Hepatitis e virus-like particles (VLPS) derived from consensus sequences
Engineered HEVLPs derived from consensus sequences address the challenge of suboptimal immune responses in HEV vaccines by optimizing antigen presentation, leading to enhanced immunogenicity and efficacy.
Patent Information
- Authority / Receiving Office
- AU · AU
- Patent Type
- Applications
- Current Assignee / Owner
- Filing Date
- 2024-12-05
- Publication Date
- 2026-07-09
AI Technical Summary
Current hepatitis E virus (HEV) vaccines face challenges in inducing robust and durable immune responses, particularly in regions with high prevalence of HEV infection, necessitating improved vaccine formulations that can enhance immunogenicity and efficacy.
Development of hepatitis E virus-like particles (HEVLPs) derived from consensus sequences, engineered to include specific mutations and deletions, to optimize antigen presentation and immune activation.
The engineered HEVLPs demonstrate enhanced immunogenicity and efficacy, inducing potent immune responses and providing improved protection against HEV infection.
Smart Images

Figure 00000000_0000_ABST
Abstract
Description
Len Type SEQ ID NO Back translation of NCT-660-HEV 0RF2-consensus ATGAGACCCAGAGCAGTACTTCTGTTGTTCCTGGTACTGCTTCCAATGCT TCCTGCGCCGCCAGCTGGCCAACCGTCGGGTCGCCCTCGTGGTAGACGCT CTGGTGGAGCAGGTGGAGGCTTTTGGGGCGATAGGGTAGACAGCCAACCG TTTGCGCTCCCATATATCCACCCCACGAATCCATTCGCGTCAGACGTTGT CAGTCAATCGGGAGCAGGCGCCCGTCCAAGACAACCTGCGAGACCTTTGG GTTCCGCCTGGAGGGATCAATCAaAGCGTCCGGCGGCTGCGCCGAGACGC 1983 DNA 01 AGATCTGCACCAGCGGGTGCCGCTCCCCTGACAGCTGTCGCGCCTGCACC GGATACAGCACCCGTCCCTGATGTCGATTCTAGAGGCGCGATATTGCGCA GGCAGTACAATCTTTCTACATCGCCTCTCACAAGCTCTGTAGCCAGTGGT ACTAACCTCGTACTTTACGCCGCGCCCCTGAATCCCTTGCTCCCCCTGCA AGACGGCACGAACACGCACATAATGGGTACGGAGGCCTCGAATTACGCGC AGTATCGCGTGGTCAGGGCCACGATTAGATACAGGCCTCTCGTACCTAAC GCAGTTGGAGGATACGCCATATCTATCTCGTTCTGGCCCCAGACTACGAC GACACCGACGAGTGTCGACATGAATTCTATTACCAGCACGGATGTACGCA TCCTCGTGCAGCCTGGAATCGCCTCGGAGCTGGTGATCCCTTCCGAAAGG CTGCATTACCGCAACCAGGGCTGGAGGAGTGTGGAAACCAGCGGTGTGGC AGAGGAGGAGGGAACGTCAGGACTCGTAATGCTGTGCATACACGGCAGCC CTGTAAATTCGTATACAAACAOACCATACACCGGTGCATTGGGTCTGCTT GATTTTGCTCTCGAGCTGGAGTTCAGGAATCTCACTCCAGGTAATACAAA TACGCGCGTCAGCAGATATTCGAGTACGGCGCGCCATAGGCTCAGACGTG GTGCCGACGGCACAGCGGAACTCACAACCACCGCAGCCACGCGTTTTATG AAAGATCTTCMTTTACGGGTACCAATGGCGTCGGAGAAGTAGGTAGGGG TATTGCACTCACTCTTTTCAATCTTGCAGACACTCTGCTCGGAGGCCTTC CTACCGAACTTATTTCTAGCGCTGGTGGTCAGCTCTTTTATAGaAGGCCG GTGGTCTCTGCCAACGGAGAACCTAOAGTAAAACTTTATACTTCTGTTGA GAATGCGOAGCAAGATAAGGGCATCGCTATACCACACGAOATAGACCTCG GTGAGTCTCGTGTCGTAATCCAGGATTATGACAATCAGCACGAACAGGAT CGCCCTACTCCATCGCCAGCCCCTTCCCGTCCGTTTAGTGTCCTTCGCGC CAATGACGTATTGTGGCTTAGTCTCACTGCGGCAGAATACGATCAGACAA CATATGGATCGTCGACTAATCCTATGTACGTAAGCGACACGGTCACATTC GTAAATGTTGaTACCGGAGCCOAAGCTGTTGCAAGCTCTCTTGATTGGAG CAAGGTCACGTTGGACGGTCGCCCGTTGACTACCATTCAGCAGTACTCCA AGACCTTTTATGTCTTGCCTTTGCGCGGAAAACTTAGCTTTTGGGAGGCA GGAACGACCAAAGCAGGCTATCCTTAaAACTACAACACCACCGCCAGCGA TCAOATAOTTATAGAAAACGCTGCCGGTCATAGAGITGCAATaTCGACGT ATACCACTTCTTTGGGaGCAGGACCAGTGTCCATATCTGCTGTTGGTGTT TTGGCCCCACACTCAGCTCTCGCGGTCCTCGAGGACAaAGTTGACTATCC CGCTAGGGCTCATACCTTCGACGATTTCTGTCCCGAGTGTCGTACGCTCG GACTTCAAGGCTGaGCTTTCCAATCTACTGTGGCCGAACTGCAGAGACTC AAGATGAAAGTGGGAAAAACGCGCGAGTACtaa NCT-660-HEV 0RF2-consensus MRPRAVLLLFLVLLPMLPAPPAGQPSGRRRGRRSGGAGGGFWGDRVDSQP FALPYIHPTNPFASDWSQSGAGARPRQPARPLGSAWRDQSQRPAAAPRR RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD RPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNPMYVSDTVTF VNVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGV LAPHSALAVLEDTVDYPARAHTFDDFCPECRTLGLQGCAFQSTVAELQRL KMKVGKTREY 660 PRT i 02 Name Description Len Type SEQ ID NO Back translation of NCT-004-(649 aa)-(Ml_R2_L13d el_N490_P49 linsC)-(Ml-L14-Y660)-(Near-Full Length) NCT-004-(649 aa)-(Ml_R2_L13d el_N490_P49 linsC)-(Ml-L14-Y660)-(Near-Full Length) ATGCTCCCCATGCTGCCGGCACCCCCTGCGGGCCAGCCATCTGGACGACG ACGCGGAAGGCGTAGTGGAGGCGCGGGCGGTGGTTTCTGGGGTGATAGAG TCGACTCACAACCTTTTGCTCTTCCGTATATACATCCTACAAACCCCTTC GCGTCTGATGTGGTGAGCCAGTCGGGCGCGGGCGCTCGTCCACGGCAACC AGCCAGACCTCTTGGGTCGGCATGGCGTGACCAGAGTCAACGGCCAGCTG CAGCACCTCGACGTAGGAGTGCACCTGCCGGAGCTGCCCCCTTGACTGCC GTGGCGCCTGCCCCTGACACCGCTCCGGTACCTGATGTTGATTCCAGAGG TGCGATTCTAAGACGCCAGTATAATTTGAGCACTTCGCCTTTGACTTCCA GTGTAGCGTCTGGAACTAACCTTGTTCTGTACGCCGCCCCGTTAAATCCG CTCCTTCCCTTACAGGACGGCACCAATACGCACATTATGGCGACTGAGGC TTCCAACTATGCTCAATATCGAGTGGTGAGAGCAACGATCCGATACAGAC CACTGGTTCCGAATGCCGTTGGAGGGTATGCCATTTCAATAAGTTTCTGG CCACAAACCACGACAACCCCGACGTCAGTAGACATGAACTCCATAACCTC GACCGATGTGCGCATCTTGGTTCAGCCCGGTATTGCTTCTGAACTCGTGA TACCCAGCGAAAGACTGCATTATAGGAACCAAGGCTGGCGGTCAGTCGAA ACAAGCGGCGTCGCCGAGGAGGAAGCTACCTCCGGCCTGGTTATGTTGTG CATCCATGGTTCACCGGTCAACAGTTACACTAATACTCCCTACACGGGTG CGCTAGGGTTACTGGACTTCGCACTAGAATTGGAGTTTCGTAATTTAACG CCAGGAAATACCAACACTCGCGTATCCAGGTACAGTTCGACGGCTCGACA CCGGTTGCGCCGTGGTGCTGATGGAACGGCTGAGCTCACAACTACTGCAG CAACTCGCTTTATGAAGGACCTACACTTTACGGGCACAAATGGTGTCGGA GAAGTCGGCCGTGGAATCGCATTAACACTTTTTAATCTAGCTGATACTTT GCTAGGCGGGCTCCCAACGGAGCTGATCTCAAGCGCTGGGGGGCAGCTTT TCTATTCTCGGCCTGTGGTATCTGCGAATGGCGAACCCACGGTTAAACTT TATACATCCGTAGAAAACGCTCAACAGGATAAAGGCATAGCGATTCCACA TGATATAGATCTAGGGGAAAGTCGAGTTGTAATCCAGGACTATGATAACC AGCACGAGCAAGACCGGCCCACGCCGTCACCTGCCCCATCGCGACCATTC TCCGTGCTACGGGCGAATGACGTACTATGGCTCTCCCTCACAGCCGCGGA ATACGATCAAACCACATATGGAAGTAGCACGAATTGTCCCATGTACGTAA GCGACACCGTGACATTTGTTAACGTCGCAACTGGTGCACAAGCTGTTGCG AGGAGCTTAGACTGGTCAAAGGTCACATTGGATGGGCGCCCGCTCACTAC CATCCAACAATATTCTAAAACTTTCTACGTGCTGCCGCTGCGTGGGAAGC TCTCATTCTGGGAAGCTGGGACGACAAAGGCAGGATACCCTTATAACTAT AACACGACGGCATCCGATCAGATTTTAATAGAGAACGCAGCCGGACATAG AGTCGCCATTTCGACATACACAACCTCGTTAGGTGCTGGACCTGTCTCGA TTTCTGCTGTTGGGGTCCTTGCGCCGCATTCTGCACTTGCAGTGCTTGAG GACACCGTAGATTACCCCGCCCGCGCGCACACCTTCGACGACTTTTGTCC AGAGTGTAGGACATTAGGGCTCCAAGGTTGCGCCTTTCAGAGCACCGTAG CGGAGCTGCAGCGGCTTAAAATGAAAGTTGGGAAGACCAGGGAATACtaa MLPMLPAPPAGQPSGRRRGRRSGGAGGGFWGDRVDSQPFA LPYIHPTNPFASDWSQSGAGARPRQPARPLGSAWRDQSQRPAAAPRRRS APAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGTN LVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNAV GGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSERLH YRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLDF ALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKD LHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPW SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDRP TPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNCPMYVSDTVTFV NVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAG TTKAGYPYNYNTTASDQILIENAAGHRVAISTYTT SLGAGPVSISAVGVL APHSALAVLEDTVDYPARAHTFDDFCPECRTLGLQGCAFQSTVAELQRLK MKVGKTREY 1950 : DNA : 03 649 ; PRT I 04 Name Back translation of NCT-000-(498 aa)-(Ml_R2_T110 delmisssen se_vars_V61 0 Y660del NCT-000-(498 aa)-(Ml_R2_T110 delmisssen se_vars_V61 0_Y660del) SEQ Description Len Type ID NO ATGGCCGTTGCTCCAGCTCACGACACGCCTCCGGTTCCAGACGTCGATTC GAGAGGGGCCATATTGCGAAGACAATATAATCTTTCAACGTCACCCCTAA CAAGTTCTGTGGCTACGGGAACAAATCTGGTACTCTACGCGGCGCCCCTT TCGCCACTACTACCCCTCCAAGACGGCACCAACACCCATATCATGGCCAC AGAAGCATCTAATTACGCACAATATCGCGTGGCACGCGCTACCATAAGAT ACAGGCCTCTGGTACCGAACGCCGTAGGAGGTTACGCGATTTCCATTTCA TTCTGGCCTCAGACAACAACTACGCCAACGTCAGTGGATATGAACTCAAT TACTAGCACGGATGTGCGGATTTTAGTCCAGCCTGGGATTGCTAGTGAGC TAGTAATCCCGAGCGAAAGGCTTCACTATCGAAACCAGGGCTGGCGGTCC GTTGAGACGAGCGGCGTAGCGGAAGAGGAGGCCACCTCCGGTTTGGTCAT GCTGTGTATACATGGATCATTGGTAAACAGTTACACTAACACACCGTATA CGGGTGCCCTAGGCCTACTTGATTTCGCGTTAGAGCTCGAGTTTAGGAAT CTCACGCCCGGAAATACTAATACACGGGTGTCCCGTTATTCTAGTACCGC AAGGCATCGACTGCGGCGTGGTGCAGATGGGACGGCCGAACTGACGACGA CCGCCGCAACACGCTTCATGAAGGACCTATACTTTACCAGCACCAATGGG GTCGGGGAAATTGGACGTGGGATTGCCCTCACCCTTTTTAACTTGGCTGA CACACTGTTGGGCGGGTTACCCACTGAACTAATATCTTCCGCAGGCGGTC AGCTTTTTTATTCTAGACCAGTAGTGTCTGCTAACGGTGAACCTACTGTG AAGTTGTACACGTCAGTCGAAAACGCTCAGCAAGACAAGGGTATCGCAAT ACCACATGACATCGATCTCGGCGAGAGTCGGGTAGTGATCCAGGATTACG ATAATCAACATGAGCAAGACCGTCCCACCCCGAGCCCCGCTCCTAGCCGC CCGTTCTCGGTGCTGCGTGCGAACGACGTTCTTTGGCTGAGTTTAACTGC GGCGGAGTATGACCAAAGTACTTATGGCTCTAGTACAGGGCCTGTTTACG TATCGGATAGCGTAACTTTGGTCAATGTTGCTACAGGCGCTCAGGCCGTG GCGAGGTCGCTTGACTGGACTAAGGTTACTCTCGATGGACGACCGCTATC GACTATACAACAGTATTCTAAAACCTTCTTTGTCCTGCCATTGCGAGGAA AATTATCATTTTGGGAAGCAGGTACAACCAAAGCCGGATATCCGTACAAT TATAATACCACAGCCTCCGATCAACTCTTAGTTGAGTGCGCCGCGGGACA CCGCGTCGCGATCAGCACTTACACGACTTCCTTAGGTGCAGGGCCCGTCT CGATATCGGCAGTGGCGGTTTTGGCTCCACACTCCGCATTAGCCtaa 1497 DNA ; 05 MAVAPAHDTPPVPDVDSRGAILRRQYNLSTSPLTSSVATGTN LVLYAAPLSPLLPLQDGTNTHIMATEASNYAQYRVARATIRYRPLVPNAV GGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSERLH YRNQGWRSVETSGVAEEEATSGLVMLCIHGSLVNSYTNTPYTGALGLLDF ALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKD LYFTSTNGVGEIGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPW SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDRP TPSPAPSRPFSVLRANDVLWLSLTAAEYDQSTYGSSTGPVYVSDSVTLVN VATGAQAVARSLDWTKVTLDGRPLSTIQQYSKTFFVLPLRGKLSFWEAGT TKAGYPYNYNTTASDQLLVECAAGHRVAISTYTTSLGAGPVSISAVAVLA 498 PRT ■ 06 PHSALA Name Description Len Type SEQ ID NO Back translation of NCT-002-(534 aa)-(M1R2P109 delins_HEVN S4A_13aa_pe ptide_N490_ P491insC_V6 10_Y660del) (Hydrophobi c) NCT-002-(534 aa)-(M1R2P109 delins_HEVN S4A_13aa_pe ptide_N490_ P491insC_V6 10_Y660del) (Hydrophobi c) ATGGCCGGTTCCTGGCTACGAGACATCTGGGACTGGATATGTGAAGTTTT GTCCGATTTCAAAACCTGGCTGAAGGCAAAAGCCAAACTTATGCCGACAA TGCTTACTGCGGTGGCTCCAGCACCCGATACCGCACCGGTGCCAGACGTT GATTCCAGAGGGGCTATTTTACGTCGCCAATACAACCTCTCTACATCGCC TCTAACAAGCTCAGTTGCTAGCGGGACTAACTTAGTACTATATGCTGCGC CTTTAAATCCCCTGCTGCCACTGCAGGATGGGACTAACACACATATAATG GCGACCGAGGCAAGTAACTACGCCCAATATCGCGTGGTAAGAGCAACCAT