.
[0016] In some embodiments, the antibody that binds human ELR+ CXC chemokines comprises light chain complementarity determining regions (“LCDR”) LCDR1, LCDR2, LCDR3, and heavy chain complementarity determining regions (“HCDR”) HCDR1, HCDR2, HCDR3, wherein LCDR1 comprises SEQ ID NO: 7, LCDR2 comprises SEQ ID NO: 8, LCDR3 comprises SEQ ID NO: 9, HCDR1 comprises SEQ ID NO: 10, HCDR2 comprises SEQ ID NO: 11, and HCDR3 comprises SEQ ID NO: 12. In some embodiments, the antibody that binds human ELR+ CXC chemokines comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4. In some embodiments, the antibody that binds human ELR+ CXC chemokines comprises a heavy chain having the amino acid sequence of SEQ ID NO: 1 and a light chain having the amino acid sequence of SEQ ID NO: 3. In some embodiments, the antibody that binds human ELR+ CXC chemokines is eltrekibart.
[0017] In some embodiments, the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab and any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL- 23p19 antibody comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 18 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 19. In some embodiments, the anti-IL-23p19 antibody comprises a heavy chain having the amino acid sequence of SEQ ID NO: 20 and a light chain having the amino acid sequence of SEQ ID NO: 21. In some embodiments, the anti- IL-23p19 antibody is mirikizumab.
[0018] In some embodiments, the ulcerative colitis is moderate to severe ulcerative colitis. In some embodiments, the patient is biologic-naïve. In some embodiments, the patient is biologic-experienced. In some embodiments, the patient is not biologic-failed. In some embodiments, the patient is biologic-failed or is conventional-failed.comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody.
[0020] In some embodiments, the method comprises: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody.
[0021] In some embodiments, the method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti- IL-23p19 antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody.
[0022] In some embodiments, the method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the inductionabout 50 mg to about 1200 mg of the anti- IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody.
[0023] In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 1000 mg intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 1500 mg subcutaneously.
[0024] In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered about once every two weeks. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered about once every four weeks.
[0025] In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 600 mg about once every two weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg to about 600 mg about once every two weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 150 mg about once every two weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg about once every two weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg about once every two weeks intravenously.
[0026] In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 900 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg to about 900 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC600 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 900 mg about once every two weeks subcutaneously.
[0027] In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 600 mg about once every four weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg to about 600 mg about once every four weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 150 mg about once every four weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg about once every four weeks intravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg about once every fourintravenously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 900 mg about once every four weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg to about 900 mg about once every four weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg about once every four weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg about once every four weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg about once every four weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 900 mg about once every four weeks subcutaneously.
[0028] In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg intravenously. In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 200 mg to about 600 mg intravenously. In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mganti-IL-23p19 antibody is administered at a dose of about 300 mg intravenously. In some embodiments, the anti-IL-23p19 antibody is administered at about four week intervals. In some embodiments, the anti-IL-23p19 antibody is administered at about two week intervals.
[0029] In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg subcutaneously. In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 200 mg to about 600 mg subcutaneously. In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg subcutaneously. In some embodiments, the anti-IL-23p19 antibody is administered at a dose of about 200 mg subcutaneously. In some embodiments, the anti-IL-23p19 antibody is administered at about four week intervals. In some embodiments, the anti-IL-23p19 antibody is administered at about two week intervals.
[0030] In some embodiments, one, two or three induction doses are administered to the patient. In some embodiments, one induction dose is administered to the patient. In some embodiments, two induction doses are administered to the patient. In some embodiments, three induction doses are administered to the patient.
[0031] In some embodiments, at least one, two, three, four, five, six, seven, eight, nine or ten maintenance doses are administered to the patient. In some embodiments, at least two maintenance doses are administered to the patient. In some embodiments, at least three maintenance doses are administered to the patient. In some embodiments, at least four maintenance doses are administered to the patient. In some embodiments, at least five maintenance doses are administered to the patient.
[0032] The present invention also provides a method of treating ulcerative colitis comprising administering three induction doses of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 100 mg to about 1000 mg of the antibody at about two week intervals, wherein, if the patient has not achieved a therapeutic effect four weeks after the last induction dose is administered, at least one maintenance dose of the anti-IL-23p19 antibody is administered to the patient.
[0033] The present invention also provides a method of treating ulcerative colitis comprising administering three induction doses of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg ofwherein, if the patient has not achieved a therapeutic effect four weeks after the last induction dose is administered, at least one maintenance dose of the anti-IL-23p19 antibody is administered to the patient.
[0034] As used herein, the term “rescue dose” refers to a dose of an anti-IL-23p19 antibody and / or a dose of an antibody that binds human ELR+ CXC chemokines administered to a patient that has developed a loss of response in order to re-induce / re- achieve the therapeutic effect(s) achieved at the end of an induction period.
[0035] As used herein, the term “rescue period” refers to a period of treatment of a patient comprising administration of an anti-IL-23p19 antibody and / or an antibody that binds human ELR+ CXC chemokines to the patient in order to re-induce the therapeutic effect achieved at the end of an induction period. The “rescue period” may be 4, 8 or 12 weeks in duration.
[0036] In some embodiments, the patient develops a loss of response during the maintenance period, one, two or three rescue dose(s) of the anti-IL-23p19 antibody and / or the antibody that binds human ELR+ CXC chemokines are administered to the patient, wherein one or more further maintenance dose(s) of the anti-IL-23p19 antibody and / or the antibody that binds human ELR+ CXC chemokines are administered to the patient if the patient achieves therapeutic effect 4-12 weeks after the last rescue dose is administered.
[0037] In some embodiments, “loss of response” is defined as a loss of therapeutic effect. In some embodiments the “loss of response” can be: (a) a combined SF + RB score at each of 2 consecutive visits (≥ 7 days apart) is greater than the combined SF + RB score at the baseline (Week 0) visit, and (b) confirmed by ES of 2 or 3. Participants who do not consent to an additional colonoscopy will not receive the rescue therapy.
[0038] In some embodiments, two or three rescue doses are administered at about four week intervals. In some embodiments, three rescue doses are administered at about four week intervals. In some embodiments, the one, two or three rescue dose(s) comprise 50 mg, 100 mg, 200 mg, 250 mg, 300 mg or 600 mg of the anti-IL-23p19 antibody. In some embodiments, the one, two or three rescue dose(s) comprise 300 mg of the anti-IL-23p19 antibody. In some embodiments, the one, two or three rescue dose(s) are administered by intravenous infusion. In some embodiments, the anti-IL-23p19 antibody for the rescue doses is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab and any one1 and Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL-23p19 antibody for the rescue doses is mirikizumab. In some embodiments, the one, two or three rescue dose(s) comprise about 100 mg to about 1000 mg (e.g., about 100 mg to about 1000 mg, about 150 mg to about 900 mg, about 200 mg to about 800 mg, about 250 mg to about 700 mg, about 300 mg to about 600 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg) of an antibody that binds human ELR+ CXC chemokines. In some embodiments, the one, two or three rescue dose(s) comprise 600 mg of the antibody that binds human ELR+ CXC chemokines. In some embodiments, the antibody that binds human ELR+ CXC chemokines for the rescue doses is eltrekibart.
[0039] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered intravenously at a dose of about 100 mg to about 1000 mg (e.g., about 100 mg to about 1000 mg, about 150 mg to about 900 mg, about 200 mg to about 800 mg, about 250 mg to about 700 mg, about 300 mg to about 600 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg).
[0040] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered intravenously at a dose of about 100 mg to about 600 mg (e.g., about 100 mg to about 600 mg, about 200 mg to about 600 mg, about 300 mg to about 600 mg, about 400 mg to about 600 mg, about 500 mg to about 600 mg, about 100 mg to about 500 mg, about 200 mg to about 500 mg, about 300 mg to about 500 mg, about 400 mg to about 500 mg, about 100 mg to about 400 mg, about 200 mg to about 400 mg, about 300 mg to about 400 mg, about 100 mg to about 300 mg, about 200 mg to about 300 mg, about 100 mg to about 200 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg).that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 100 mg to about 600 mg (e.g., about 100 mg to about 600 mg, about 200 mg to about 600 mg, about 300 mg to about 600 mg, about 400 mg to about 600 mg, about 500 mg to about 600 mg, about 100 mg to about 500 mg, about 200 mg to about 500 mg, about 300 mg to about 500 mg, about 400 mg to about 500 mg, about 100 mg to about 400 mg, about 200 mg to about 400 mg, about 300 mg to about 400 mg, about 100 mg to about 300 mg, about 200 mg to about 300 mg, about 100 mg to about 200 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg) about once every two weeks intravenously.
[0042] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 600 mg to about 1000 mg (e.g., about 600 mg to about 1000 mg, about 650 mg to about 950 mg, about 700 mg to about 900 mg, about 750 mg to about 850 mg, about 600mg, about 650mg, about 700mg, about 750mg, about 800mg, about 850mg, about 900mg, about 950mg, about 100mg) about once every two weeks intravenously.
[0043] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 200 mg to about 600 mg (e.g., about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg) about once every two weeks intravenously.
[0044] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 300 mg to about 600 mg (e.g., about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg) about once every two weeks intravenously.
[0045] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 100 mg to about 150 mg about once every two weeks intravenously.that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 300 mg about once every two weeks intravenously.
[0047] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 600 mg about once every two weeks intravenously.
[0048] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered subcutaneously at a dose of about 150 mg to about 1500 mg (e.g., about 150 mg to about 1500 mg, about 200 mg to about 1400 mg, about 250 mg to about 1300 mg, about 300 mg to about 1200 mg, about 350 mg to about 1100 mg, about 400 mg to about 1000 mg, about 450 mg to about 900 mg, about 600 mg to about 900 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg, about 1050 mg, about 1100 mg, about 1150 mg, about 1200 mg, about 1250 mg, about 1300 mg, about 1350 mg, about 1400 mg, about 1450 mg, about 1500 mg).
[0049] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered subcutaneously at a dose of about 150 mg to about 900 mg (e.g., about 150 mg to about 900 mg, about 300 mg to about 900 mg, about 450 mg to about 900 mg, about 600 mg to about 900 mg, about 750 mg to about 900 mg, about 150 mg to about 750 mg, about 300 mg to about 750 mg, about 450 mg to about 750 mg, about 600 mg to about 750 mg, about 150 mg to about 600 mg, about 300 mg to about 600 mg, about 450 mg to about 600 mg, about 150 mg to about 450 mg, about 300 mg to about 450 mg, about 150 mg to about 300 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg).
[0050] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 150 mg to about 900 mg (e.g., about 150 mg to about 900450 mg to about 900 mg, about 600 mg to about 900 mg, about 750 mg to about 900 mg, about 150 mg to about 750 mg, about 300 mg to about 750 mg, about 450 mg to about 750 mg, about 600 mg to about 750 mg, about 150 mg to about 600 mg, about 300 mg to about 600 mg, about 450 mg to about 600 mg, about 150 mg to about 450 mg, about 300 mg to about 450 mg, about 150 mg to about 300 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg) about once every two weeks subcutaneously.
[0051] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 900 mg to about 1500 mg (e.g., about 900 mg to about 1500 mg, about 1000 mg to about 1400 mg, about 1100 mg to about 1300 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg) about once every two weeks subcutaneously.
[0052] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 300 mg to about 900 mg (e.g., about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg) about once every two weeks subcutaneously.