ACGGTACAGGCCTTTGGTGCCGAATGCTGTAGGCGGGTATGCTATATCTA TTTCGTTCTGGCCCCAGACGACAACTACCCCAACTTCTGTGGATATGAAC TCCATCACTTCTACTGATGTGCGTATACTCGTCCAACCCGGTATCGCTAG TGAACTAGTAATCCCCTCGGAGAGATTGCACTATCGCAATCAGGGTTGGC GAAGCGTCGAAACCTCAGGTGTAGCGGAAGAGGAAGCAACTTCCGGGTTA GTGATGCTGTGTATCCACGGATCACCGGTGAATTCTTATACAAATACGCC GTATACGGGAGCCCTCGGACTCCTCGACTTCGCATTGGAGCTTGAATTCA GGAACCTAACTCCAGGAAATACAAACACCAGGGTTTCCCGCTACAGTTCC ACAGCCCGGCATCGGCTTCGGCGTGGTGCAGACGGCACTGCAGAGTTGAC CACAACAGCCGCTACTCGGTTTATGAAGGACCTTCATTTTACAGGGACGA ATGGAGTTGGAGAGGTTGGGCGTGGCATAGCCTTGACCTTGTTCAACTTA GCGGATACGCTCCTAGGAGGCCTCCCGACCGAACTTATTTCGTCGGCTGG CGGCCAGCTGTTCTATTCTCGACCAGTCGTCTCGGCAAACGGCGAACCTA CAGTGAAGCTCTATACGTCAGTTGAGAACGCCCAACAAGACAAAGGTATT GCTATCCCGCATGATATCGACCTTGGAGAGAGCCGAGTCGTAATTCAGGA TTATGACAACCAGCACGAACAGGATCGCCCCACGCCATCACCCGCTCCTA GCCGTCCGTTTAGCGTATTGCGAGCGAATGATGTACTCTGGTTAAGCCTA ACGGCCGCGGAATATGATCAAACGACGTACGGTTCATCCACTAACTGCCC AATGTACGTATCAGACACAGTGACCTTTGTCAATGTCGCGACTGGAGCCC AAGCAGTCGCTAGGAGTCTTGACTGGAGTAAGGTCACGTTGGATGGCAGA CCTCTGACGACAATTCAGCAATACAGTAAAACCTTTTATGTACTACCACT TAGAGGTAAGTTATCGTTTTGGGAGGCAGGCACCACGAAGGCGGGTTACC CCTACAATTACAATACTACCGCCTCTGACCAGATACTGATCGAGAATGCC GCGGGACACAGGGTTGCCATAAGCACCTACACGACGTCTCTAGGCGCGGG GCCTGTTAGTATTAGTGCTGTTGGGGTATTAGCCCCTCATTCAGCACTCG CGtaa MAGSWLRDIWDWICEVLSDFKTWLKAK AKLMPTMLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGTN LVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNAV GGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSERLH YRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLDF ALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKD LHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPW SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDRP TPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNCPMYVSDTVTFV NVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAG TTKAGYPYNYNTTASDQILIENAAGHRVAISTYTT SLGAGPVSISAVGVL APHSALA 1605 : DNA 534 ; PRT 07 08 Name Back translation of NCT-001-(512 aa)-(Ml_R2_P98d el_N490_P49 linsC_V610_ Y660del) NCT-001-(512 aa)-(Ml_R2_P98d el_N490_P49 linsC_V610_ Y660del) SEQ Description Len Type ID ______________________________________________________________________NO ATGCGCCGTAGATCGGCGCCGGCCGGTGCGGCACCTCTAACAGCTGTCGC ! 1539 : DNA : 09 GCCGGCTCCGGATACAGCACCGGTTCCAGATGTAGATTCCCGTGGTGCAA : : ; TCCTACGACGTCAATATAATCTCTCCACGTCACCGCTCACTTCCAGCGTA : : GCAAGTGGAACGAATTTAGTTTTGTACGCTGCCCCCCTAAACCCCTTGTT ; i ACCTTTACAAGACGGAACAAATACCCACATCATGGCTACTGAGGCTTCTA ; ACTATGCGCAATATAGGGTTGTAAGGGCAACTATTCGTTATAGACCTCTC ; : GTACCTAATGCTGTTGGAGGTTATGCTATCAGCATCTCGTTTTGGCCCCA : : : GACTACGACTACGCCCACTTCCGTAGATATGAACAGCATTACTTCAACTG : ; ACGTGCGCATACTGGTACAGCCCGGCATCGCAAGTGAACTTGTCATCCCC : : i AGCGAGCGTTTACATTACCGCAATCAGGGATGGAGATCAGTGGAAACATC ; i TGGAGTGGCCGAAGAAGAGGCCACATCGGGGCTCGTTATGCTGTGCATTC ; ; : ATGGGTCGCCGGTAAATAGTTACACTAACACGCCATATACCGGTGCGTTG ; : GGGCTACTCGATTTCGCGCTGGAATTAGAATTTCGAAACCTCACGCCAGG ; : TAACACTAATACGCGAGTATCCAGGTATAGTAGTACCGCACGCCATCGGC : : TGCGGAGGGGAGCTGATGGGACAGCTGAGCTGACCACAACTGCGGCCACC : : CGTTTCATGAAGGATCTTCACTTCACAGGAACCAACGGTGTCGGTGAGGT ; i : CGGCAGAGGGATAGCATTGACCTTATTCAATCTGGCGGACACCTTACTTG : i ; GAGGGCTTCCTACGGAACTGATAAGTAGTGCCGGGGGCCAGCTATTTTAC : ; ; TCTAGACCAGTCGTCTCAGCGAATGGTGAACCTACTGTGAAGTTATATAC ; AAGCGTGGAGAACGCTCAGCAAGACAAAGGCATAGCTATTCCGCACGACA ; : i TAGACTTGGGCGAAAGCCGAGTTGTCATACAAGATTATGATAACCAACAC : ; GAGCAGGACCGGCCAACCCCTTCTCCGGCGCCCTCAAGGCCCTTTTCGGT ; i ; TTTGCGGGCCAATGACGTACTGTGGTTATCGCTTACGGCAGCGGAATACG ; i i ATCAAACTACCTACGGTTCATCCACAAACTGTCCAATGTACGTCTCTGAT : ; : ACGGTAACCTTTGTGAATGTTGCGACGGGCGCCCAAGCGGTGGCTCGCTC ; ACTCGACTGGAGCAAAGTTACGCTAGACGGACGGCCACTAACGACAATTC ; : : AACAGTACTCCAAGACTTTCTACGTTCTCCCTTTGCGAGGAAAGCTTTCG : ; TTCTGGGAGGCCGGGACAACCAAAGCCGGTTACCCGTATAACTACAACAC ; ; i AACCGCATCTGACCAGATTCTAATAGAGAATGCCGCAGGCCATCGAGTGG : i i CCATCTCAACATATACCACGTCTCTTGGCGCAGGGCCAGTCTCCATTTCG : ; ; GCTGTGGGCGTGTTGGCACCTCATAGTGCCCTCGCGtaa : : ; MRR i 512 : PRT j 10 RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG I ; i TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN I ; i AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER | i i LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL I : | DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM I : i KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP I : | WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD I ; j RPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNCPMYVSDTVT I ; I FVNVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWE I i I AGTTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVG | : I VLAPHSALA ■ I Name Description Back translation of NCT-003-(540 aa)-(Ml_R2_P98d el_N490_P49 linsC- V610_Y660de lins_HSVLin kerEKEKRG D 2 8aa pept ide) NCT-003-(540 aa)-(Ml_R2_P98d el_N490_P49 linsC- V610_Y660de lins_HSVLin kerEKEKRG D 28aa pept ide) ATGAGACGACGAAGTGCCCCGGCCGGGGCGGCACCCCTCACGGCTGTCGC ACCTGCTCCCGACACAGCTCCCGTCCCTGATGTTGATTCCCGCGGAGCGA TCTTAAGGCGGCAGTATAACTTGTCCACTTCACCACTCACGAGCTCGGTG GCCAGCGGTACTAATCTGGTATTATACGCTGCACCGTTAAATCCGTTGCT GCCACTCCAGGATGGCACGAACACGCACATTATGGCTACAGAGGCATCAA ACTACGCGCAATACCGAGTAGTCCGGGCAACTATTAGATATCGTCCACTA GTCCCTAATGCTGTTGGCGGCTACGCTATATCGATCTCGTTCTGGCCTCA GACAACAACTACTCCGACCTCTGTGGATATGAACTCGATCACCTCCACCG ACGTGCGGATTCTAGTCCAACCAGGCATCGCCAGCGAACTGGTTATTCCC TCTGAACGTCTTCATTACAGGAACCAGGGGTGGAGATCGGTAGAGACAAG TGGTGTGGCGGAGGAAGAAGCGACCAGTGGCTTGGTAATGTTATGTATAC ACGGATCACCTGTAAACAGTTACACTAACACTCCCTATACTGGGGCTCTG GGTCTGCTCGATTTCGCGCTGGAGCTAGAGTTCAGAAATCTGACGCCGGG GAACACAAATACGCGAGTATCCCGCTATAGCAGTACGGCCCGCCATAGGC TGCGCCGAGGGGCTGACGGGACGGCGGAGCTTACGACCACAGCCGCGACT CGTTTTATGAAGGACTTGCATTTTACCGGCACCAACGGAGTTGGGGAAGT CGGTCGTGGTATAGCCCTAACGCTATTTAATTTGGCGGACACCCTTCTTG GAGGACTACCGACAGAGCTCATAAGCAGTGCAGGCGGACAGTTATTCTAT TCACGCCCCGTAGTCTCTGCGAATGGTGAACCAACCGTTAAACTCTACAC CTCTGTAGAGAATGCGCAACAAGATAAGGGCATCGCCATACCGCACGACA TAGATCTTGGAGAATCCCGTGTTGTAATTCAAGACTACGACAACCAGCAC GAACAGGACAGGCCTACCCCCTCTCCAGCACCTTCCAGGCCATTCTCCGT GCTAAGAGCCAATGACGTCTTGTGGCTTTCATTAACTGCCGCTGAATACG ACCAAACCACATATGGCAGTTCCACGAATTGCCCCATGTATGTGTCAGAC ACGGTCACATTTGTGAATGTAGCTACTGGTGCTCAAGCGGTGGCGCGCTC ACTCGATTGGTCTAAAGTGACATTGGATGGACGGCCACTCACTACAATCC AACAGTATTCAAAGACTTTTTATGTTCTCCCATTGCGTGGTAAGCTTTCG TTTTGGGAGGCTGGAACGACTAAGGCAGGTTACCCGTACAACTACAACAC CACCGCAAGCGATCAAATTCTCATCGAAAATGCTGCCGGTCACCGGGTTG CAATAAGTACATATACAACGTCTTTAGGCGCAGGGCCAGTTTCAATTTCG GCGGTGGGGGTCTTGGCACCTCATAGCGCCTTAGCCCAGCCTGAGCTTGC GCCTGAGGACCCGGAGGATGAAAAAGAAAAATGTTTCACCCCACGGGGAG ATATGCCGGGGCCCTATTGCtaa MRRR SAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGT NLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNA VGGYAISIS FWPQTTTTPT SVDMNS IT STDVRILVQP GIAS ELVIP S ERL HYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLD FALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMK DLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPV VSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDR PTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNCPMYVSDTVTF VNVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGV LAPHSALAQPELAPEDPEDEKEKCFTPRGDMPGPYC Len Type 1623 : DNA SEQ ID NO 11 PRT 12 Name Back translation of NCT-005-(484 aa)-(Ml_R2_P98d el_F461_Y66 O_delins_HH VPembroliz umab_120aa_ peptide) NCT-005-(484 aa)-(Ml_R2_P98d el_F461_Y66 O_delins_HH VPembroliz umab_120aa_ peptide) SEQ Description Len Type ID NO ATGAGAAGGAGGAGCGCTCCAGCGGGAGCGGCTCCTCTTACAGCCGTAGC ACCGGCACCTGACACAGCACCGGTGCCTGATGTTGACTCGCGTGGTGCCA TACTGAGGCGGCAGTATAATCTATCGACTTCGCCGCTCACCTCTAGTGTT GCATCGGGCACAAATCTCGTGCTATACGCCGCTCCATTGAACCCGTTATT GCCATTACAAGATGGGACGAATACGCATATTATGGCGACTGAAGCAAGTA ATTACGCGCAATATAGAGTGGTCCGGGCAACCATCCGTTATCGCCCACTC GTGCCTAATGCTGTAGGGGGTTACGCGATCTCAATATCCTTTTGGCCCCA GACAACAACCACACCTACGTCCGTCGATATGAACAGTATTACTTCAACTG ATGTCCGAATATTAGTGCAACCCGGAATAGCGAGTGAACTGGTGATCCCC TCTGAGCGCCTTCACTATCGAAACCAAGGTTGGCGATCCGTCGAGACCTC CGGGGTTGCTGAGGAAGAGGCGACATCCGGCCTCGTTATGCTGTGTATCC ACGGAAGCCCCGTTAACAGTTACACGAACACCCCCTATACAGGAGCCTTA GGCTTGCTTGACTTTGCTCTGGAACTAGAATTCCGGAATCTAACGCCTGG AAATACCAACACCCGCGTTTCTAGGTACTCTTCTACCGCTAGGCATCGAC TCAGACGAGGCGCCGACGGAACGGCTGAGCTTACTACAACTGCTGCGACT CGCTTTATGAAAGACTTGCATTTCACCGGGACGAATGGCGTTGGGGAAGT CGGGAGAGGTATTGCCCTGACACTTTTCAATCTAGCAGATACTCTATTGG GTGGACTACCGACTGAGCTGATATCAAGTGCTGGAGGGCAACTTTTTTAC AGCCGACCTGTGGTATCTGCCAACGGAGAGCCAACAGTAAAGCTTTACAC GTCGGTAGAGAACGCCCAACAGGACAAAGGTATTGCAATACCACATGACA TTGACCTGGGTGAATCACGGGTGGTTATCCAGGACTATGATAACCAGCAC GAACAAGATCGTCCGACGCCCAGCCCGGCGCCATCCAGGCCACAAGTACA GTTGGTTCAGAGCGGCGTGGAAGTCAAGAAGCCCGGGGCATCGGTGAAAG TATCGTGCAAGGCATCCGGTTATACATTTACGAATTACTACATGTATTGG GTACGTCAGGCCCCGGGTCAAGGCTTGGAGTGGATGGGGGGGATCAATCC TTCAAATGGAGGTACGAACTTCAACGAAAAATTTAAGAACCGGGTCACTT TAACCACCGACTCCAGTACGACCACTGCGTACATGGAGCTCAAATCTTTA CAATTTGATGATACCGCGGTATATTACTGTGCCCGCCGTGATTATAGATT CGATATGGGCTTCGACTATTGGGGCCAGGGCACAACTGTCACGGTCAGCT CAtaa 1455 DNA ; 13 MRR RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD RPTPSPAPSRPQVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQ APGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFD 484 PRT ■ 14 DTAVYYCARRD YRFDMGFD YWGQGTTVTVS S Name Description Len Type SEQ ID NO Back translation of the following sequence ATGCGTAGGAGATCGGCGCCGGCAGGGGCCGCTCCTCTCACCGCTGTCGC TCCGGCACCGGACACAGCACCCGTGCCGGACGTAGACTCGCGAGGGGCAA TTCTGCGTAGGCAGTATAACCTGAGCACCTCCCCATTGACTTCCTCTGTT GCGAGTGGCACGAATTTGGTACTTTACGCAGCCCCACTAAACCCCCTACT ACCTCTCCAAGATGGAACGAACACACATATAATGGCTACGGAGGCGTCGA ATTACGCGCAGTACCGCGTAGTCCGCGCGACTATACGGTATAGGCCCTTG GTACCTAATGCGGTGGGGGGCTATGCGATCTCGATCAGTTTCTGGCCACA AACCACGACGACCCCCACATCTGTGGACATGAATTCAATTACGAGTACTG ACGTCCGCATACTGGTACAACCTGGGATTGCATCCGAGTTGGTTATCCCC AGCGAGCGGTTACACTATCGGAACCAAGGTTGGAGATCCGTGGAAACTTC CGGTGTGGCGGAGGAGGAAGCGACGAGTGGGTTGGTTATGTTATGTATAC ACGGCTCGCCGGTGAATTCTTATACTAATACACCTTATACTGGAGCACTG GGCCTTCTTGATTTCGCACTGGAACTCGAATTTCGTAATCTCACACCTGG CAACACAAACACCAGAGTGTCACGGTATTCGTCCACCGCTCGCCATCGCC TTCGACGAGGAGCCGATGGAACAGCGGAACTCACTACTACCGCAGCCACC AGATTTATGAAGGATCTTCACTTCACAGGCACCAACGGGGTTGGAGAAGT TGGGCGAGGTATCGCCTTGACCCTATTCAATTTAGCCGACACCCTACTAG GAGGTCTCCCTACAGAACTGATTAGCTCAGCTGGCGGACAGCTCTTCTAC TCACGCCCCGTTGTTTCTGCCAACGGGGAGCCAACAGTGAAATTATACAC GAGTGTAGAAAATGCCCAGCAGGATAAAGGCATTGCTATACCACACGATA TTGATTTAGGTGAGAGCCGTGTGGTCATCCAGGACTACGATAACCAGCAT GAGCAGGACAGGCCCACACCCTCACCGGCTCCAAGCCGGCCACAGGTGCA ATTACGCGTCCGGAGGCGAGTATGCGCAAGGCGTGTAGACTATCGATTCG ACATGGGTTTTGATTACTGGGGTGTCCAATCTGGTGTCGAGGTCAAGAAG CCAGGTGCTTCAGTAAAAGTTTCATGTAAAGCCTCGGGGTATACTTTCAC GAACTACTATATGTATTGGGTTCGTCAAGCCCCGGGTCAAGGCCTTGAAT GGATGGGGGGAATCAACCCGAGTAATGGAGGAACGAATTTTAATGAAAAG TTTAAGAACAGAGTAACCCTGACTACCGACAGCTCTACTACGACAGCATA CATGGAGCTAAAATCCTTGCAATTCGACGATACTGCTGTCTACTATTGCG CTAGACGGGATTACAGATTTGACATGGGCTTTGATTACTGGGGGCAGGGC ACAACTGTTACGGTCAGCTCT taa 1524 DNA : 15 NCT-006 2212851-PL02087- 2.7-NCT006-(507 aa)- (Ml_R2_P98d el_F461_Y66 O_delins_HH VPembroliz umab plus 1 inker_143aa peptide) MRR RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD RPTPSPAPSRPQVQLRVRRRVCARRVDYRFDMGFDYWGVQSGVEVKKPGA S VKVS CKAS GYTFTNYYMYWVRQAP GQGLEWMGGINP SNGGTNFNEKFKN RVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTV TVSS 507 PRT 16 Expression and Assembly of HEV VLPs in Baculovirus Expression Vector Systems Baculovirus expression vector systems (BEVS) have been widely used to facilitate the expression of heterologous proteins in cultured insect cells, most commonly based on the Autographa californica Nuclear Polyhedrosis Virus (AcNPV) or the Bombyx mori Nuclear Polyhedrosis Virus (BmNPV), which are used to infect Spodoptera frugiperda (fall armyworm), Trichoplusia ni (cabbage looper), or Bombyx mori (silkworm) cells [O'Reilly, Miller, and Luckow, 1992], A variety of methods have been used to facilitate the generation of recombinant baculoviruses. The earliest methods were based on homologous recombination between a transfer vector and wild-type or modified baculovirus DNA samples transfected into cultured insect cells, replacing the polyhedrin gene to generate viruses that formed occlusion-minus plaques at a frequency of 0.1% to 1% on lawns of cultured cells under a layer of low melting point agarose [O'Reilly, Miller, and Luckow, 1992], The frequency increased to about 30%, when a linearized parental virus was used, and later, up to 100% with improved parental virus variants were developed [Kitts et al, 1990; Roy et al 2012; Possee et al 2019]. Linearized viral backbones are now available from a variety of sources. The development of the baculovirus shuttle vector (bacmid) system also improved the efficiency of the system, by using components of Tn7, a site-specific bacterial transposon, to insert a mini-transposon comprising one or more genes of interest under the control of a baculovirus promoter derived from a donor vector, in the presence of a helper vector which comprises four transposase genes, into a target vector comprising a gene fusion with an attachment site for the transposon propagated as a very low copy number plasmid (designated as a bacmid, or more generically as a baculovirus shuttle vector) in E. coli [Luckow et al 1993]. DNA samples isolated from bacterial cells harboring composite shuttle vectors comprising a cargo DNA segment derived from the transposon are infectious when transfected into susceptible insect cells, bypassing the need to perform plaque assays to purify recombinant viruses using tedious traditional or more rapid methods based on homologous recombination between a transfer vector and a circular or linearized parental viral DNA genome. Donor, helper, and target vectors are available from Thermo Fisher as components of their Bac-To-Bac™ system. Thousands of proteins have been expressed in baculovirus-infected insect cells for a wide variety of applications, including therapeutic proteins, vaccines, and components of gene therapy vector systems, including viral capsid systems, used in basic and applied research and development, and as biopharmaceutical products reviewed and approved by the FDA and similar regulatory agencies around the world [Luckow et al 1993; Chen et al. 2016; Possee 2019], Spodoptera frugiperda and Trichoplusia ni cells are commonly used as substrates for expression of proteins encoded by genes of interest on recombinant baculoviruses derived from AcNPV. These include Sf9, Sf21, Tn368 and High Five (7. ni) cell lines available from the biological material depositories, such as ATCC (Manassas, Virginia) and a variety of commercial sources. Products intended for use in healthcare applications need to be expressed in cells that are free of adventitious agents or byproducts of purification processes, which have the potential to compromise the activity or effectiveness of the product in its intended application, such as a patient receiving a therapeutic protein, vaccine, or gene therapy vector, more so perhaps, than a product used in a diagnostic assay or for basic structure / function assays. Rhabdovirus- and nodavirus-free Spodoptera frugiperda and Trichoplusia ni cell lines are now available from a variety of commercial sources. Expression of VLPs in Baculovirus-infected Insect Cell Lines While baculovirus expression vector systems have been used to facilitate the expression and purification VirusLike Particles used in human and animal vaccines at very large scales for many years (Kaba et al. 2004), there is a growing interest in using these systems to express HEV-VLPs at high levels as well, followed by procedures to efficiently concentrate and purify the particles (Kawano et al. 2011). Since methods involving ultracentrifugation are labor-intensive and not easily scalable, other approaches have been developed for use to produce GMP-quality materials, using cation exchange liquid chromatography (LC) and size-exclusion columns. Non-infectious HEV-VLPs with T=1 virus-like structures have been produced via baculovirus expression of the Hepatitis E capsid protein with N terminus and C terminus truncated, P0RF2 (Xing et al. 1999; Xing, Li, Mayazaki, et al. 2010; Yamashita et al. 2009). Construction of Recombinant Baculoviruses Comprising HEV-VLP Sequences Recombinant baculoviruses comprising genes encoding HEV-VLP variant capsid proteins can be constructed by two basic methods: (1) insertion of a capsid variant gene into a transfer vector, which is then transfected into cultured insect cells with a circular or linearized viral backbone, where they recombine to generate infectious viruses that are capable of expressing the heterologous capsid proteins, typically under the control of the polyhedrin promoter; or (2) insertion of a capsid variant gene into a donor vector that is transformed into E. coli DHIOBac cells, harboring a shuttle vector, such as bMON14272, and a helper vector, such as pMON7124„ and screening for cells that harbor a composite shuttle vector generated by transposition of the cargo segment of the donor into a target site within a disruptable lacZalpha gene fusion on the shuttle vector to generate a composite target vector that can be transfected directly as a pure virus into cultured insect cell lines. Both approaches require synthesis of segments of DNA encoding the desired genes, that may be codon-optimized, and flanked by recognition sites for restriction enzymes or regulatory sequences, which are available from a variety of commercial vendors of synthetic DNA fragments and vectors. In the first approach, DNA fragments are cloned into a transfer vector such as pVL1392 or pVL1393, verified by sequencing, and transfected into insect cells with a linearized viral backbone, such as BestBac 2.0 (Av-cath / chiA) (Expression Systems, Davis, CA) to generate viruses in a series designated AcBestBacORF2. In the second approach, DNA fragments are cloned onto a donor vector, such as pFastBacl (Thermo Fisher), and transformed into competent, E. coli DHIOBac cells, screened, and composite DNA samples transfected into insect cells to generate AcBacToBacORF2 viral vectors. Stocks of AcBactoBac-ORF2 and AcBestBacORF2 can be prepared by repeated passages in Sf9 cells grown in ESF921 serum-free medium (Expression Systems) at 27°C. Viral titers can be measured using antibodies directed against gp64 (Mulvania, Hayes, and Hedin 2004). The general parameters used for inoculation (by AcBactoBacORF2 or AcBestBacORF2) and harvest of the cell culture supernatants are described as follows. Day 1: Seed cell cultures of High Five cells in ESF921 at 1 million cells / ml; Day 2: Infect the cell cultures at an MOI = 0.1 - 5.0, incubate by shaking for two hours; and determine the viable cell count and percent viability on a daily basis, staining cells for gp64 expression on days 1 and 2 post infection (pi). Days 3-7: pellet cells and store pellets from each culture at -80°C, while storing viral supernatant samples at 4°C. The yields and qualities of HEV-VLPs from each inoculation conditions are analyzed and compared after each purification step. Stocks of pure virus at known titers can be used in subsequent studies to determine optimal conditions for expression under a variety of conditions. For