[0053] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 450 mg to about 900 mg (e.g., about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg) about once every two weeks subcutaneously.
[0054] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 300 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 450 mg about once every two weeks subcutaneously. In someELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 600 mg about once every two weeks subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 900 mg about once every two weeks subcutaneously.
[0055] In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 150 mg to about 600 mg (e.g., about 150 mg to about 600 mg, about 200 mg to about 500 mg, about 250 mg to about 450 mg, about 300 mg to about 450 mg, about 350 mg to about 450 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg) weekly subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 250 mg to about 450 mg weekly subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 250 mg weekly subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 300 mg weekly subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 350 mg weekly subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 400 mg weekly subcutaneously. In some embodiments, the antibody that binds human ELR+ CXC chemokines, e.g., eltrekibart, or a pharmaceutical composition comprising such an antibody, is administered at a dose of about 450 mg weekly subcutaneously.
[0056] In some embodiments, the anti-IL-23p19 antibody, e.g., mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900, or a pharmaceuticalis administered intravenously at a dose of about 100 mg to about 1200 mg (e.g., about 100 mg to about 1200 mg, about 150 mg to about 900 mg, about 200 mg to about 800 mg, about 250 mg to about 700 mg, about 300 mg to about 600 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg, about 1100mg or about 1200mg).
[0057] In some embodiments, the anti-IL-23p19 antibody, e.g., mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900, or a pharmaceutical composition comprising such an antibody, is administered subcutaneously at a dose of about 100 mg to about 1200 mg (e.g., about 100 mg to about 1200 mg, about 150 mg to about 900 mg, about 200 mg to about 800 mg, about 250 mg to about 700 mg, about 300 mg to about 600 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg, about 1100mg or about 1200mg). DETAILED DESCRIPTION OF THE INVENTION
[0058] As used herein, the term “human ELR+ CXC chemokines” refers to the seven known CXC chemokines that have an E-L-R motif and that bind to CXCR l and / or CXCR2 receptor. The human ELR+ CXC chemokines are human Gro-alpha (also known as CXCL1) (SEQ ID NO: 11), human Gro-beta (also known as CXCL2) (SEQ ID NO: 12), human Gro-gamma (also known as CXCL3) (SEQ ID NO: 13), human ENA-78 (also known as CXCL5) (SEQ ID NO: 14), human GCP-2 (also known as CXCL6) (SEQ ID NO: 15), human NAP-2 (also known as CXCL7) (SEQ ID NO: 16), and human IL-8 (also known as CXCL8) (SEQ ID NO: 17). Collectively, all seven human ELR+ CXC chemokines are called “human pan-ELR+ CXC chemokines” herein.
[0059] The term “antibody,” as used herein, refers to an immunoglobulin molecule that binds an antigen. Embodiments of an antibody include a monoclonal antibody, polyclonal antibody, human antibody, humanized antibody, chimeric antibody, or conjugated antibody. The antibodies can be of any class (e.g., IgG, IgE, IgM, IgD, IgA) and any subclass (e.g., IgG1, IgG2, IgG3, IgG4).G (IgG) type antibody comprised of four polypeptide chains: two heavy chains (HC) and two light chains (LC) that are cross-linked via inter-chain disulfide bonds. The amino-terminal portion of each of the four polypeptide chains includes a variable region of about 100-125 or more amino acids primarily responsible for antigen recognition. The carboxyl-terminal portion of each of the four polypeptide chains contains a constant region primarily responsible for effector function. Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region. Each light chain is comprised of a light chain variable region (VL) and a light chain constant region. The IgG isotype may be further divided into subclasses (e.g., IgG1, IgG2, IgG3, and IgG4).
[0061] The VH and VL regions can be further subdivided into regions of hyper- variability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). The CDRs are exposed on the surface of the protein and are important regions of the antibody for antigen binding specificity. Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Herein, the three CDRs of the heavy chain are referred to as “HCDR1, HCDR2, and HCDR3” and the three CDRs of the light chain are referred to as “LCDR1, LCDR2 and LCDR3”. The CDRs contain most of the residues that form specific interactions with the antigen. Assignment of amino acid residues to the CDRs may be done according to the well-known schemes, including those described in Kabat (Kabat et al., “Sequences of Proteins of Immunological Interest,” National Institutes of Health, Bethesda, Md. (1991)), Chothia (Chothia et al., “Canonical structures for the hypervariable regions of immunoglobulins”, Journal of Molecular Biology, 196, 901-917 (1987); Al-Lazikani et al., “Standard conformations for the canonical structures of immunoglobulins”, Journal of Molecular Biology, 273, 927-948 (1997)), North (North et al., “A New Clustering of Antibody CDR Loop Conformations”, Journal of Molecular Biology, 406, 228-256 (2011)), or IMGT (the international ImMunoGeneTics database available on at www.imgt.org; see Lefranc et al., Nucleic Acids Res.1999; 27:209-212). Assignment of amino acid residues to the CDRs may be done according to a combination of the schemes described above. The Chothia CDR definitions are identical to the Kabat CDR definitions with the exception of HCDRl and HCDR2. For the purposes of thethe Kabat and Chothia definitions are used to define CDRs. The assignment of amino acids in the HCVR and LCVR regions is in accordance with the Kabat numbering convention. It is further understood that the term “antibody” encompasses any cellular post-translational modifications to the antibody including, but not limited to, acylation and glycosylation.
[0062] Embodiments of the present disclosure also include antibody fragments or antigen-binding fragments that, as used herein, comprise at least a portion of an antibody retaining the ability to specifically interact with an antigen or an epitope of the antigen, such as Fab, Fab’, F(ab’)2, Fv fragments, scFv antibody fragments, scFab, disulfide- linked Fvs (sdFv), a Fd fragment.
[0063] As used herein, the term “septa-specific antibody” refers to an antibody that binds all seven human ELR+ CXC chemokines with high affinity (e.g., with binding affinity (KD) in the range of from about 5 x 10-11 M to about 1 x 10-9 M).
[0064] As used herein, a “patient” refers to a human having, or suspected of having, ulcerative colitis.
[0065] As used herein, “treatment” or “treating” refers to all processes wherein there may be a slowing, controlling, or stopping of the progression of the disorders disclosed herein, but does not necessarily indicate a total elimination of all disorder symptoms. Treatment includes administration of an antibody of the present invention for treatment of a disease or condition in a patient, particularly in a human.
[0066] UC is a form of colitis, an inflammatory disease of the intestine, usually the colon, which includes characteristic ulcers. Symptoms of active disease usually include diarrhea mixed with blood, usually accompanied with varying degrees of abdominal pain, from mild discomfort to severely painful cramps. Bowel urgency is also a common and disruptive symptom of ulcerative colitis (UC) and is distinct from stool frequency (SF) and rectal bleeding (RB).
[0067] There are a number of methods for assessing the severity of disease / clinical metrics, including the UC disease severity index, the Modified UC disease severity index, Pediatric Ulcerative Colitis Disease Activity Index (PUCAI), UC disease severity index Endoscopic Subscore, Ulcerative Colitis Endoscopic Index of Severity (UCEIS) Total Score, Geboes Score, Robarts Histopathology Index (RHI) and combinations thereof.composite instrument comprised of the following 4 subscores: · Stool Frequency (SF): The SF subscore is a patient-reported measure. This item reports the number of stools in a 24-hour period, relative to the normal number of stools for that patient in the same period, on a 4-point scale. A stool is defined as a trip to the toilet when the patient has either a bowel movement, or passes blood alone, blood and mucus, or mucus only. For a younger child, this includes each diaper change where stool is present. The total number of stools passed in a 24- hour period is recorded by the patient. The reference “normal” SF for that patient is typically recorded at the outset of a study or period of observation. Normal SF for that patient is based on the reported SF when the patient was in remission or, if the patient has never achieved remission, the reported SF before initial onset of signs and symptoms of UC. Stool Frequency Subscore Score Normal number of stools per day for subject 0 1 to 2 stools per day more than normal 1 3 to 4 stools per day more than normal 2 5 or more stools per day more than normal 3 · Rectal Bleeding: The RB subscore is a patient-reported measure. This item reports the most severe amount of blood passed per rectum for a given day, on a 4-point scale. Rectal Bleeding Subscore Score No blood seen 0 Streaks of blood with stool less than half of the time 1 Obvious blood (more than just streaks) or streaks of blood with stool most of the time 2 Blood alone passed 3 · Endoscopic Subscore (ES): The ES is a physician-reported measure that reports the worst appearance of the mucosa on flexible sigmoidoscopy or colonoscopy, onclinical practice, friability is excluded from the definition of an ES of 1. Endoscopic Subscore Score Normal or inactive disease 0 Mild disease (erythema, decreased vascular pattern) 1 Moderate disease (marked erythema, absent vascular pattern, friability, erosions) 2 Severe disease (spontaneous bleeding, ulceration) 3 · Physician’s Global Assessment (PGA): The PGA is a physician-reported measure that summarizes the assessment of the patient’s UC disease activity on a 4-point scale. Physician’s Global Assessment Score Normal 0 Mild disease 1 Moderate disease 2 Severe disease 3 Each subscore is scored on a 4-point scale, ranging from 0 to 3, to give a maximum UC disease severity index score of 12.
[0069] The Modified UC disease severity index is a modification made to the original UC disease severity index (Schroeder et al., New Eng J Med, 317(26):1625-1629, 1987) and includes 3 of the 4 subscores of the UC disease severity index. It does not include the Physician’s Global Assessment. The Modified UC disease severity index evaluates three subscores, each on a scale of 0 to 3 with a maximum total score of 9. Patients who have a UC disease severity index of 6-12 or a Modified UC disease severity index of 4-9, each with an ES of ≥ 2, are defined as having moderate to severely active ulcerative colitis.
[0070] The UC disease severity index ranges from 0 to 12, with higher scores indicating more severe disease. The partial UC disease severity index excludes endoscopy and ranges from 0 to 9, while the modified UC disease severity index excludes the Physician’s Global Assessment and also ranges from 0 to 9. The original description ofin the definition of an endoscopic subscore of 1.
[0071] Using the Modified UC disease severity index, as used herein, “clinical remission” is defined as a RB subscore of 0, SF subscore of 0 or 1 and ES of 0 or 1 (excluding friability).
[0072] Using the Modified UC disease severity index, as used herein, “clinical response” is defined as achieving a decrease in the Modified UC disease severity index score of ≥2 points and ≥ 30% from baseline, and either a decrease in the RB subscore of ≥1 or an RB subscore of 0 or 1.
[0073] Using the Modified UC disease severity index, as used herein, “endoscopic remission” is defined as achieving a UC disease severity index ES of 0.
[0074] Using the Modified UC disease severity index, as used herein, “endoscopic improvement” is defined as having achieved a UC disease severity index ES of 0 or 1 (excluding friability).
[0075] “Histologic-endoscopic mucosal improvement (HEMI)” is defined as achieving both endoscopic improvement (centrally read endoscopy subscore of 0 or 1, excluding friability) and histologic improvement (neutrophil infiltration in <5% of crypts, no crypt destruction, and no erosions, ulcerations, or granulation tissue based on the Geboes scoring system).
[0076] “Histologic endoscopic mucosal remission (HEMR)” is defined as achieving both endoscopic remission and histologic remission (defined as Geboes histologic subscores of 0 for the neutrophils in lamina propria, neutrophils in epithelium, and erosion or ulceration parameters or defined as RHI score of ≤2).
[0077] Using the Modified UC disease severity index, as used herein “symptomatic remission” is defined as having achieved a SF subscore = 0 or SF subscore = 1 with a ≥1- point decrease from baseline, and a RB subscore = 0.
[0078] As used herein, “symptomatic response” is defined as ≥30% decrease from baseline in composite clinical endpoint of the sum of SF and RB subscores.
[0079] Using the Modified UC disease severity index, as used herein, “loss of response” is defined as: combined stool frequency (SF) + rectal bleeding (RB) score at each of 2 consecutive visits (≥7 days apart) is greater than the combined SF + RB score at the baseline (Week 0) visit and confirmed by endoscopic subscore of 2 or 3.used herein is defined as clinical remission at Week 52 without surgery, and no corticosteroid use for ≥ 12 weeks prior to week 52.
[0081] The Ulcerative Colitis Endoscopic Index of Severity (UCEIS) is a central-reader– reported instrument for measuring the endoscopic disease activity of UC on colonoscopy or flexible sigmoidoscopy, that includes 3 descriptors (scored on the most severe lesions): vascular pattern, bleeding, and erosions and ulcerations. The central reader will determine the UCEIS for each endoscopy in a blinded manner, as detailed in the Endoscopy Image Review charter.
[0082] Bowel urgency is measured by a Uniform Numeric Rating Score (UNRS) to assess mean change of bowel urgency severity. Bowel urgency, a sudden or immediate need to have a bowel movement, is a common and burdensome symptom for patients with ulcerative colitis. UNRS is a patient-reported measure of bowel urgency in the past 24 hours using an 11-point scale, from 0 (no urgency) to 10 (worst possible urgency). UNRS score is recorded daily by patients. Change in UNRS from baseline is measured, through week 12, week 28, week 52, or up to about 104 weeks of treatment. Clinically meaningful “improvement in bowel urgency” or clinically meaningful change in bowel urgency severity is defined as the proportion of patients achieving both clinical response, based on the Modified UC disease severity index and a UNRS score of ≥ 3 points of improvement from baseline. “Bowel urgency remission” is defined as minimal to no bowel urgency: UNRS [0,1]. as assessed at Week 12, week 28, and timepoints thereafter (maintenance) in patients with baseline UNRS ≥3.
[0083] Other measure of improvement include, abdominal pain NRS, Fatigue NRS, Nocturnal stools, Patient’s Global Impression of Change (PGI-C), Patient’s Global Rating of Severity (PGR-S). Such measures are evaluated by the participant and / or caregiver- reported outcomes.
[0084] The Geboes Score as used herein, is comprised of seven categories (or grades), each of which describes a histologic item, including “structural (architectural change)” (grade 0), “chronic inflammatory infiltrate” (grade 1), “lamina propria eosinophils” (grade 2A), “lamina propria neutrophils” (grade 2B), “neutrophils in epithelium” (grade 3), “crypt destruction” (grade 4) and “surface epithelial injury / erosion and ulcerations” (grade 5). Each grade includes subscores that indicate the degree of abnormality seen for that histologic characteristic, with subscores of 0 indicating normal appearance and higherappearance. The RHI uses the weighted results from 4 Geboes score categories (“chronic inflammatory infiltrate”, “lamina propria neutrophils”, “neutrophils in epithelium” and “surface epithelial injury / erosion and ulcerations”) to derive a continuous score, ranging from 0 (no disease activity) to 33 (severe disease activity). The RHI was developed as a responsive instrument to detect treatment effects in early drug development.
[0085] As such as used herein, a “therapeutic effect” or response to treatment can include any one or more of, clinical response, clinical remission, endoscopic remission, histologic-endoscopic mucosal remission, symptomatic remission, symptomatic response, histologic-endoscopic mucosal improvement, corticosteroid free remission, bowel urgency remission, improvement in bowel urgency, improvement in stool frequency, decrease in nocturnal stools, improvement in fatigue, improvement in abdominal pain, improvement in rectal bleeding, improvement in endoscopic response and / or improvement in other symptoms associated with ulcerative colitis.
[0086] “Sustained response” as used herein, is the percentage of patients who achieve a therapeutic effect during the maintenance period, among those patients that achieved a therapeutic effect in the induction period. For example, a sustained response as used herein, can be the percentage of patients who achieve clinical remission at week 52, among those patients who achieved clinical remission at week 12.
[0087] The term “inadequate response” as used herein refers to inability to achieve good disease control of ulcerative colitis after use of the treatment for the duration recommended by the product prescribing information, which occurs while on the treatment.
[0088] The term “intolerance” as used herein refers to unacceptable toxicity and / or improvement in other symptoms associated with ulcerative colitis.
[0089] As used herein, the term “biologic-naïve” used interchangeably with “advanced therapy-naïve”, refers to patients that have not been administered a biologic or an advanced therapy, for example, an anti-TNFα antibody (e.g., adalimumab, golimumab, infliximab), anti-integrin antibody (e.g., vedolizumab), JAK inhibitor (e.g., tofacitinib, upadacitinib), TYK2 inhibitor, S1P receptor modulator (e.g., ozanimod), an anti-IL- 12 / IL-23 antibody (e.g. ustekinumab) for the treatment of UC, in particular, for the treatment of moderate to severe UC. Biologic-naïve or advanced therapy naïve patients,response to, loss of response to, or are intolerant to at least one of a corticosteroid or an immunomodulator. Intolerance to an immunomodulator includes but not limited to nausea / vomiting, abdominal pain, pancreatitis, liver function test abnormalities, and lymphopenia.
[0090] As used herein, the term “biologic experienced” used interchangeably with “advanced therapy experienced” refers to patients that have been administered at least one prior biologic or advanced therapy for the treatment of UC, which is not an anti-IL23p19 antibody or an antibody that binds human ELR+ CXC chemokines, for example, an anti- TNFα antibody (e.g., adalimumab, golimumab, infliximab), anti-integrin antibody (e.g., vedolizumab), JAK inhibitor (e.g., tofacitinib, upadacitinib), TYK2 inhibitor, S1P receptor modulator (e.g., ozanimod), in particular for the treatment of moderately to severely active UC. Such patients may or may not have been administered a conventional medicine for the treatment of UC.
[0091] As used herein, the term “biologic-failed” used interchangeably with “advanced therapy failed” refers to patients that have been administered at least one prior biologic or advanced therapy for the treatment of UC, which is not an anti-IL23p19 antibody or an antibody that binds human ELR+ CXC chemokines, for example, an anti-TNFα antibody (e.g., adalimumab, golimumab, infliximab), anti-integrin antibody (e.g., vedolizumab), JAK inhibitor (e.g., tofacitinib, upadacitinib), TYK2 inhibitor, S1P receptor modulator (e.g., ozanimod), in particular for the treatment of moderately to severely active UC. Such patients may or may not have been administered a conventional therapy for the treatment of UC. Such patients have an inadequate response to, loss of response to, or are intolerant to biologic or advanced therapy for UC, which is not an anti-IL23p19 antibody or an antibody that binds human ELR+ CXC chemokines. In the context of the terms biologic- failed or advanced therapy failed, inadequate response means signs and symptoms of persistently active disease despite induction treatment at the approved induction dosing that was indicated in the product label at the time of use. In the context of the term biologic-failed or advanced therapy failed, loss of response is defined as recurrence of signs and symptoms of active disease during maintenance dosing following prior clinical benefit (discontinuation despite clinical benefit does not qualify as having failed or being intolerant to UC biologic therapy). In the context of the term biologic-failed or advanced therapy failed, intolerance means a history of intolerance to for example, an anti-TNF-αTYK2 inhibitor, S1P receptor modulator, examples of which include, infliximab, adalimumab, golimumab, ustekinumab, vedolizumab, tofacitinib, upadacitinib, deucravacitinib, ozanimod, or other such approved therapies.
[0092] As used herein, the term “not biologic-failed” used interchangeably with “not advanced therapy failed” refers to patients that have been administered at least one prior biologic or advanced therapy for the treatment of UC, which is not an anti-IL23p19 antibody or an antibody that binds human ELR+ CXC chemokines, for example, an anti- TNFα antibody (e.g., adalimumab, golimumab, infliximab), anti-integrin antibody (e.g., vedolizumab), JAK inhibitor (e.g., tofacitinib, upadacitinib), TYK2 inhibitor, S1P receptor modulator (e.g., ozanimod), in particular for the treatment of moderately to severely active UC, who have discontinued treatment for any reason other than inadequate response to, loss of response to, or intolerance to the prior biologic or advanced therapy (e.g. a change in insurance coverage). Such patients may or may not have been administered a conventional medicine for the treatment of UC.
[0093] “Loss of response”, as used in the context of prior biologic or advance therapy, includes recurrence of signs and symptoms of active disease during prescribed maintenance dosing following prior clinical benefit. Intolerance includes a history of intolerance to the biologic or advanced therapy, which includes, but not limited to infusion-related event, demyelination, congestive heart failure, or any other drug-related AE that led to a reduction in dose or discontinuation of the medication) or stopped taking a biologic for any other reason.
[0094] As used herein, the term “conventional-failed” refers to patients who have not been treated with a biologic previously and have an inadequate response to, loss of response to, or are intolerant to at least one of the following medications: Corticosteroids · Corticosteroid-refractory colitis is defined as signs or symptoms of active UC despite taking oral prednisone, or equivalent oral corticosteroid, at doses of ≥30 mg / day for ≥2 weeks. · Corticosteroid-dependent colitis, defined as (a) an inability to taper or reduce corticosteroid dose below the equivalent of prednisone 10 mg / kg / day within 3without a return of signs or symptoms of active UC, or (b) a relapse within ≤ 3 months of completing a course of corticosteroids. · A history of intolerance of corticosteroids includes, but is not limited to, cataracts, Cushing’s syndrome, hyperglycemia, hypertension, osteopenia / osteoporosis, or neuropsychiatric side-effects, including insomnia. Immunomodulators: · signs and / or symptoms of persistently active disease despite ≥3 months treatment with one of the following: o oral AZA (≥1.5 mg / kg / day) or 6-MP (≥0.75 mg / kg / day) o oral AZA or 6-MP within a therapeutic range as judged by thioguanine metabolite testing, or o a combination of a thiopurine and allopurinol within a therapeutic range as judged by thioguanine metabolite testing · A history of intolerance to at least one immunomodulator includes but is not limited to nausea / vomiting, abdominal pain, pancreatitis, liver function test abnormalities, and lymphopenia Conventional-failed patients have neither failed nor demonstrated an intolerance to a biologic, (anti-TNF antibody or anti-integrin antibody) or JAK, S1P, or TYK2 inhibitor, that is indicated for the treatment of UC.
[0095] The term “about” as used herein, means in reasonable vicinity of the stated numerical value. In some embodiments, “about” means plus or minus 5% or plus or minus 10% of the stated numerical value. In some embodiments, the term “about” means rounding to the standard degree of accuracy for the last decimal place of a numerical value. For example, the rounding-off convention to the last decimal place for a measurement of 3.5 cm means the reasonable vicinity would be 3.45-3.54. As another example, the expression "about 200°C" is interpreted as having the same rounding-off as "200°C".
[0096] As used herein “anti-IL-23p19 antibody” refers to an antibody that binds to the p19 subunit of human IL-23 but does not bind to the p40 subunit of human IL-23. An anti-IL-23p19 antibody thus binds to human IL-23 but does not bind to human IL-12. Examples of anti-IL23p19 antibodies include mirikizumab, guselkumab, tildrakizumab,Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. In a particular embodiment of the invention, the anti- IL-23p19 antibody is mirikizumab.