example, High Five cells at 1-2 million cells per ml can be infected with titered viral samples to determine the time course for expression over a series of days, and samples of cells and clarified supernatants collected for analysis, to determine the optimal period to harvest cells which ensure that the desired protein is expressed at high levels without significant degradation or disassembly, into inactive fragments. Purification of HEV-VLPs from Baculovirus-lnfected Insect Cells Levels of expression of heterologous proteins in baculovirus-infected insect cell lines will vary, typically starting around 48 hpi for genes under the control of the strong polyhedrin promoter. The nature of the protein being expressed will also affect its location, within the cell, or the accumulation of proteins or complex Virus-Like Particles actively secreted by intact cells, or exposed to the media when cells begin to lyse, late in infection (48-72 hpi). Cell fractionation studies can be performed to determine the relative amounts and activities of proteins of interest using a variety of assays, including immunoblotting or dye binding properties of proteins separated by electrophoresis on acrylamide gels. If HEV-VLPs are secreted from infected cells, the medium and cells can be separated by centrifugation at lowspeed centrifugation (e.g., 1500-3000 rpm for 15 min at4°C). The supernatant can be pre-treated with a detergent (e.g., 0.5-1% Nonidet P-40), and gently rocked at room temperature for >2 h), before adding 5 - 20 U / mL of Benzonase in 1 mM MgCI2 at 37°C, 2.5 hours to be used to break down endogenous DNA. If HEV-VLPs are not secreted from infected cells, the medium and cells can be separated by centrifugation at low-speed centrifugation (e.g., 3,000 rpm for 15 min at 4°C). The pelleted cells can be pre-treated with a denaturation buffer (e.g., 50mM sodium borate, 150mM NaCI, 1% Nonidet P-40,0.5% sodium deoxycholate, and 5% 2-mercaptoethanol, and gently rocked at room temperature for 2 h). The lysate will be diluted with cell medium before the purification process. Figure 5: sets forth an illustration entitled "Pretreatment of Cells Before Purification for HEV-VLPs That Are Not Secreted From Cultured Cells”. HEV-VLPs recovered by either method can purified further by several additional steps: (1) Clarification, to remove cell debris and large aggregates; (2) Concentration, to minimize investment in the equipment and consumable products; (3) Purification of the desired molecules; and (4) Polishing, to remove host-cell proteins and nucleic acids needed to reach acceptable thresholds for clinical grade biomaterials. Figure 6: sets forth an illustration entitled "Purification Process with Capture / Purification Steps by pH-Gradient-Based Ion Exchange Methods". Figure 7: sets forth an illustration entitled "Purification Process with Capture / Purification Steps by SaltGradient-Based Ion Exchange Methods". Other approaches can also be used to purify HEV-VLPs in large quantities (scalability), with high quality (purity), high titer (potency), and in GMP-favorable manners, which include depth filtration, tangential-flow ultrafiltration (TFF), cation-exchange chromatography (IEX, FPLC) or cation-exchange membrane chromatography, and sizeexclusion (SEC, FPLC) replacing the clarification, concentration, capture / purification, and polishing steps, respectively. Methods relying on separation of components from mixtures by ultracentrifugation can also be used (Xing et al. 1999; Niikura et al. 2002; Li et al. 2005a; Xing et al. 2011; Chen et al. 2018). Generic Encapsulation Protocols DNA encapsulation processes described in earlier studies (Barr, Keck, and Aposhian 1979; Nilsson et al. 2005) can be expanded to encapsulate different payloads, including inorganic Virus-Like Particles, DNA, mRNA, and peptides into HEV-VLPs. Disassembly and reassembly of the recombinant HEV-VLPs can be performed according to a procedure as described (Takamura et al. 2004) with minor modifications. Briefly, purified HEV-VLPs are diluted to a final concentration of 0.4-1.2 mg / mL and incubated for 1-2 hr at room temperature in a buffer containing 1-10 mM EGTA and 10-20 mM DTT. Disassembly of HEV-VLPs that are ~10 nm can be measured and confirmed by Dynamic Light Scattering (DLS) using a Malvern Anton parr, Litesizer 500 device. Figure 8: sets forth an illustration entitled "Generic Encapsulation Process for HEV-VLPs". Payloads at designated ratios can be added to the disassembled HEV-VLPs and mixed for >15 min. Mixtures of disassembled HEV-VLPs and payloads can be reassembled by adding 1 / 4 volume of 4-10 mM CaCI2 or 5-10 mM MgCI2 every hour for four times and incubated at 4°C overnight. The sizes of HEV-VLPs after encapsulation / reassembly reactions can be measured by DLS and confirmed by TEM. Negatively-charged Inorganic Virus-Like Particles, like citric acid-treated ferrite NPs, can be encapsulated by HEV-VLPs regardless of their sizes. Instead of forming T=1 HEV-VLP particles that are ~27 nm, the particle sizes should vary according to the sizes of ferrite Virus-Like Particles (NP) (Chen CC 2017). Encapsulation of ferrite NPs by capsids of disassembled HEV-VLPs are primarily due to the interactions between negative-charged ferrite particles and the positively-charged residues within capsid particles (Takamura et al. 2004; Cheng and Xing 2014). Alternative Encapsulation Process Examples: Example 1: The encapsulation process can be performed at 37 °C to reduce the process time and improve encapsulation efficiency. In general, the payloads, such as DNA plasmid and mRNA, at designated ratioscan be added to the disassembled HEV-VLPs and mixed for >15 min. Mixtures of disassembled HEV-VLPs and payloads can be reassembled by adding CaCI2 or MgCI2 to final concentration of 5-10 mM at 37 °C for one hour, followed by incubating at 4°C overnight. The sizes of HEV-VLPs after encapsulation / reassembly reactions can be measured by DLS and confirmed by TEM. Example 2: The encapsulation process can be performed by microfluidic process, which has been widely used in Lipid Nano Particles (LNP) (Ward 2015) to achieve automation and GMP favored process. In general, the payloads, such as DNA plasmid, mRNA etc., at designated ratios can be mixed with the disassembled HEV-VLPs in microfluid device. Similarly, mixtures of disassembled HEV-VLPs and payloads can be reassembled in microfluidic device by adding CaCI2 or MgCI2 to final concentration of 2-10 mM at 25-37 °C. The sizes of HEV-VLPs after encapsulation / reassembly reactions can be measured by DLS and confirmed by TEM. Payload Condensation and Encapsulation Procedures Payloads generally need to be condensed to preferred size ~10 nm to enhance the efficiencies of encapsulation process steps. DNA condensation and charge inversions usually occur in solutions of multivalent counterions. Organic monovalent ions of tetraphenyl chloride arsenic (Ph4As+) can induce DNA compaction at low Ph4As+ concentrations of ~1 pM (Xia et al. 2017). When the concentration of Ph4As+ is increased to 1 mM, steps disappeared in the pulling curves, and globular structures could be found in the corresponding AFM image (Xia et al. 2017), suggesting that payloads of plasmids can be condensed to ~10 nm using ~ 1-2 mM Ph4As+, such as 2 mM tetra-phenyl-arsonium chloride that are incubated overnight at 4°C. The sizes of the plasmid payloads after condensation can be measured by DLS. Generic insulin is small (MW 5.8kDa) and has a negative surface charge, making it an attractive payload for use in HEV-VLP systems (Chen, Baikoghli, and Cheng 2018), compared to long chain-linked insulins which may be extruded out of the assembled particles. Generic insulins prepared without an aggregation step could not be encapsulated into HEV-VLP despite their size <10 nm and negatively-charged surface, suggesting that payload condensation will be critical for the successful encapsulation by HEV-VLP capsids. Structural data confirmed that insulin hexamer conformation changes can be induced by Zn+2 (Olsen et al. 2003), suggesting that generic insulins at 0.2-1.0 mg / mL can be condensed in 2 mM ZnCI2 to reduce the payload size to ~10 nm, before encapsulation. Insulin-encapsulated HEV-VLPs will be analyzed by DLS and confirmed byTEM. The content of insulin can be analyzed by ELISA analysis. Evaluation of DNA Samples Inside HEV-VLPs HEV-VLPs can be viewed as nucleic acid binding proteins that can form DNA / protein or RNA / protein complexes upon mixing. The resulting samples would contain a mixture of components, including empty HEV-VLPs, HEV-VLPs containing DNA, plus unincorporated DNA and capsid protein molecules. DNA encapsulated HEV-VLPs need to be efficiently separated from empty shells. Plasmid DNAs can be condensed by >1 mM Ph4As+ before encapsulation. Reagents like Ph4As+, however, are considered biohazard reagents. Size exclusion columns (SEC, with a cutoff size of 50 - 400 kDa) can be used to isolate HEV-VLPs carrying DNA payloads to reduce the concentration Ph4As+ and other solutes to safe levels. Encapsulation of plasmid DNAs plasmids can be performed by following general procedures. Plasmid encapsulated HEV-VLPs can be concentrated by filtering through a 100 kDa centrifugal filter (Amicon Ultra-0.5 Centrifugal Filter Device). The concentrated samples are applied to a gravity size-exclusion column (SEC) (e.g., GE Sephacryl S-500 resin or TOSOH TSK gel G6000 SEC column). Collected fractions can be measured by spectrophotometry, DLS, and confirmed byTEM. The encapsulated DNA contents can be estimated by comparing amplifications of fragments by semiquantitative PCR analyses of serial dilutions of unbound plasmid DNA samples separated on 1% agarose gels. Encapsulation of RNA Samples Inside HEV-VLPs Small RNA molecules can be encapsulated into HEV-VLPs using a protocolthat is similar noted above for plasmid DNAs, without the nucleic acid condensation step. CleanCapTM eGFP mRNA, 996 nt (TriLink Biotechnology, San Diego, CA, USA) can be used as a control, encapsulated into HEV-VLPs. Free mRNAs can be cleaned by passing through a size-exclusion column (SEC), such as a CaptoTM Core 400 multimodal chromatography column (Cytiva). Samples from collected fractions can be analyzed by UV spectrophotometry, DLS (Anton parr Litesizer 500), and TEM. HEV-VLPs containing encapsulated RNAs are also treated with RNase to confirm that RNAs are protected and packaged within the Virus-Like Particle. Reactions can be terminated by adding an RNase inhibitor, and the sample pelleted to remove the RNase and the RNase inhibitor. TEM analyses and UV spectrophotometry measurements are also used to confirm that the treatment did not disintegrate RNA molecules encapsulated within HEV-VLP. HEV-VLPs comprising RNA molecules can be disassembled, resulting in an increase in the concentration of nucleic acids, that can be detected as bands on agarose gels. Encapsulation of Mixtures Comprising One or More Nucleic Acids or Polypeptides Inside HEV-VLPs Strategies for disassembly, assembly, and encapsulation noted above can also be used to prepare HEV-VLPs that contain one or more molecules that are not covalently associated with capsid proteins, per se. The mixtures can comprise nucleic acids such as a single-stranded RNA, a double-stranded RNA, a single-stranded DNA, a double stranded DNA, plus short peptides, longer polypeptides, and complexes between one or more peptides or polypeptides and a single- or double-stranded RNA or DNA molecule, including components of CRISPR-based systems, such as a Cas protein complexed with a guide RNA molecule. In Vitro Potency Assay Using the Inoculation of Mammalian Cells with DNA and mRNA payloads from Encapsulated HEV-VLPs PC-3 cells grown in monolayers in DMEM medium (GIBCO) supplemented with 10% fetal bovine serum (FBS), 100 lU / ml penicillin and 100 ug / ml streptomycin can be seeded in 12-well plates (Nunc, Life Technologies) and grown to 80% of confluence (~4xl05 cells / well). Cells can be washed with PBS. Samples of 50 ul of DNA encapsulated HEV-VLPs diluted in 100 ul of PBS can be added to wells, and allowed to incubate for 1 h at 37°C. After this step, 1 mL of DMEM supplemented with 10% FBS will be added, and the cells will be incubated for 48 and 72 h at 37°C. GFP expression and activity levels are measured by comparing the number of fluorescent and non-fluorescent cells using a Cellometer device. Transmission Electron Microscopy (TEM) The purified VLPs can be loaded onto a glow-discharged, carbon-coated EM grid and stained with 2% uranyl acetate. The formation of HEV-VLPs can be examined under transmission electron microscope (TEM) at the magnifications of 10,000x- 30,000x. EXAMPLE 1: DERIVING A CONSENSUS SEQUENCE FROM RELATED HEPATITIS E VIRUS 0RF2 CAPSID SEQUENCES A variety of methods can be used to design and assemble viral capsids based on known sequences deposited into sources of publicly-accessible nucleotide and amino acid databases, such as GenBank. In many cases, basic research is carried out with a limited set of vectors comprising nucleotide sequences encoding peptides or polypeptides of interest, and their variants, to facilitate the characterization of direct relationships between structural and functional features of molecules, such as binding of repressors or activators to DNA, mRNA stability, and folding, assembly, and catalytic activity of monomeric proteins or oligomeric complexes of subunits encoded from the same or different genes. Some strategies, such as saturation mutagenesis across segments of nucleotide sequences of interest, are generally more likely to occur in applied research settings, when resources are not limiting, to generate large amounts of data that become valuable for understanding structural and functional relationships of molecules involved in chronic and acute diseases, including cancer, infectious diseases, and immunological deficiencies, that are needed to facilitate the discovery, development, and commercialization of novel drug products, including compositions comprising therapeutic agents, vaccines, and components of cell and gene therapy vector systems. More than 2200 nucleotide sequences have been deposited into GenBank that are described as encoding components of Hepatitis E virus, many based on clinical samples collected from patients in hospitals or from veterinary samples around the world. Deciding where to begin, and which sequences to use, are often challenging when prototype viruses, despite being studied for decades, do not appear to be clinically-relevant, or amenable for mutagenesis, expression, and propagation in cultured cells, to characterize key components that will lead to the development of vaccines, or as Virus-Like Particles that can encapsulate nucleic acids, proteins, or small molecules, or be conjugated to other molecules suitable for use in diagnostic procedures or as therapeutic drug products. This application discloses methods for the design and characterization of novel viral capsids derived from one or more consensus sequences obtained by comparing lineups of many related HEV 0RF2 capsid polypeptide sequences. In the examples noted below, the frequencies of amino acids at each position across 660 or 674 amino acids derived from the 0RF2 capsid protein from 124 related HEV genomes were determined. These strategies should lead to the discovery and development of new capsids that are functional in a variety of human cells, as VirusLike Particles that can efficiently deliver a variety of other molecules, encapsulated by or conjugated to a particle that is bound to and absorbed by specific kinds of host cells. Virus-Like Particles based on a consensus sequence derived from HEV, or variants thereof, do not appear to be disclosed or suggested in publicly-available sequence, journal article, or patent document databases. Tables and figures summarizing the frequencies of variants derived from lineups of nucleotide or polypeptide sequences allow you to identify segments comprising "a sea" of highly conserved residues interspersed with segments comprising "islands" of two or more residues, taking into account their biochemical properties, such as position of a nucleotide within a codon, or properties of side chains of amino acids observed at any given position. If a segment of one or more amino acids comprises a mixture of aliphatic, hydrophobic, positively-, or negatively- charged residues, then that segment may tolerate many kinds of amino acids, that are not necessarily observed in frequency tables. If they are all hydrophobic or negatively-charged, for example, then the tolerance for alterations may be lower, and only biochemically-similar amino acids may be substituted. Site-specific mutagenesis or directed evolution experiments can also be performed, where one or more amino acids are substituted, inserted, or deleted at specific positions and assessed, to determine if the properties of the capsid are altered in a desirable fashion. The sequences of genes encoding the variant capsid proteins can be determined, and combined with one or several other variants to generate other desirable sequences, that may not occur in nature, but have similar or unexpected properties compared to those disclosed in GenBank or other publicly-available nucleotide or amino acid sequence databases. Thousands of sequences of HEV or HEV-like viruses have been deposited in GenBank, and it is useful to compare multiple sequence alignments of related sequences determine the locations of segments of amino acids that were identical, highly conserved, or variable, across the entire length of the capsid protein. A series of tablesand figures are noted below based on a query in GenBank, and then extracting those sequences and preparing multiple sequence lineups using ClustalP (Sievers, 2011), and determining the frequencies of variant amino acids at different positions across the entire length of the protein. Raw lineups of sequences were pasted into Excel, in groups of 60 to 100 amino acids, and tables prepared that compare the frequency of amino acids in each aligned column of 100 sequences in each group. Some amino acids occurred only once (such as the starting methionine), while others had a variety of amino acids, up to 6 different kinds for an initial set of 124 highly similar sequences. Fewer or more sequences can be analyzed, using the data generated from other kinds of search queries. Table 3: Search Query and Sources of 124 Related HEV Capsid Proteins in GenBank* Search Strategy: (txid291484[organism:exp] AND (capsid[AII Fields] AND complete[AII Fields])) AND "Paslahepevirus balayani" [porgn] AND ("651"[SLEN] : "675"[SLEN]). Seq GenBank Accession Number Seq GenBank Accession Number 1 >BAD74183.1 capsid protein [Paslahepevirus balayani] 63 >BAH03567.1 capsid protein [Paslahepevirus balayani] 2 >BAD74180.1 capsid protein [Paslahepevirus balayani] 64 >BAH03564.1 capsid protein [Paslahepevirus balayani] 3 >BAD74177.1 capsid protein [Paslahepevirus balayani] 65 >BAH03561.1 capsid protein [Paslahepevirus balayani] 4 >BAD74174.1 capsid protein [Paslahepevirus balayani] 66 >BAF92627.1 capsid protein [Paslahepevirus balayani] 5 >BAH08627.1 capsid protein [Paslahepevirus balayani] 67 >BAE79668.1 capsid protein [Paslahepevirus balayani] 6 >BAH08624.1 capsid protein [Paslahepevirus balayani] 68 >BAE79665.1 capsid protein [Paslahepevirus balayani] 7 >BAH08615.1 capsid protein [Paslahepevirus balayani] 69 >BAE79662.1 capsid protein [Paslahepevirus balayani] 8 >BAH08613.1 capsid protein [Paslahepevirus balayani] 70 >BAE79659.1 capsid protein [Paslahepevirus balayani] 9 >BAH08610.1 capsid protein [Paslahepevirus balayani] 71 >BAE79656.1 capsid protein [Paslahepevirus balayani] 10 >BAH08607.1 capsid protein [Paslahepevirus balayani] 72 >BAE79653.1 capsid protein [Paslahepevirus balayani] 11 >BAH08598.1 capsid protein [Paslahepevirus balayani] 73 >BAE79650.1 capsid protein [Paslahepevirus balayani] 12 >BBF24716.1 capsid protein [Paslahepevirus balayani] 74 >BAE79647.1 capsid protein [Paslahepevirus balayani] 13 >BBF24681.1 capsid protein [Paslahepevirus balayani] 75 >BAE79644.1 capsid protein [Paslahepevirus balayani] 14 >BBF24678.1 capsid protein [Paslahepevirus balayani] 76 >BAH22721.1 capsid protein [Swine hepatitis E virus] Seq GenBank Accession Number Seq GenBank Accession Number 15 >BBF24668.1 capsid protein [Paslahepevirus balayani] 77 >BAH22718.1 capsid protein [Swine hepatitis E virus] 16 >BBF24660.1 capsid protein [Paslahepevirus balayani] 78 >BAH22714.1 capsid protein [Swine hepatitis E virus] 17 >BBF24614.1 capsid protein [Paslahepevirus balayani] 79 >BAH22712.1 capsid protein [Swine hepatitis E virus] 18 >BBF24611.1 capsid protein [Paslahepevirus balayani] 80 >BAD74171.1 capsid protein [Paslahepevirus balayani] 19 >BBF24602.1 capsid protein [Paslahepevirus balayani] 81 >BAD74168.1 capsid protein [Paslahepevirus balayani] 20 >BBF24599.1 capsid protein [Paslahepevirus balayani] 82 >ACJ54949.1 capsid protein [Swine hepatitis E virus] 21 >BBF24584.1 capsid protein [Paslahepevirus balayani] 83 >ACJ54946.1 capsid protein [Swine hepatitis E virus] 22 >BBF24578.1 capsid protein [Paslahepevirus balayani] 84 >BBL78146.1 capsid protein [Paslahepevirus balayani] 23 >BBF24572.1 capsid protein [Paslahepevirus balayani] 85 >BBH72275.1 capsid protein [Paslahepevirus balayani] 24 >BBF24524.1 capsid protein [Paslahepevirus balayani] 86 >BBE29389.1 capsid protein [Paslahepevirus balayani] 25 >BBF24515.1 capsid protein [Paslahepevirus balayani] 87 >BAV576O7.1 capsid protein [Paslahepevirus balayani] 26 >BBF24455.1 capsid protein [Paslahepevirus balayani] 88 >BAK52238.1 capsid protein [Paslahepevirus balayani] 27 >BBF24446.1 capsid protein [Paslahepevirus balayani] 89 >BAK52235.1 capsid protein [Paslahepevirus balayani] 28 >BBF24437.1 capsid protein [Paslahepevirus balayani] 90 >BAE02704.1 capsid protein [Paslahepevirus balayani] 29 >BBF24416.1 capsid protein [Paslahepevirus balayani] 91 >BAE02701.1 capsid protein [Paslahepevirus balayani] 30 >BBF24407.1 capsid protein [Paslahepevirus balayani] 92 >AXL93752.1 capsid protein [Paslahepevirus balayani] 31 >BBF24401.1 capsid protein [Paslahepevirus balayani] 93 >AXJ21463.1 capsid protein [Paslahepevirus balayani] 32 >BBF24386.1 capsid protein [Paslahepevirus balayani] 94 >AOG18225.1 capsid protein [Hepatitis E virus type 3] 33 >BBF24374.1 capsid protein [Paslahepevirus balayani] 95 >AOG18222.1 capsid protein [Hepatitis E virus type 3] 34 >BBF24368.1 capsid protein [Paslahepevirus balayani] 96 >AOG18219.1 capsid protein [Hepatitis E virus type 3] 35 >BBF24335.1 capsid protein [Paslahepevirus balayani] 97 >AOG18216.1 capsid protein [Hepatitis E virus type 3] 36 >BBF24323.1 capsid protein [Paslahepevirus balayani] 98 >AOG18213.1 capsid protein [Hepatitis E virus type 3] 37 >BBF24299.1 capsid protein [Paslahepevirus balayani] 99 >AOG18210.1 capsid protein [Hepatitis E virus type 3] 38 >BBF24281.1 capsid protein [Paslahepevirus balayani] 100 >ART85721.1 capsid protein [Swine hepatitis E virus] 39 >BBF24266.1 capsid protein [Paslahepevirus balayani] 101 >AMH40419.1 capsid protein [Swine hepatitis E virus] 40 >BBF24260.1 capsid protein [Paslahepevirus balayani] 102 >BAS32610.1 capsid protein [Hepatitis E virus type 4] 41 >BBF24254.1 capsid protein [Paslahepevirus balayani] 103 >AHZ44449.1 capsid protein [Swine hepatitis E virus] 42 >BBF24252.1 capsid protein [Paslahepevirus balayani] 104 >AHZ44446.1 capsid protein [Swine hepatitis E virus] 43 >BBF24821.1 capsid protein [Paslahepevirus balayani] 105 >AH 187595.1 capsid protein [Swine hepatitis E virus] 44 >BBF24809.1 capsid protein [Paslahepevirus balayani] 106 >ACY66855.1 capsid protein [Swine hepatitis E virus] 45 >BBF24728.1 capsid protein [Paslahepevirus balayani] 107 >ACY66852.1 capsid protein [Swine hepatitis E virus] 46 >BCN97356.1 capsid protein [Paslahepevirus balayani] 108 >ACM68932.1 capsid protein [Swine hepatitis E virus] 47 >BCN97353.1 capsid protein [Paslahepevirus balayani] 109 >ABB88701.2 capsid protein [Swine hepatitis E virus] 48 >BAV53293.1 capsid protein [Paslahepevirus balayani] 110 >ACH87960.1 capsid protein [Swine hepatitis E virus] 49 >BAV53290.1 capsid protein [Paslahepevirus balayani] 111 >ACH87954.1 capsid protein [Swine hepatitis E virus] 50 >BAH08621.1 capsid protein [Paslahepevirus balayani] 112 >BAB79306.1 capsid protein [Swine hepatitis E virus] 51 >BAH08618.1 capsid protein [Paslahepevirus balayani] 113 >ACH87966.1 capsid protein [Swine hepatitis E virus] 52 >BAH08604.1 capsid protein [Paslahepevirus balayani] 114 >ACH87963.1 capsid protein [Swine hepatitis E virus] 53 >BAH08600.1 capsid protein [Paslahepevirus balayani] 115 >ACH87957.1 capsid protein [Swine hepatitis E virus] 54 >BAH08595.1 capsid protein [Paslahepevirus balayani] 116 >sp | P33426.11CAPSDHE VPA Seq GenBank Accession Number Seq GenBank Accession Number 55 >BAH08592.1 capsid protein [Paslahepevirus balayani] 117 >sp | P29326.11 CAPSD_HEVBU 56 >BAH08589.1 capsid protein [Paslahepevirus balayani] 118 >sp | Q81871.11 CAPSD_H E VCH 57 >BAH08586.1 capsid protein [Paslahepevirus balayani] 119 >sp | Q68985.11 CAPSD_H E VHY 58 >BAH08583.1 capsid protein [Paslahepevirus balayani] 120 >sp | Q9IVZ8.21 CAPSD_H E VCT 59 >BAH08580.1 capsid protein [Paslahepevirus balayani] 121 >sp | Q9YLQ9.11CAPSDH EVUS 60 >BAH08577.1 capsid protein [Paslahepevirus balayani] 122 >sp | Q6J8F7.11 CAPSD_HEVMG 61 >BAH03573.1 capsid protein [Paslahepevirus balayani] 123 >sp | Q04611.1| CAPSD_HEVM Y 62 >BAH03570.1 capsid protein [Paslahepevirus balayani] 124 >sp | Q03500.11 CAPSD_H EVM E *Records 116 to 124 also contain the same supplemental annotations: "RecName: Full=Pro-secreted protein 0RF2; AltName: Full=Protein 0RF2; Short=pORF2; Contains: RecName: Full=Secreted protein 0RF2; Short=ORF2s; Flags: Precursor". Figures were also prepared that sorted the number of different amino acids at each position which were then analyzed using several algorithms, comparing their biochemical properties based on hydrophobicity, charge, size, and other properties, with numerical values that differ for each algorithm. If all of the amino acids in a column are the same, that position is highly conserved, suggesting that residue is critical with respect to expression (amino terminal Met), transport (signal peptides), catalytic, or other structural or functional features of the protein. If the amino acids vary, but have similar biochemical properties, then substitutions at those positions suggest a higher tolerance for other amino acids of the same chemical class, but not necessarily those represented in the set of sequences being analyzed. If the amino acids vary, but have very different biochemical properties, then a wide variety of substitutions, or even insertions and deletions may be tolerated, at that position or nearby positions, perhaps because that amino acid or segments of contiguous amino acids nearby are exposed within or outside the cell, or in a disordered internal segment, such as a spacer between highly organized segments or polypeptide domains. Figure 9: sets forth an illustration entitled "Frequencies of Amino Acid Substitutions in Related HEV 0RF2 Capsid Sequences Used to Generate a Consensus Capsid Sequence" based on 124 different HEV capsid proteins, 93 of which are described as Paslahepevirus balayani, and the rest derived from other sources (including swine). Note the "islands" of variability among a "sea" of highly conserved amino acids, particularly at the amino and carboxy termini of the 124 protein sequences. There are longer stretches of highly-conserved amino acids in this group of sequences, compared to the first group. Figure 10: sets forth an illustration entitled "Predicted Secondary Structures For a Consensus Sequence Derived from Multiple Sequence Alignments of Related HEV 0RF2 Capsid Protein". Figure 11: sets forth an illustration showing the distances in number amino acid changes across 124 sequences (green is lower, red is higher). This image illustrates the basic differences for the 124 sequences against each other, with a green diagonal showing equivalence between the same sequence. The big blocks illustrate sequences of 660 aa compared against 660 aa (both preceded by 15 dashes from the lineup), or 674 aa against 674 aa. The color patterns of the differences look like farm fields. Figure 12: sets forth an illustration showing the frequencies of number amino acid