[0097] Guselkumab, CAS Registry No.1350289-85-8, is a fully human IgG1 lambda monoclonal antibody that binds to the p19 subunit of human IL-23. The antibody and methods of making same are described in US Patent No.7,935,344.
[0098] Tildrakizumab, CAS Registry No.1326244-10-3, is a humanized, IgG1 kappa monoclonal antibody targeting the p19 subunit of human IL-23. The antibody and methods of making same are described in US Patent No.8,293,883. C
[0099] Risankizumab, CAS Registry No.1612838-76-2, is a humanized, IgG1 kappa monoclonal antibody targeting the p19 subunit of human IL-23. The antibody and methods of making same are described in US Patent No.8,778,346.
[0100] Brazikumab, CAS Registry No.1610353-18-8, is a humanized, IgG2-lambda monoclonal antibody targeting the p19 subunit of human IL-23. The antibody and methods of making same are described in US Patent No.8,722,033.
[0101] WO 2024 / 263900 describes multiple anti-IL23p19 antibodies suitable for use in the present invention. In particular, the antibodies described as Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 or Table 2 of WO 2024 / 263900 are suitable for use in the present invention. In some embodiments, the anti-IL23p19 antibody of the invention has the CDR sequences of one of antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 of WO 2024 / 263900. In some embodiments, the anti-IL23p19 antibody of the invention has the VH and / or VL sequences of one of antibodies 1, 2, 3, 4 or 5 disclosed in Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL23p19 antibody of the invention is antibody 1 as disclosed in Table 1 or Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL23p19 antibody of the invention is antibody 2 as disclosed in Table 1 or Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL23p19 antibody of the invention is antibody 3 as disclosed in Table 1 or Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL23p19 antibody of the invention is antibody 4 as disclosed in Table 1 or Table 2 of WO 2024 / 263900. In some embodiments, the anti-IL23p19 antibody of the invention is antibody 5 as disclosed in Table 1 or Table 2 of WO 2024 / 263900.
[0102] Mirikizumab, CAS Registry No.1884201-71-1, is a humanized, IgG4-kappa monoclonal antibody targeting the p19 subunit of human IL-23. The antibody andUS Patent No.9,023,358. Mirikizumab comprises the following heavy chain variable region (HCVR), light chain variable region (LCVR), heavy chain (HC), and light chain (LC) amino acid sequences: HCVR – SEQ ID NO: 18 LCVR – SEQ ID NO: 19 HC – SEQ ID NO: 20 LC – SEQ ID NO: 21
[0103] Mirikizumab is particularly suitable for use in many aspects of the present invention.
[0104] The anti-IL-23p19 antibody and / or the antibody that binds human ELR+ CXC chemokines or pharmaceutical compositions comprising the same, may be administered by parenteral routes (e.g., subcutaneous, intravenous, intraperitoneal, intramuscular, or transdermal).
[0105] The term "intravenous infusion" or “intravenously” refers to introduction of an agent into the vein of an animal or human patient over a period of time greater than approximately 15 minutes, generally between approximately 30 to 90 minutes.
[0106] The term "subcutaneous injection" or “subcutaneously” refers to introduction of an agent under the skin of an animal or human patient, preferable within a pocket between the skin and underlying tissue, by relatively slow, sustained delivery from a drug receptacle. Pinching or drawing the skin up and away from underlying tissue may create the pocket.
[0107] Pharmaceutical compositions comprising an anti-IL-23p19 antibody and / or an antibody that binds human ELR+ CXC chemokines for use in the methods of the present invention can be prepared by methods well known in the art (e.g., Remington: The Science and Practice a / Pharmacy, 19th edition (1995), (A. Gennaro et al., Mack Publishing Co.) and comprise an antibody as disclosed herein, and one or more pharmaceutically acceptable carriers, diluents, or excipients.
[0108] As used herein, “dose” or “dosing” refers to the administration of a substance (for example, an anti-IL-23p19 antibody or an antibody that binds human ELR+ CXC chemokines) to achieve a therapeutic objective (for example, the treatment of ulcerative colitis).refers to a period of treatment of a patient comprising administration of an antibody that binds human ELR+ CXC chemokines and / or an anti-IL-23p19 antibody to the patient in order to induce a therapeutic effect. There is no minimum or maximum duration of the “induction period” but it is typically 4, 8 or 12 weeks in duration. The end of induction period is typically an end-of-induction assessment occurring 4 or 8 weeks after the last induction dose has been administered.
[0110] As used herein, “induction dose” refers to a first dose of an antibody that binds human ELR+ CXC chemokines and / or a dose of an anti-IL-23p19 antibody administered to a patient in order to induce a therapeutic effect. The “induction dose” can be a single dose or, alternatively, a set of doses. The “induction dose” is administered during the induction period.
[0111] As used herein, “maintenance period” refers to refers to a period of treatment comprising administration of an antibody that binds human ELR+ CXC chemokines and / or an anti-IL-23p19 antibody to a patient in order to maintain a desired therapeutic effect. The “maintenance period” follows the induction period or extended induction period, and, therefore, is initiated once a desired therapeutic is achieved.
[0112] As used herein, “maintenance dose” refers to a subsequent dose of an antibody that binds human ELR+ CXC chemokines and / or a dose of an anti-IL-23p19 antibody administered to a patient to maintain or continue a desired therapeutic effect. A “maintenance dose” is administered subsequent to the induction dose. A “maintenance dose” can be a single dose or, alternatively, a set of doses.
[0113] The terms “bind” and “binds” as used herein are intended to mean, unless indicated otherwise, the ability of a protein or molecule to form a chemical bond or attractive interaction with another protein or molecule, which results in proximity of the two proteins or molecules as determined by common methods known in the art. EXAMPLES
[0114] Example 1 – Antibodies that bind to ELR+ CXC chemokines and antibodies that bind to human IL-23p19 may yield enhanced clinical efficacy in UC
[0115] Combination therapy with antibodies that bind to ELR+ CXC chemokines, such as eltrekibart, and antibodies that bind to human IL-23p19, such as mirikizumab may induce more rapid therapeutic effects, such as symptomatic, clinical and / or histologic improvement in more patients with UC compared to either agent alone due to antibodiesdirect effects on neutrophil chemotaxis to sites of inflammation.
[0116] IL-23 has multiple proinflammatory effects, including induction of Th17 cells. These cells express IL-17, IL-22, and other mediators that contribute to the pathogenesis of UC. IL-17, in particular, induces the expression of multiple CXCR1 / 2 ligands from epithelial cells and these ligands are neutrophil chemoattractants. Treatments targeting IL 23 alone may not completely block CXCR1 / 2 ligand expression and subsequent neutrophil migration. Antibodies that bind to ELR+ CXC chemokines and have a direct effect on CXCR1 / 2 ligands may result in more rapid blockade of neutrophil migration compared to therapeutics that regulate the expression of these ligands incompletely and indirectly.
[0117] As part of the invention, post hoc analyses of the mirikizumab Phase 3 UC Study I6T-MC-AMAN (LUCENT-1) show a correlation between histologic assessment from colon biopsies and clinical response, where greater histologic response is associated with greater clinical response (Table 1).
[0118] Table 1 - Number (%) of mITT-Treated LUCENT-1 Participants with Histologic Improvement (2B.0<Geboes ≤ 3.1), Histologic Remission (Geboes ≤ 2B.0), or no Histologic Improvement at Week 12 that Did or Did Not Achieve Clinical Response at Week 12 Histological DID Achieve Clinical Did NOT Achieve T l N
[0119] Importantly, the Geboes histologic scoring system (Geboes, K., Riddell, R., Öst, A., Jensfelt, B., Persson, T. and Löfberg, R., 2000. A reproducible grading scale for histological assessment of inflammation in ulcerative colitis. Gut, 47(3), pp.404-409) is based on neutrophil tissue presence:are not present in the lamina propria or epithelium - a score of ≤3.1 indicates neutrophils may be present in the lamina propria and in less than 5% of epithelial crypts.
[0120] Therefore, the LUCENT-1 data suggest an association between persistent tissue neutrophil presence and decreased clinical response. The combination therapy with antibodies that bind to ELR+ CXC chemokines, such as eltrekibart, and antibodies that bind to human IL-23p19, such as mirikizumab, may therefore yield enhanced clinical efficacy in UC.
[0121] Eltrekibart binds to all 7 human CXCR1 / 2 ligands via a common ELR+ epitope. This direct effect on CXCR1 / 2 ligands may result in more rapid blockade of neutrophil migration compared to therapeutics that regulate expression of these ligands incompletely and indirectly. The effect of eltrekibart on inhibition of neutrophil migration in vivo is supported by the following evidence: i) In a DSS mouse model of acute intestinal inflammation, eltrekibart decreased myeloperoxidase content in colon lysates and stool by approximately 50%, demonstrating a decrease in neutrophil infiltration compared with control- treated mice. These effects were observed though eltrekibart neutralizes only 3 out of the 5 mouse ligands to CXCR1 and CXCR2. ii) In the Phase 2 proof-of-concept Study I7P-MC-DSAD, eltrekibart demonstrated efficacy in patients with moderate-to-severe HS. HS is a chronic inflammatory skin disease characterized by neutrophil-rich lesions.
[0122] A combination treatment with antibodies that bind to ELR+ CXC chemokines, such as eltrekibart, and antibodies that bind to human IL-23p19, such as mirikizumab, may induce more rapid clinical and histologic improvement in more patients with UC than either agent alone, due to the critical role of neutrophils in UC and antibodies that bind to ELR+ CXC chemokines, such as eltrekibart’s direct role in limiting CXCR1 / 2 ligand-mediated neutrophil chemotaxis. In addition, simultaneously inhibiting both (i) CXCR1 / 2 ligand and (ii) IL-23 may yield greater therapeutic effects or response to treatment, such as greater or more rapid rates of symptomatic response / remission and / or clinical response / remission versus those achieved with either intervention alone.Ranging, Phase 2 Study of Eltrekibart Given Alone or in Combination with Mirikizumab for the Treatment of Adult Patients with Moderately to Severely Active Ulcerative Colitis
[0124] This study is an adaptive Phase 2, multicenter, randomized, double-blind, placebo- controlled, parallel-group, dose-ranging study to evaluate eltrekibart given alone or in combination with mirikizumab for the treatment of adult patients with moderately to severely active UC. Enrolled study participants will have either ● an inadequate response to, loss of response to, or be intolerant to corticosteroid or immunomodulator therapy for UC (termed “conventional-failed” in this protocol), or ● an inadequate response to, loss of response to, or are intolerant to biologic or biosimilar, JAK inhibitor, or S1P receptor modulator therapy for UC (termed “advanced therapy-failed” in this protocol).
[0125] Moderate to severe UC is defined as a Modified UC disease severity index of 6 to 12, with an endoscopic subscore of ≥ 2. Screening is required within 35 days prior to enrollment. In some embodiments, patients have moderately to severely active UC defined as a score of 5 to 9 on the sum of SF, RB, and ES from the UC disease severity index, with an ES ≥2, with colonoscopy performed within 14 days before baseline. For each participant, the total duration of the clinical trial will be about 69 weeks including screening.
[0126] Table 2 - Objectives, Endpoints, and Estimands Objectives Endpoints lProportion of participants who achieve the treatment with eltrekibart in combination following at Week 12: r r ) d= = scale; PK = pharmacokinetics; PROs = patient-reported outcomes; QoL = quality of life; SAE = serious adverse event; TEAE = treatment-emergent adverse event; UC =ulcerative colitis; UCEIS = Ulcerative Colitis Endoscopic Index of Severity.
[0127] This adaptive study has 2 stages. The Stage 1 treatment groups include eltrekibart, placebo, mirikizumab, and eltrekibart in combination with mirikizumab. Stage 2 consists of 3 options (A, B, C), only one of which will be implemented. Results from Stage 1 will determine, based on sponsor internal criteria, whether monotherapy and / or combination therapy will be evaluated further to enable future studies. This decision will determine the option selected for Stage 2.
[0128] Stage 1assigned to eltrekibart 600 mg Q2W, mirikizumab 300 mg Q4W, the combination of eltrekibart 600 mg Q2W and mirikizumab 300 mg Q4W, or placebo Q2W (2:1:2:2 ratio) for dosing through the end of the Induction Period as shown in Table 3.
[0130] Table 3 – Stage 1 Induction Treatment Arms Stage 1 Induction Treatment Approximate Number of Participants[ ] ase on er responer saus an nuc on reamen, par cpans wo complete the Induction Period treatments will be reassigned at Week 12 to receive one of the Maintenance Period treatments shown in Table 4.
[0132] Table 4 – Stage 1 Maintenance Treatment Arms Participants who received this Stage 1 and are will receive this Stage 1 0 0
[0133] Stage 21 complete Week 12 or discontinue early, results of an interim analysis will be used to determine whether the study continues with Stage 2.
[0135] Screening Period
[0136] The Screening Period begins with Visit 1, which occurs over a period of time starting up to 5 weeks before the participant’s planned randomization visit. A participant’s screening evaluations must be completed and reviewed to confirm the participant’s eligibility before randomization and dosing occur at Week 0 (Visit 2).
[0137] Induction Period
[0138] The placebo-controlled, 12-week Induction Period begins with the induction dose given at Week 0. Dosing, sample collection, and assessments continue Q2W, as shown in the SoA. The period ends with the sample collections and assessments performed for Week 12.
[0139] Based on the sample collections and assessments performed for Week 12, participants will be classified as either “Week 12 Responder” or “Week 12 Nonresponder” using the “clinical response” criteria.
[0140] Maintenance Period
[0141] The Maintenance Period begins with the dose administered for Week 12. The period ends with the sample collections and assessments performed for Week 52.
[0142] During this period, participants will receive a maintenance treatment based on · their Week 12 responder or nonresponder status determined by diary entries and colonoscopy, · the induction period treatment assignment, and · the maintenance treatments planned for use in the relevant stage.
[0143] Rescue Therapy
[0144] Stage 1 will not include rescue therapy
[0145] Stage 2
[0146] The Maintenance Period of Stage 2 will include rescue therapy for certain participants, as described in Table 5.
[0147] Table 5 – Rescue Therapy Treatment ArmsIf participants who had responded to study then… intervention during the Induction Period… - erthan the combined SF + RB score at the baseline (Week 0) visit, AND · confirmed by endoscopic subscore of 2 or 3. Participants who do not consent to an additional colonoscopy will not receive the rescue therapy
[0150] To assess UC disease activity for the primary endpoint and several secondary endpoints, this study uses scores from the UC disease activity score.
[0151] Complete and accurate daily recording of the SF and RB subscores by participants in their daily electronic diary is necessary for the success of the study. Adequate bowel preparation and a colonoscopy with adequate visualization of the mucosa will enable calculation of the ES.
[0152] Table 6 defines the primary endpoint and several secondary endpoints.
[0153] Table 6 – Primary and secondary clinical endpoints Endpoint Definition UC disease activity score of ≤2 with SF subscore = 0, or SF = 1, and RB subscore = 0, and ES = 0 or 1, excluding friabilityHistologic- Histologic improvement with resolution of mucosal neutrophils, AbbBlinded safety data from ongoing trail level safety review was generated once approximately 15 participants received treatment. It was calculated that at least 3 participants have likely been assigned to combination treatment (i.e. eltrekibart + mirikizumab) at the time that a total of 15 participants have received treatment. The Phase 2 Study is blinded, therefore the actual number of participants assigned to each study treatment remains unknown. A summary of blinded safety data for 15 participants from the completed trial level safety review of the Phase 2 Study has been provided. No serious adverse event or permanent discontinuation due to adverse events were reported. All 15 participants are receiving on- going treatment and continuing participation in the Phase 2 Study.Eltrekibart Heavy chain amino acid sequence: SEQ ID NO: 1 QVQLVQSGAEVKKPGASVKVSCKASGYEFTSYWIHWVRQAPGQGLEWMGNISP NSGSANYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDT AVYYCAREGPYSYYPSREYYGSDLWGQGTL VTVSSASTKGPSVFPLAPCSRSTSEST AALGCL VKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSN TKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS QEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSRLTVDKSRWQEGNVFSCSVMH EALHNHYTQKSLSLSLG Eltrekibart Heavy chain variable region: SEQ ID NO: 2 QVQLVQSGAEVKKPGASVKVSCKASGYEFTSYWIHWVRQAPGQGLEWMGNISP NSGSANYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDT AVYYCAREGPYSYYPS REYYGSDLWGQGTLVTVSS Eltrekibart Light chain amino acid sequence: SEQ ID NO: 3 EIVLTQSPA TLSLSPGERATLSCRASQSISNNLHWYQQKPGQAPRLLIYYTSRSVSGIPARFSGSGSGTDFTL TISSLEPEDFA VYYCGQNNEWPEVFGGGTKVEIKRTV AAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD SKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC Eltrekibart Light chain variable region: SEQ ID NO: 4 EIVLTQSPA TLSLSPGERATLSCRASQSISNNLHWYQQKPGQAPRLLIYYTSRSVSGIPARFSGSGSGTDFTL TISSLEPEDFA VYYCGQNNEWPEVFGGGTKVEIKEltrekibart LCDR1: SEQ ID NO: 5 RASQSISNNLH Eltrekibart LCDR2: SEQ ID NO: 6 YTSRSVS Eltrekibart LCDR3: SEQ ID NO: 7 GQNNEWPEV Eltrekibart HCDR1: SEQ ID NO: 8 GYEFTSYWIH Eltrekibart HCDR2: SEQ ID NO: 9 NISPNSGSANYNEKFKSEGPYSYYPSREYYGSDL Human Gro-alpha (CXCLl): SEQ ID NO: 11 ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPA SPIVKKIIEKMLNSDKSN Human Gro-beta (CXCL2): SEQ ID NO: 12 APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPA SPMVKKIIEKMLKNGKSN Human Gro-gamma (CXCL3): SEQ ID NO: 13 ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPA SPMVQKIIEKILNKGSTN Human ENA-78 (CXCLS): SEQ ID NO: 14 AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPE APFLKKVIQKILDGGNKEN Human GCP-2 (CXCL6): SEQ ID NO: 15 VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLD PEAPFLKKVIQKILDSGNKKN Human NAP-2 (CXCL7): SEQ ID NO: 16 AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIK KIVQKKLAGDESAD Human IL-8 (CXCL8): SEQ ID NO: 17 SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENW VQRVVEKFLKRAENS Mirikizumab heavy chain variable region (HCVR): SEQ ID NO: 18 QVQLVQSGAEVKKPGSSVKVSCKASGYKFTRYVMHWVRQAPGQGLEWMGYINPYND GTNYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNWDTGLWGQGTTVTVS S Mirikizumab light chain variable region (LCVR): SEQ ID NO: 19 DIQMTQSPSSLSASVGDRVTITCKASDHILKFLTWYQQKPGKAPKLLIYGATSLETGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCQMYWSTPFTFGGGTKVEIK Mirikizumab heavy chain (HC): SEQ ID NO: 20 QVQLVQSGAEVKKPGSSVKVSCKASGYKFTRYVMHWVRQAPGQGLEWMGYINPYND GTNYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNWDTGLWGQGTTVTVS SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSR WQEGNVFSCSVMHEALHNHYTQKSLSLSLG Mirikizumab light chain (LC): SEQ ID NO: 21 DIQMTQSPSSLSASVGDRVTITCKASDHILKFLTWYQQKPGKAPKLLIYGATSLETGVPSR FSGSGSGTDFTLTISSLQPEDFATYYCQMYWSTPFTFGGGTKVEIKRTVAAPSVFIFPPSDE QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KADYEKHKVYACEVTHQGLSSPVTKSFNRGECprovided below: 1. A method of treating ulcerative colitis comprising administering to a human patient an antibody that binds human ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody. 2. The method of embodiment 1, wherein the antibody that binds human ELR+ CXC chemokines binds two or more (2, 3, 4, 5, 6 or 7) of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin- 8. 3. The method of embodiment 1 or embodiment 2, wherein the antibody that binds human ELR+ CXC chemokines binds human pan-ELR+ CXC chemokines including all of: growth- regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8. 4. The method of any one of embodiments 1-3, wherein the antibody that binds human ELR+ CXC chemokines comprises light chain complementarity determining regions (“LCDR”) LCDR1, LCDR2, LCDR3, and heavy chain complementarity determining regions (“HCDR”) HCDR1, HCDR2, HCDR3, wherein LCDR1 comprises SEQ ID NO: 7, LCDR2 comprises SEQ ID NO: 8, LCDR3 comprises SEQ ID NO: 9, HCDR1 comprises SEQ ID NO: 10, HCDR2 comprises SEQ ID NO: 11, and HCDR3 comprises SEQ ID NO: 12. 5. The method of any one of embodiments 1-4, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4. 6. The method of any one of embodiments 1-5, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain having the amino acid sequence of SEQ ID NO: 1 and a light chain having the amino acid sequence of SEQ ID NO: 3. 7. The method of any one of embodiments 1-6, wherein the antibody that binds human ELR+ CXC chemokines is eltrekibart.7, wherein the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. 9. The method of any one of embodiments 1-7, wherein the anti-IL-23p19 antibody is mirikizumab. 10. The method of any one of embodiments 1-9, wherein the ulcerative colitis is moderate to severe ulcerative colitis. 11. The method of any one of embodiments 1-10, wherein the patient is biologic-naïve. 12. The method of any one of embodiments 1-10, wherein the patient is biologic-experienced. 13. The method of any one of embodiments 1-10, wherein the patient is not biologic-failed. 14. The method of any one of embodiments 1-10, wherein the patient is biologic-failed or is conventional-failed. 15. The method of any one of embodiments 1-14, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 1000 mg intravenously. 16. The method of any one of embodiments 1-14, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 1500 mg subcutaneously. 17. The method of any one of embodiments 1-16, wherein the antibody that binds human ELR+ CXC chemokines is administered once every two weeks. 18. The method of any one of embodiments 1-16, wherein the antibody that binds human ELR+ CXC chemokines is administered once every four weeks. 19. The method of any one of embodiments 1-15 or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 600 mg once every two weeks intravenously. 20. The method of any one of embodiments 1-15 or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg to about 600 mg once every two weeks intravenously.15 or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 150 mg once every two weeks intravenously. 22. The method of any one of embodiments 1-15 or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg once every two weeks intravenously. 23. The method of any one of embodiments 1-15 or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg once every two weeks intravenously. 24. The method of any one of embodiments 1-14, 16, or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 900 mg once every two weeks subcutaneously. 25. The method of any one of embodiments 1-14, 16, or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg to about 900 mg once every two weeks subcutaneously. 26. The method of any one of embodiments 1-14, 16, or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg once every two weeks subcutaneously. 27. The method of any one of embodiments 1-14, 16, or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg once every two weeks subcutaneously. 28. The method of any one of embodiments 1-14, 16, or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg once every two weeks subcutaneously. 29. The method of any one of embodiments 1-14, 16, or 17, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 900 mg once every two weeks subcutaneously.15 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 600 mg once every four weeks intravenously. 31. The method of any one of embodiments 1-15 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg to about 600 mg once every four weeks intravenously. 32. The method of any one of embodiments 1-15 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 150 mg once every four weeks intravenously. 33. The method of any one of embodiments 1-15 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg once every four weeks intravenously. 34. The method of any one of embodiments 1-15 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg once every four weeks intravenously. 35. The method of any one of embodiments 1-14, 16 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 900 mg once every four weeks subcutaneously. 36. The method of any one of embodiments 1-14, 16 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg to about 900 mg once every four weeks subcutaneously. 37. The method of any one of embodiments 1-14, 16 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 300 mg once every four weeks subcutaneously. 38. The method of any one of embodiments 1-14, 16 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 450 mg once every four weeks subcutaneously.14, 16 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 600 mg once every four weeks subcutaneously. 40. The method of any one of embodiments 1-14, 16 or 18, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 900 mg once every four weeks subcutaneously. 41. The method of any one of embodiments 1-40, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg intravenously. 42. The method of any one of embodiments 1-41, wherein the anti-IL-23p19 antibody is administered at a dose of about 200 mg to about 600 mg intravenously. 43. The method of any one of embodiments 1-41, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg intravenously. 44. The method of any one of embodiments 1-41, wherein the anti-IL-23p19 antibody is administered at a dose of about 300 mg intravenously. 45. The method of any one of embodiments 1-44, wherein the anti-IL-23p19 antibody is administered at about four week intervals. 46. The method of any one of embodiments 1-44, wherein the anti-IL-23p19 antibody is administered at about two week intervals. 47. The method of any one of embodiments 1-40, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg subcutaneously. 48. The method of any one of embodiments 1-40 or 47, wherein the anti-IL-23p19 antibody is administered at a dose of about 200 mg to about 600 mg subcutaneously. 