changes across 124 sequences (green is lower, red is higher). Sequence Alignment 1: Consensus Sequence NCT-660 Derived from 124 Related HEV ORF2 Capsid Sequence (SEQ ID NO: 02) MRPRAVLLLFLVLLPMLPAPPAGQPSGRRRGRRSGGAGGGFWGDRVDSQP FALPYIHPTNPFASDWSQSGAGARPRQPARPLGSAWRDQSQRPAAAPRR RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD RPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNPMYVSDTVTF VNVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGV LAPHSALAVLEDTVDYPARAHTFDDFCPECRTLGLQGCAFQSTVAELQRL KMKVGKTREY Clear patterns of variability from these analyses are valuable in the design of vectors encoding consensus sequences and their variants derived from HEV, where one or more amino acids are substituted, inserted, or deleted at specific positions, and assessed to determine if the properties of the capsid are altered in a desirable fashion. The sequences of genes encoding variant capsid proteinscan be determined, and combined with those of other desirable sequences encoding variants, that may not occur in nature, and have altered or improved properties for particular applications in the development and commercialization of clinically-relevant therapeutic drug products, vaccines, and as components of cell and gene therapy vector systems, as described in other Examples noted below. Note that the depictions of variable and invariable sequences depend heavily on the query sequence submitted to a nucleotide or polypeptide sequence database and the results that are returned, based on the algorithms used to identify similar sequences. A query that is highly similar to many other sequences represented in the database, will return sets of sequences that may show many invariable, identical, or highly conserved regions and fewer variable regions compared to a query that is less similar to other sequences represented in the database, that would return more regions of variability and fewer regions of invariable, identical, or highly conserved sequences. Capsids derived from HEV consensus sequences, and variants thereof, comprising one or more amino acid substitutions, insertions, or deletions that are "functionally similar" in this context, refer to the ability of polypeptides to be expressed in prokaryotic or eukaryotic host cell systems that can assemble and form VLPs or Virus-Like Particles that have desirable properties, such as the ability to form three dimensional structures that are similar to those observed for wild-type viruses using electron microscopy and Virus-Like Particle counting equipment, and the ability to encapsulate nucleic acids, such as RNA molecules encoding viral proteins, or heterologous polypeptides, based on amino acid side chains within the shell of a capsid that can attract and specifically or non-specifically bind to an RNA molecule. Capsids derived from HEV consensus sequences, and variants thereof, comprising one or more amino acid substitutions, insertions, or deletions that have enhanced properties in this context, also refer to the ability to encapsulate and bind dsDNA molecules, polypeptides, or be altered to contain residues on exterior or interior surfaces that facilitate conjugation to other molecules, for use as vaccines, or as agents used to target and deliver non-covalently associated nucleic acids, polypeptides, or small therapeutic drug products to a cell. Identifying and displaying regions of variability among a sea of conserved residues in a consensus sequence derived from HEV 0RF2 capsid proteins, dramatically accelerates the discovery, development, and commercialization of a wide variety of products for use as therapeutic or diagnostic agents, avoiding the need to design, express, and test hundreds of variants by traditional methods that have the desirable properties for specific applications. EXAMPLE 2: DEVELOPING HEV-VLPS FOR HYDROPHOBIC DRUG DELIVERY SYSTEMS Applications based on Virus-Like Particles for targeted delivery of drug products have dramatically increased in recent years. While many types of nanocarriers, such as synthetic polymers, liposomes, and telodendrimers, have been designed and evaluated over the last 20 years, limitations such as toxicity, inability to accumulate enough molecules to the cytoplasm, and lack of biodegradability, still need to be addressed (Sebestik, Niederhafner et al. 2011, Jian, Zhang et al. 2012). Liposomal carriers (e.g. Doxil®, 5-fluorouricil, etc.) do not possess the ability to target specific types of cells, but tend to accumulate in solid tumors due to the features of the tumor region, such as large pore spaces in newly-synthesized blood vessels (EPR effect) (Shi, van der Meel et al. 2020). Drug leakage during circulation, resulting in undesired side effects and stability issues are significant concerns (Russell, Huitz et al. 2018). Lipid-based Virus-Like Particle delivery systems are micelles, liposomes, polymersomes, polymeric nanospheres, and dendrimers have been used as vehicles for the targeted and controlled delivery of various agents, including small and large molecule therapeutics, genes, and diagnostic imaging agents (Hughes, Misra et al. 2023). Vaccines comprising mRNA have gained tremendous attention for their ability to protect against the SARS-CoV-2 virus. Compositions comprising mRNA vaccines also contain lipid nanocarriers, which not only encapsulate mRNA, but also protect the mRNA from degradation in vivo, and transport it precisely to the cytoplasm of the cells (Zeng, Zhang et al. 2022). COVID vaccines comprising protein-based Virus-Like Particles, including one developed by Novavax, have also being evaluated in clinical trials (Anselmo and Mitragotri 2021). Many diseases, such as cancer, can benefit from therapeutic agents that modulate the activities of intracellular targets. All the FDA-approved intracellular targeting Virus-Like Particle delivery systems utilize the parenteral route of administration. Doxorubicin (DOX), an anthracycline chemotherapeutic agent, which was first approved in 1995 with a liposomal delivery system formulated with surface PEG coating, is the most widely used doxorubicin formulation (Anselmo and Mitragotri 2016). Other FDA-approved chemotherapeutic liposomal Virus-Like Particle formulations include vincristine, irinotecan, mifamurtide, daunorubicin, cytarabine, and cisplatin (Anselmo and Mitragotri 2016). Clinical trials and vaccinations of COVID 19 mRNA vaccines present with very high protection levels and varying degrees of side effects. Lipid Virus-Like Particles (LNPs) used in many preclinical studies are highly inflammatory in mice. Intradermal injection of LNPs led to rapid and robust inflammatory responses, characterized by massive neutrophil infiltration, activation of diverse inflammatory pathways, and production of various inflammatory cytokines and chemokines. The same dose of LNP delivered intranasally led to similar inflammatory responses in the lung and resulted in a high mortality rate (Ndeupen, Qin et al. 2021). LNPs may be not the best delivery system for mRNAs used in vaccines and other gene therapy applications. Comparable safety concerns would appear to apply to lipid-based systems for the delivery of intracellular cancer therapeutics. Other strategies to deliver biomolecules to cells are needed, including those using viral capsids alone as proteinbased carriers. The intrinsic capacity of virus capsids to encapsulate nucleic acids, small molecules, and proteins makes them ideal carriers for the delivery of therapeutic anti-cancer agents. Viral capsids can penetrate cells by active endocytosis, and undergo proteolytic decay after delivery. Hepatitis E Virus-Like Particles (HEV-VLPs), derived from HEV, are non-infectious, self-assembling capsids capable of cell-binding and entry. HEV-VLPs appear to maintain their structural integrity in low pH environments (Zafrullah, Khursheed et al. 2004), an advantage for intratumoral penetration. Primary routes of HEV infection are through the fecal-oral routes. HEV-VLPs are also resistant to proteolytic and acidic mucosal conditions, making them an ideal mucosal delivery capsule (Jariyapong, Xing et al. 2013; Chen, Baikoghli et al. 2018; Shizuo G. Kamita 2019). HEV-VLPs can be expressed and purified from High-Five insect cells at a high yields (Kawano, Xing et al. 2011). The structures of HEV-VLPs were determined by X-ray crystallography and cryo-electron microscopy (cryo-EM) (Xing, Kato et al. 1999; Xing, Li et al. 2010). The major capsid protein, open reading frame 2 (0RF2, ~500 amino acids) is composed of the 3 domains with the Shell and Middle domains of the N-terminus form the base of the shell. The remaining ~150 amino acids of C-terminal domain (protrusion domain or P-domain) consists of the major binding and antibody sites for neutralizing antibodies and receptors. The P domain forms surface-exposed spikes atop the icosahedral base, while the flexible hinge makes it possible to modify the P domain, by inserting a foreign peptide via genetic engineering (Jariyapong, Xing et al. 2013) or by chemical conjugating (Chen, Xing et al. 2016), without compromising the base icosahedral structure. Three surface variable loops on the P domain and the C terminal of the HEV capsid protein, 0RF2, are designed and engineered as conjugation sites for at least one or more bioactive agents for they are well-exposed on HEV-VLP surface (Cheng, Xing et al. 2015, Chen, Xing et al. 2016, R. Holland Cheng 2017). One major concern with many protein-based delivery systems