49. The method of any one of embodiments 1-40 or 47, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg subcutaneously. 50. The method of any one of embodiments 1-40 or 47, wherein the anti-IL-23p19 antibody is administered at a dose of about 200 mg subcutaneously.40 or 47-50, wherein the anti-IL-23p19 antibody is administered at about four week intervals. 52. The method of any one of embodiments 1-40 or 47-51, wherein the anti-IL-23p19 antibody is administered at about two week intervals. 53. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody. 54. The method of embodiment 53, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 600 mg administered intravenously. 55. The method of embodiment 53, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg to about 600 mg administered intravenously. 56. The method of embodiment 53, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 150 mg administered intravenously. 57. The method of embodiment 53, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg administered intravenously. 58. The method of embodiment 53, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg administered intravenously. 59. The method of any one of embodiments 53-58, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines is administered at about four week intervals.58, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines is administered at about two week intervals. 61. The method of any one of embodiments 53-60, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg to about 1200 mg administered intravenously. 62. The method of any one of embodiments 53-61, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered intravenously. 63. The method of any one of embodiments 53-62, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered intravenously. 64. The method of any one of embodiments 53-63, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 300 mg administered intravenously. 65. The method of any one of embodiments 53-60, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered subcutaneously. 66. The method of any one of embodiments 53-60 or 65, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered subcutaneously. 67. The method of any one of embodiments 53-60 or 65-66, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg administered subcutaneously. 68. The method of any one of embodiments 53-67, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about four week intervals. 69. The method of any one of embodiments 53-67, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about two week intervals. 70. The method of any one of embodiments 53-64, wherein the maintenance doses of the anti-IL-23p19 antibody comprise three maintenance doses of about 200 mg to about 600 mgfurther maintenance dose(s) of about 200 mg to about 600 mg administered subcutaneously. 71. The method of any one of embodiments 53-64, wherein the maintenance doses of the anti-IL-23p19 antibody comprise three maintenance doses of about 300 mg administered intravenously followed by at least one further maintenance dose(s) of about 200 mg administered subcutaneously. 72. The method of embodiment 70 or embodiment 71, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about four week intervals. 73. The method of any one of embodiments 1-14 or 53-68, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals or comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 74. The method of any one of embodiments 1-14 or 53-68, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise three maintenance doses of about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals followed by further maintenance doses comprising about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 75. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the antibody; andof the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 76. The method of embodiment 75, wherein the at least one induction dose of the anti-IL- 23p19 antibody comprises a dose of about 50 mg to about 1200 mg administered intravenously. 77. The method of any one of embodiments 75-76, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered intravenously. 78. The method of any one of embodiments 75-77, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered intravenously. 79. The method of any one of embodiments 75-78, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 300 mg administered intravenously. 80. The method of embodiment 75, wherein the at least one induction dose of the anti-IL- 23p19 antibody comprises a dose of about 200 mg to about 600 mg administered subcutaneously. 81. The method of any one of embodiments 75 or 80, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered subcutaneously. 82. The method of any one of embodiments 75 or 80-81, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg administered subcutaneously. 83. The method of any one of embodiments 75-82, wherein the at least one induction dose of the anti-IL-23p19 antibody is administered at about four week intervals. 84. The method of any one of embodiments 75-82, wherein the at least one induction dose of the anti-IL-23p19 antibody is administered at about two week intervals. 85. The method of any one of embodiments 75-84, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 600 mg administered intravenously.85, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg to about 600 mg administered intravenously. 87. The method of any one of embodiments 75-85, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 150 mg administered intravenously. 88. The method of any one of embodiments 75-85, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg administered intravenously. 89. The method of any one of embodiments 75-85, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg administered intravenously. 90. The method of any one of embodiments 75-89, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines is administered at about four week intervals. 91. The method of any one of embodiments 75-89, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines is administered at about two week intervals. 92. The method of any one of embodiments 1-14 or 75-91, said method comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction doses comprise about 300 mg of the antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 600 mg of the antibody administered intravenously at about four week intervals. 93. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequentialanti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody. 94. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 95. The method of embodiment 93 or embodiment 94, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 600 mg administered intravenously. 96. The method of any one of embodiments 93-95, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg to about 600 mg administered intravenously. 97. The method of any one of embodiments 93-95, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 150 mg administered intravenously. 98. The method of any one of embodiments 93-95, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg administered intravenously.95, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg administered intravenously. 100. The method of any one of embodiments 93-99, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines is administered at about four week intervals. 101. The method of any one of embodiments 93-99, wherein the at least one induction dose of the antibody that binds human ELR+ CXC chemokines is administered at about two week intervals. 102. The method of any one of embodiments 93-101, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg to about 1200 mg administered intravenously. 103. The method of any one of embodiments 93-102, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered intravenously. 104. The method of any one of embodiments 93-102, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered intravenously. 105. The method of any one of embodiments 93-102, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 300 mg administered intravenously. 106. The method of any one of embodiments 93-101, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered subcutaneously. 107. The method of any one of embodiments 93-101 or 106, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered subcutaneously. 108. The method of any one of embodiments 93-101 or 106-107, wherein the at least one induction dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg administered subcutaneously.101 or 106-108, wherein the at least one induction dose of the anti-IL-23p19 antibody is administered at about four week intervals. 110. The method of any one of embodiments 93-101 or 106-108, wherein the at least one induction dose of the anti-IL-23p19 antibody is administered at about two week intervals. 111. The method of any one of embodiments 93 or 95-110, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg to about 1200 mg administered intravenously. 112. The method of any one of embodiments 93 or 95-111, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered intravenously. 113. The method of any one of embodiments 93 or 95-112, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered intravenously. 114. The method of any one of embodiments 93 or 95-110, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 300 mg administered intravenously. 115. The method of any one of embodiments 93 or 95-110, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered subcutaneously. 116. The method of any one of embodiments 93 or 95-110 or 115, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered subcutaneously. 117. The method of any one of embodiments 93 or 95-110 or 115-116, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg administered subcutaneously. 118. The method of any one of embodiments 93 or 95-117, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about four week intervals. 119. The method of any one of embodiments 93 or 95-117, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about two week intervals.14, 93 or 95-119, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 121. The method of any one of embodiments 94-110, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 600 mg administered intravenously. 122. The method of any one of embodiments 94-110 or 121, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg to about 600 mg administered intravenously. 123. The method of any one of embodiments 94-110 or 121, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 150 mg administered intravenously. 124. The method of any one of embodiments 94-110 or 121, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg administered intravenously. 125. The method of any one of embodiments 94-110 or 121, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg administered intravenously. 126. The method of any one of embodiments 94-125, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines is administered at about four week intervals.125, wherein the at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines is administered at about two week intervals. 128. The method of any one of embodiments 1-14, 94-110 or 121-127, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 600 mg of the antibody administered intravenously at about four week intervals. 129. The method of any one of embodiments 1-14, 94-110 or 121-127, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 300 mg of the antibody administered intravenously at about four week intervals. 130. The method of any one of embodiments 1-14, said method comprising:of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 300 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 131. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 300 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals or comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 132. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 300 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise three maintenance doses of about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals followed by further maintenance doses comprising about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 133. The method of any one of embodiments 1-14, said method comprising:of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 100 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals or comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 134. The method of any one of embodiments 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 100 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise three maintenance doses of about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals followed by further maintenance doses comprising about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 135. The method of any one of embodiments 53-134, wherein one, two or three induction doses are administered to the patient. 136. The method of any one of embodiments 53-134, wherein one induction dose is administered to the patient. 137. The method of any one of embodiments 53-134, wherein two induction doses are administered to the patient. 138. The method of any one of embodiments 53-134, wherein three induction doses are administered to the patient. 139. The method of any one of embodiments 53-138, wherein at least one, two, three, four, five, six, seven, eight, nine or ten maintenance doses are administered to the patient. 140. The method of any one of embodiments 53-138, wherein at least two maintenance doses are administered to the patient.141. The method of any one of embodiments 53-138, wherein at least three maintenance doses are administered to the patient. 142. The method of any one of embodiments 53-138, wherein at least four maintenance doses are administered to the patient. 143. The method of any one of embodiments 53-138, wherein at least five maintenance doses are administered to the patient. 144. The method of any one of embodiments 1-14, said method comprising administering three induction doses of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 100 mg to about 1000 mg of the antibody at about two week intervals, wherein, if the patient has not achieved clinical response four weeks after the last induction dose is administered, at least one maintenance dose of the anti-IL-23p19 antibody is administered to the patient. 145. The method of any one of embodiments 1-14 or 144, said method comprising administering three induction doses of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody at about two week intervals, wherein, if the patient has not achieved clinical response four weeks after the last induction dose is administered, at least one maintenance dose of the anti-IL-23p19 antibody is administered to the patient. 146. The method of embodiment 144 or embodiment 145, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg to about 1200 mg administered intravenously. 147. The method of any one of embodiments 144-146, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered intravenously. 148. The method of any one of embodiments 144-147, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered intravenously.148, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 300 mg administered intravenously. 150. The method of embodiment 144 or embodiment 145, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg to about 600 mg administered subcutaneously. 151. The method of any one of embodiments 144, 145 or 150, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg administered subcutaneously. 152. The method of any one of embodiments 144, 145 or 150-151, wherein the at least one maintenance dose of the anti-IL-23p19 antibody comprises a dose of about 200 mg administered subcutaneously. 153. The method of any one of embodiments 144-152, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about four week intervals. 154. The method of any one of embodiments 144-152, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about two week intervals. 155. The method of embodiment 144 or embodiment 145, wherein the maintenance doses of the anti-IL-23p19 antibody comprise three maintenance doses of about 200 mg to about 600 mg administered intravenously followed by at least one further maintenance dose(s) of about 200 mg to about 600 mg administered subcutaneously. 156. The method of embodiment 144 or embodiment 145, wherein the maintenance doses of the anti-IL-23p19 antibody comprise three maintenance doses of about 300 mg administered intravenously followed by at least one further maintenance dose(s) of about 200 mg administered subcutaneously. 157. An antibody that binds human ELR+ CXC chemokines for use in a method of treating ulcerative colitis wherein the method comprises simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody.of treating ulcerative colitis wherein the method comprises simultaneous combination, separate combination and / or sequential combination with an antibody that binds human ELR+ CXC chemokines. 159. The antibody for use of embodiment 157 or embodiment 158, wherein the antibody that binds human ELR+ CXC chemokines binds two or more (2, 3, 4, 5, 6 or 7) of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8. 160. The antibody for use of any one of embodiments 157-159, wherein the antibody that binds human ELR+ CXC chemokines binds human pan-ELR+ CXC chemokines including all of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8. 161. The antibody for use of any one of embodiments 157-160, wherein the antibody that binds human ELR+ CXC chemokines comprises light chain complementarity determining regions (“LCDR”) LCDR1, LCDR2, LCDR3, and heavy chain complementarity determining regions (“HCDR”) HCDR1, HCDR2, HCDR3, wherein LCDR1 comprises SEQ ID NO: 7, LCDR2 comprises SEQ ID NO: 8, LCDR3 comprises SEQ ID NO: 9, HCDR1 comprises SEQ ID NO: 10, HCDR2 comprises SEQ ID NO: 11, and HCDR3 comprises SEQ ID NO: 12. 162. The antibody for use of any one of embodiments 157-161, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4. 163. The antibody for use of any one of embodiments 157-162, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain having the amino acid sequence of SEQ ID NO: 1 and a light chain having the amino acid sequence of SEQ ID NO: 3. 164. The antibody for use of any one of embodiments 157-163, wherein the antibody that binds human ELR+ CXC chemokines is eltrekibart.157-164, wherein the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. 166. The antibody for use of any one of embodiments 157-165, wherein the anti-IL-23p19 antibody is mirikizumab. 167. The antibody for use of any one of embodiments 157-166, wherein the ulcerative colitis is moderate to severe ulcerative colitis. 168. The antibody for use of any one of embodiments 157-167, wherein the patient is biologic- naïve. 169. The antibody for use of any one of embodiments 157-167, wherein the patient is biologic- experienced. 170. The antibody for use of any one of embodiments 157-167, wherein the patient is biologic- failed or is conventional-failed. 171. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody. 172. The antibody for use of any one of embodiments 157-171, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 300at about four week intervals or comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 173. The antibody for use of any one of embodiments 157-171, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise three maintenance doses of about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals followed by further maintenance doses comprising about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 174. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 175. The antibody for use of any one of embodiments 157-170 or 174, wherein said method comprises: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction doses comprise about 300 mg of the antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenancedoses comprise about 600 mg of the antibody administered intravenously at about four week intervals. 176. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody. 177. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 178. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; andof the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 179. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 180. The antibody for use of any one of embodiments 157-170, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 600 mg of the antibody administered intravenously at about four week intervals. 181. The antibody for use of any one of embodiments 157-180, wherein one, two or three induction doses are administered to the patient.157-180, wherein one induction dose is administered to the patient. 183. The antibody for use of any one of embodiments 157-180, wherein two induction doses are administered to the patient. 184. The antibody for use of any one of embodiments 157-180, wherein three induction doses are administered to the patient. 185. The antibody for use of any one of embodiments 157-184, wherein at least one, two, three, four, five, six, seven, eight, nine or ten maintenance doses are administered to the patient. 186. The antibody for use of any one of embodiments 157-184, wherein at least two maintenance doses are administered to the patient. 187. The antibody for use of any one of embodiments 157-184, wherein at least three maintenance doses are administered to the patient. 188. The antibody for use of any one of embodiments 157-184, wherein at least four maintenance doses are administered to the patient. 189. The antibody for use of any one of embodiments 157-184, wherein at least five maintenance doses are administered to the patient. 190. Use of an antibody that binds human ELR+ CXC chemokines in the manufacture of a medicament for treating ulcerative colitis wherein the treatment comprises simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody. 191. Use of an anti-IL-23p19 antibody in the manufacture of a medicament for treating ulcerative colitis, wherein the treatment comprises simultaneous combination, separate combination and / or sequential combination with an antibody that binds human ELR+ CXC chemokines. 192. The use of embodiment 190 or embodiment 191, wherein the antibody that binds human ELR+ CXC chemokines binds two or more (2, 3, 4, 5, 6 or 7) of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8.wherein the antibody that binds human ELR+ CXC chemokines binds human pan-ELR+ CXC chemokines including all of: growth- regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8. 194. The use of any one of embodiments 190-193, wherein the antibody that binds human ELR+ CXC chemokines comprises light chain complementarity determining regions (“LCDR”) LCDR1, LCDR2, LCDR3, and heavy chain complementarity determining regions (“HCDR”) HCDR1, HCDR2, HCDR3, wherein LCDR1 comprises SEQ ID NO: 7, LCDR2 comprises SEQ ID NO: 8, LCDR3 comprises SEQ ID NO: 9, HCDR1 comprises SEQ ID NO: 10, HCDR2 comprises SEQ ID NO: 11, and HCDR3 comprises SEQ ID NO: 12 195. The use of any one of embodiments 190-194, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 4. 196. The use of any one of embodiments 190-195, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain having the amino acid sequence of SEQ ID NO: 1 and a light chain having the amino acid sequence of SEQ ID NO: 3. 197. The use of any one of embodiments 190-196, wherein the antibody that binds human ELR+ CXC chemokines is eltrekibart. 198. The use of any one of embodiments 190-197, wherein the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. 199. The use of any one of embodiments 190-198, wherein the anti-IL-23p19 antibody is mirikizumab. 200. The use of any one of embodiments 190-199, wherein the ulcerative colitis is moderate to severe ulcerative colitis. 201. The use of any one of embodiments 190-200, wherein the patient is biologic-naïve.wherein the patient is biologic-experienced. 203. The use of any one of embodiments 190-200, wherein the patient is biologic-failed or is conventional-failed. 204. The use of any one of claiErms 190-203, said use comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody. 205. The use of any one of embodiments 190-204, said use comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals or comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 206. The use of any one of embodiments 190-204, said use comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction doses comprise about 600 mg of the antibody administered intravenously at about two week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise three maintenance doses of about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals followed by further maintenance doses comprising about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals.said use comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 208. The use of any one of embodiments 190-203 or 207, wherein said method comprises: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction doses comprise about 300 mg of the antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 600 mg of the antibody administered intravenously at about four week intervals. 209. The use of any one of embodiments 190-203, said use comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody. 210. The use of any one of embodiments 190-203, said use comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein theCXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 211. The use of any one of embodiments 190-203, said use comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 212. The use of any one of embodiments 190-203, wherein said method comprises: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg of the antibody administered intravenously at about two week intervals and the induction dose of the anti-IL-23p19 antibody comprises about 300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 200 mg of the anti-IL-23p19 antibody administered subcutaneously at about four week intervals. 213. The use of any one of embodiments 190-203, said use comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 600 mg of the antibody administered intravenously at about two week intervals and the induction300 mg of the anti-IL-23p19 antibody administered intravenously at about four week intervals; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance doses comprise about 600 mg of the antibody administered intravenously at about four week intervals. 214. The use of any one of embodiments 190-213, wherein one, two or three induction doses are administered to the patient. 215. The use of any one of embodiments 190-213, wherein one induction dose is administered to the patient. 216. The use of any one of embodiments 190-213, wherein two induction doses are administered to the patient. 217. The use of any one of embodiments 190-213, wherein three induction doses are administered to the patient. 218. The use of any one of embodiments 190-217, wherein at least one, two, three, four, five, six, seven, eight, nine or ten maintenance doses are administered to the patient. 219. The use of any one of embodiments 190-217, wherein at least two maintenance doses are administered to the patient. 220. The use of any one of embodiments 190-217, wherein at least three maintenance doses are administered to the patient. 221. The use of any one of embodiments 190-217, wherein at least four maintenance doses are administered to the patient. 222. The use of any one of embodiments 190-217, wherein at least five maintenance doses are administered to the patient. 223. The method of any one of embodiments 1-156, wherein, if the patient develops a loss of response during the maintenance period, one, two or three rescue dose(s) of the anti-IL-23p19 antibody are administered to the patient.one or more further maintenance dose(s) of the anti-IL-23p19 antibody are administered to the patient if the patient achieves clinical response 4- 12 weeks after the last rescue dose is administered. 225. The method of embodiment 223 or embodiment 224 wherein loss of response is defined as: (a) a combined SF + RB score at each of 2 consecutive visits (≥ 7 days apart) is greater than the combined SF + RB score at the baseline (Week 0) visit, and (b) confirmed by ES of 2 or 3. 226. The method of any one of embodiments 223-225, wherein two or three rescue doses are administered at about four week intervals. 227. The method of any one of embodiments 223-225, wherein three rescue doses are administered at about four week intervals. 228. The method of any one of embodiments 223-227, wherein the one, two or three rescue dose(s) comprise 50 mg, 100 mg, 200 mg, 250 mg, 300 mg or 600 mg of the anti-IL-23p19 antibody. 229. The method of any one of embodiments 223-228, wherein the one, two or three rescue dose(s) comprise 300 mg of the anti-IL-23p19 antibody. 230. The method of any one of embodiments 223-229, wherein the one, two or three rescue dose(s) are administered by intravenous infusion. 231. The method of any one of embodiments 223-230, wherein the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. 232. The method of any one of embodiments 223-231, wherein the anti-IL-23p19 antibody is mirikizumab. 233. The antibody for use of any one of embodiments 157-180 wherein, if the patient develops a loss of response during the maintenance period, one, two or three rescue dose(s) of the anti-IL- 23p19 antibody are administered to the patient. 234. The antibody for use of embodiment 233, wherein one or more further maintenance dose(s) of the anti-IL-23p19 antibody are administered to the patient if the patient achieves clinical response 4-12 weeks after the last rescue dose is administered.or embodiment 234, wherein loss of response is defined as: (a) a combined SF + RB score at each of 2 consecutive visits (≥ 7 days apart) is greater than the combined SF + RB score at the baseline (Week 0) visit, and (b) confirmed by ES of 2 or 3. 236. The antibody for use of any one of embodiments 233-235, wherein two or three rescue doses are administered at about four week intervals. 237. The antibody for use of any one of embodiments 233-235, wherein three rescue doses are administered at about four week intervals. 238. The antibody for use of any one of embodiments 233-237, wherein the one, two or three rescue dose(s) comprise 50 mg, 100 mg, 200 mg, 250 mg, 300 mg or 600 mg of the anti-IL- 23p19 antibody. 239. The antibody for use of any one of embodiments 233-238, wherein the one, two or three rescue dose(s) comprise 300 mg of the anti-IL-23p19 antibody. 240. The antibody for use of any one of embodiments 233-239, wherein the one, two or three rescue dose(s) are administered by intravenous infusion. 241. The antibody for use of any one of embodiments 233-240, wherein the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. 242. The antibody for use of any one of embodiments 233-241, wherein the anti-IL-23p19 antibody is mirikizumab.243. The use of any one of embodiments 190-213 wherein, if the patient develops a loss of response during the maintenance period, one, two or three rescue dose(s) of the anti-IL-23p19 antibody are administered to the patient. 244. The use of embodiment 243, wherein one or more further maintenance dose(s) of the anti- IL-23p19 antibody are administered to the patient if the patient achieves clinical response 4-12 weeks after the last rescue dose is administered. 245. The use of embodiment 243 or embodiment 244, wherein loss of response is defined as: (a) a combined SF + RB score at each of 2 consecutive visits (≥ 7 days apart) is greater than the combined SF + RB score at the baseline (Week 0) visit, and (b) confirmed by ES of 2 or 3.wherein two or three rescue doses are administered at about four week intervals. 247. The use of any one of embodiments 243-245, wherein three rescue doses are administered at about four week intervals. 248. The use of any one of embodiments 243-247, wherein the one, two or three rescue dose(s) comprise 50 mg, 100 mg, 200 mg, 250 mg, 300 mg or 600 mg of the anti-IL-23p19 antibody. 249. The use of any one of embodiments 243-248, wherein the one, two or three rescue dose(s) comprise 300 mg of the anti-IL-23p19 antibody. 250. The use of any one of embodiments 243-249, wherein the one, two or three rescue dose(s) are administered by intravenous infusion. 251. The use of any one of embodiments 243-250, wherein the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900. 252. The use of any one of embodiments 243-251, wherein the anti-IL-23p19 antibody is mirikizumab. 253. The method of any one of embodiments 1-8, 10-14 or 53-60, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 180 mg of the anti-IL-23p19 antibody, wherein the anti-IL-23p19 antibody is risankizumab. 254. The method of any one of embodiments 1-8, 10-14 or 53-60, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; andof the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 360 mg of the anti-IL-23p19 antibody, wherein the anti-IL-23p19 antibody is risankizumab. 255. The method of any one of embodiments 1-8, 10-14 or 75, said method comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 1200 mg of the antibody and wherein the anti-IL- 23p19 antibody is risankizumab; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 256. The method of any one of embodiments 1-8, 10-14 or 93, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 1200 mg of the anti-IL-23p19 antibody and wherein the anti-IL-23p19 antibody is risankizumab; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 180 mg of the anti-IL-23p19 antibody, wherein the anti-IL-23p19 antibody is risankizumab. 257. The method of any one of embodiments 1-8, 10-14 or 94, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 1200 mg of the anti-IL-23p19 antibody and wherein the anti-IL-23p19 antibody is risankizumab; andof the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 258. The method of any one of embodiments 253-257, wherein the at least one induction dose of the anti-IL-23p19 antibody is administered at about four week intervals. 259. The method of any one of embodiments 253-258, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at eight week intervals. 260. The method of any one of embodiments 253-259, wherein the anti-IL-23p19 antibody is administered intravenously. 261. The method of any one of embodiments 253-259, wherein the anti-IL-23p19 antibody is administered subcutaneously. 262. The method of any one of embodiments 1-8, 10-14 or 53-60, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 200 mg of the anti-IL-23p19 antibody, wherein the anti-IL-23p19 antibody is guselkumab. 263. The method of any one of embodiments 1-8, 10-14 or 75, said method comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 200 mg of the antibody and wherein the anti-IL- 23p19 antibody is guselkumab; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 264. The method of any one of embodiments 1-8, 10-14 or 93, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequentialanti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 200 mg of the anti-IL-23p19 antibody and wherein the anti-IL-23p19 antibody is guselkumab; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 200 mg of the anti-IL-23p19 antibody, wherein the anti-IL-23p19 antibody is guselkumab. 265. The method of any one of embodiments 1-8, 10-14 or 94, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 200 mg of the anti-IL-23p19 antibody and wherein the anti-IL-23p19 antibody is guselkumab; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody. 266. The method of any one of embodiments 262-265, wherein the at least one induction dose of the anti-IL-23p19 antibody is administered at about four week intervals. 267. The method of any one of embodiments 262-266, wherein the at least one maintenance dose of the anti-IL-23p19 antibody is administered at about four week intervals. 268. The method of any one of embodiments 262-267, wherein the anti-IL-23p19 antibody is administered intravenously. 269. The method of any one of embodiments 262-267, wherein the anti-IL-23p19 antibody is administered subcutaneously.
Claims
1. A method of treating ulcerative colitis comprising administering to a human patient an antibody that binds human ELR+ CXC chemokines in simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody.
2. The method of claim 1, wherein the antibody that binds human ELR+ CXC chemokines binds two or more (2, 3, 4, 5, 6 or 7) of: growth-regulated oncogene (“Gro”)-alpha, human Gro- beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8.
3. The method of claim 1 or claim 2, wherein the antibody that binds human ELR+ CXC chemokines binds human pan-ELR+ CXC chemokines including all of: growth-regulated oncogene (“Gro”)-alpha, human Gro-beta, human Gro-gamma, human epithelial neutrophil activating peptide-78, human granulocyte chemotactic protein-2, human neutrophil activating protein-2 and human interleukin-8.
4. The method of any one of claims 1-3, wherein the antibody that binds human ELR+ CXC chemokines comprises light chain complementarity determining regions (“LCDR”) LCDR1, LCDR2, LCDR3, and heavy chain complementarity determining regions (“HCDR”) HCDR1, HCDR2, HCDR3, wherein LCDR1 comprises SEQ ID NO: 7, LCDR2 comprises SEQ ID NO: 8, LCDR3 comprises SEQ ID NO: 9, HCDR1 comprises SEQ ID NO: 10, HCDR2 comprises SEQ ID NO: 11, and HCDR3 comprises SEQ ID NO:
12.
5. The method of any one of claims 1-4, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:
4.
6. The method of any one of claims 1-5, wherein the antibody that binds human ELR+ CXC chemokines comprises a heavy chain having the amino acid sequence of SEQ ID NO: 1 and a light chain having the amino acid sequence of SEQ ID NO:
3.
7. The method of any one of claims 1-6, wherein the antibody that binds human ELR+ CXC chemokines is eltrekibart.the anti-IL-23p19 antibody is mirikizumab, guselkumab, tildrakizumab, risankizumab, brazikumab or any one of Antibodies 1, 2, 3, 4 or 5 disclosed in Table 1 and Table 2 of WO 2024 / 263900.
9. The method of any one of claims 1-7, wherein the anti-IL-23p19 antibody is mirikizumab.
10. The method of any one of claims 1-9, wherein the ulcerative colitis is moderate to severe ulcerative colitis.
11. The method of any one of claims 1-10, wherein the patient is biologic-naïve.
12. The method of any one of claims 1-10, wherein the patient is biologic-experienced.
13. The method of any one of claims 1-10, wherein the patient is not biologic-failed.
14. The method of any one of claims 1-10, wherein the patient is biologic-failed or is conventional-failed.
15. The method of any one of claims 1-14, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 100 mg to about 1000 mg intravenously.
16. The method of any one of claims 1-14, wherein the antibody that binds human ELR+ CXC chemokines is administered at a dose of about 150 mg to about 1500 mg subcutaneously.
17. The method of any one of claims 1-16, wherein the antibody that binds human ELR+ CXC chemokines is administered once every two weeks.
18. The method of any one of claims 1-16, wherein the antibody that binds human ELR+ CXC chemokines is administered once every four weeks.
19. The method of any one of claims 1-18, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg intravenously.
20. The method of any one of claims 1-19, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg intravenously.
21. The method of any one of claims 1-20, wherein the anti-IL-23p19 antibody is administered at a dose of about 200 mg to about 600 mg intravenously.the anti-IL-23p19 antibody is administered at a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg intravenously.
23. The method of any one of claims 1-20, wherein the anti-IL-23p19 antibody is administered at a dose of about 300 mg intravenously.
24. The method of any one of claims 1-23, wherein the anti-IL-23p19 antibody is administered at about four week intervals.
25. The method of any one of claims 1-23, wherein the anti-IL-23p19 antibody is administered at about two week intervals.
26. The method of any one of claims 1-18, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg to about 1200 mg subcutaneously.
27. The method of any one of claims 1-18 or 26, wherein the anti-IL-23p19 antibody is administered at a dose of about 200 mg to about 600 mg subcutaneously.
28. The method of any one of claims 1-18 or 26, wherein the anti-IL-23p19 antibody is administered at a dose of about 50 mg, about 100 mg, about 200 mg, about 250 mg, about 300 mg or about 600 mg subcutaneously.
29. The method of any one of claims 1-18 or 26-27, wherein the anti-IL-23p19 antibody is administered at a dose of about 200 mg subcutaneously.
30. The method of any one of claims 1-18 or 26-29, wherein the anti-IL-23p19 antibody is administered at about four week intervals.
31. The method of any one of claims 1-18 or 26-29, wherein the anti-IL-23p19 antibody is administered at about two week intervals.
32. The method of any one of claims 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient, wherein the induction dose comprises about 100 mg to about 1000 mg of the antibody; andof the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody.
33. The method of any one of claims 1-14, said method comprising: a) administering at least one induction dose of the anti-IL-23p19 antibody to the patient, wherein the induction dose comprises about 50 mg to about 1200 mg of the antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody.
34. The method of any one of claims 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the anti-IL-23p19 antibody to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody.
35. The method of any one of claims 1-14, said method comprising: a) administering at least one induction dose of the antibody that binds human ELR+ CXC chemokines to the patient in simultaneous combination, separate combination and / or sequential combination with at least one induction dose of the anti-IL-23p19 antibody, wherein the induction dose of the antibody that binds human ELR+ CXC chemokines comprises about 100 mg to about 1000 mg of the antibody and the induction dose of the anti-IL-23p19 antibody comprises about 50 mg to about 1200 mg of the anti-IL-23p19 antibody; and b) administering at least one maintenance dose of the antibody that binds human ELR+ CXC chemokines to the patient after the last induction dose is administered, wherein the maintenance dose comprises about 100 mg to about 1000 mg of the antibody.of treating ulcerative colitis wherein the method comprises simultaneous combination, separate combination and / or sequential combination with an antibody that binds human ELR+ CXC chemokines.
37. An antibody that binds human ELR+ CXC chemokines for use in a method of treating ulcerative colitis wherein the method comprises simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody.
38. Use of an antibody that binds human ELR+ CXC chemokines in the manufacture of a medicament for treating ulcerative colitis wherein the treatment comprises simultaneous combination, separate combination and / or sequential combination with an anti-IL-23p19 antibody.
39. Use of an anti-IL-23p19 antibody in the manufacture of a medicament for treating ulcerative colitis, wherein the treatment comprises simultaneous combination, separate combination and / or sequential combination with an antibody that binds human ELR+ CXC chemokines.
Citation Information
Patent Citations
Pan-ELR+ CXC chemokine antibodies
EP2970447B1
Human anti-IL-23 antibodies, compositions, methods and uses
US7935344B2
Engineered anti-IL-23P19 antibodies
US8293883B2
Human IL-23 antigen binding proteins
US8722033B2
Anti-IL-23 antibodies
US8778346B2