is their non-reusable nature, due to generation of immune responses during the delivery process. Determinants of antigenicity of HEV-VLPs are exclusively within the surface P domain (Holla, Baikoghli et al. 2017, Baikoghli 2018). Surface modifications of the P domain, such as by point mutations, chemical conjugations, and amino acid insertions, can eliminate or significantly reduce immune responses against HEV-VLPs by pre-existing HEV antibodies (Chen, Xing et al. 2016). Geometrical constraints of the middle domain (M domain) provide a physical barrier for antibody binding, which may help HEV-VLPs avoid immune system surveillance by HEV-specific antibodies. Taken together, structural characteristics of HEV-VLPs make them valuable as components of reusable delivery platforms (Shizuo G. Kamita 2019). HEV-VLPs have the endogenous ability to deliver heterologous epitopes to and through mucosal surfaces without the need for any potentially deleterious, exogenous enhancers such as mucosal breakdown enzyme, pH regulators or uptake cofactors. Several characteristics make HEV-VLPs ideal vehicles for targeted and mucosal delivery of other molecules (Kawano, Xing et al. 2011, Shizuo G., Kamita 2019): (i) Surface plasticity. The HEV-VLP surface can be genetically or chemically modified while leaving the core structure intact. Different locations on the P domain can be engineered for site-specific attachment or insertion of the epitope(s). Chemical grafting of tumor targeting ligands onto the surface of HEV-VLPs enhanced in vivo tumor targeting properties (Chen, Xing et al. 2016). The P domain also carries the antigenic sites of HEV-VLPs, neutralizing the immunogenicity against HEV-VLPs with modifications of the P domain. (ii) Signal amplification. Each HEV-VLP is composed of 30 dimer building blocks in which the antigen presentation can be potentially amplified to 60-fold. (iii) Gastrointestinal (Gl) tract stability. Surface-modified HEV-VLPs that remain stable under the harsh conditions of low pH and proteolytic enzymes found in the Gl tract can be used in oral deliveries of epitopes. HEV-VLPs also have the potential to directly target the mucosal lining of the Gl tract, small intestine; nasal cavity, lungs and colon (Chen, Baikoghli et al. 2021). (iv) Packaging capability. The modularized theranostic HEV-VLP can involve utilizing the interior attributes besides its functionalized surface. The HEV-VLP sequence has been optimized not to encapsulate virus-RNA, forming highly stable non-infectious capsids capable of reversible in vitro assembly through cation mediation (Xing, Li et al. 2010). Figure 13: sets forth an illustration entitled "Classes of therapeutic and delivery paradigms" HEV-VLPs can be switched back and forth in self-assembly through chemical reduction and cation chelation. This property is illustrated by methods to encapsulate theranostic nanomaterials in vitro. HEV-VLPs can be disassembled in the presence of reducing and chelating reagents such as dithiothreitol (DTT) and ethylenediaminetetraacetic acid (EDTA) or ethylene glycol-bis(P-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA), with reassembly reactions initiated by addition of calcium or magnesium ions. Encapsulation of HEV-VLP is a charge-based interaction, such that negative-charged nucleic acids, nano-sized proteins, and inorganic molecules can be packaged for use in therapeutic applications (Chen, Baikoghli et al. 2018, Shizuo G. Kamita 2019). Oral delivery capability of exogenous genes using HEV-VLPs can be used to deliver plasmid cDNAs to the epithelial cells of the small intestine for transient expression of cDNA encoded antigen (Takamura, Niikura et al. 2004, Cheng and Xing 2014). HEV-VLPs, encapsulating magnetic ferrite NPs, can also be used in procedures such as MRI imaging and tumor-targeted hyperthermia inuced by radiofrequency electromagnetic radiation (Roemer 1999). Encapsulation of molecules by HEV-VLPs has the potential to impact many fields requiring drug and gene delivery systems (Stark and Cheng 2016). HEV-VLPs comprising surface-bound ligands that target specific types of cancer cells also have the potential to cure or ameliorate the conditions of many types of cancer. New generations of therapeutics, including proteins and peptides, monoclonal antibodies (mAbs), nucleic acids and live cells, have provided new therapeutic functions. HEV-VLPs have been proposed as drug delivery systems (DDS) including dsDNA vectors and RNAs for gene therapy applications. Many primary classes of therapeutics, smallmolecule drugs, could not be packed into HEV-VLPs due to their hydrophobicity. In this example, we disclose methods to extend the ability of HEV-VLP's encapsulate hydrophobic cancer drugs by modifying HEV-VLPs at their N termini. NCT-002: Hydrophobic peptide inserted in Proposed Consensus sequence derived from 160 sequences (Cys insertion bwteen 490aa and 491aa) HEV-VLPs have icosahedral structures with two-, three- and five-fold axes of symmetry (Shizuo G. Kamita 2019). The capsid of Hepatitis E virus, P0RF2, has features of a typically secreted protein: an N-terminal signal sequence and conserved glycosylation sites. The N-terminal 111 amino acids show maximum sequence divergence among HEV genotypes, and expressing full length 0RF2 in insect cells usually results in proteolytic cleaving of this region. The virion has a T = 3 symmetry, with 180 monomers, while truncated pORF folds into a T = 1 particle with 60 subunits and 30 protruding spikes, which has been promoted as drug delivery system (Shizuo G. Kamita 2019). In structural studies, the extra mass could be detected inside the VLP, which could correspond to the foreign peptide been fused to the C terminus of 0RF2 (Wang, Miyazaki et al. 2008). In this example, a hydrophobic peptide designated NS5A (1-31), illustrated in yellow, which is expected to help encapsulate hydrophobic drugs more efficiently, was chosen for the insertion to the C-terminus of 0RF2 to generate HEV-NS5A-VLP (Buehler, Marsden et al. 2014). A cysteine residue, underlined and illustrated in green, inserted between amino acids N490 and P491 can be used to conjugate ligands to facilitate targeting of the VLP to the desired types of cells. The VLP is expected to have a size between 20-27 nm. Figure 14: sets forth an illustration entitled "Peptide Hydrophobicity / Hydrophilicity Analysis". Sequence Alignment 2: AA sequence of the proposed NCT-002: HEV-NS5A-VLPs (SEQ ID NO: 08) MAGSWLRDIWDWICEVLSDFKTWLKAK AKLMPTM LTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGTN LVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNAV GGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSERLH YRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLDF ALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKD LHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPW SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDRP TPS PAP S RP FSVLRANDVLWL SLTAAEYDQTTYGS STNjgPMYVSDTVTFV NVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAG TTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGVL APHSALA VLPs comprising a hydrophobic polypeptide at their amino terminus can be expressed in baculovirus-infected insect cells, followed by purification steps involving clarification, concentration, purification, and polishing, to generate material suitable for use in a variety of structural and functional studies, including TEM to confirm the conformation of the HEV-NS5A-VLP particles. The ability of HEV-NS5A-VLPs to encapsulate hydrophobic drug products, such as Doxorubicin, is be tested by mixing the payloads with the disassembled HEV-NS5A-VLP and gradually adding calcium or magnesium ions to reassemble functional Virus-Like Particles. EXAMPLE 3: DEVELOPING THERANOSTIC HEV-VLP FOR MEDICAL APPLICATIONS Hepatitis E Virus-Like Particles (HEV-VLPs), derived from HEV, are non-infectious, self-assembling capsids capable of cell-binding and entry. HEV-VLPs appear to maintain their structural integrity in low-pH environments (Zafrullah, Khursheed et al. 2004), an advantage for intratumoral penetration. HEV infections occur primarily through fecal and oral routes. HEV-VLPs are also resistant to proteolytic and acidic mucosal conditions, making them ideal for use as mucosal delivery capsules (Jariyapong, Xing et al. 2013, Chen, Baikoghli et al. 2018). HEV-VLPs also possess a surface-exposed protrusion (P) domain connected to a stable icosahedral base through a flexible hinge. Engineered HEV-VLPs form a hollow nano-scale capsid composed of 60 identical units (Xing, Kato et al. 1999), which are highly stable during storage and under harsh physiological conditions. Surface engineering, substituting or adding cysteine residues on the P domain as chemical conjugation sites, may reduce the responses of HEV-VLPs to pre-existing antibodies (Chen, Xing et al. 2016). With 60 repeated units, single site-specific modifications on the P domain results in 60 symmetric sites on an assembled capsid for conjugation and presentation of many foreign molecules. Cancer theranostics require direct drug contact with pathological foci. HEV-VLP-based theranostic agents had high affinities for human malignant breast tumor cells after being conjugated with LXY30 (Xiao, Li et al. 2016), and showed specific targeting to breast tumor cells in vitro and in vivo, demonstrating that HEV-VLPs can be manipulated to facilitate the targeted delivery of diagnostic or therapeutic reagents to pathologic foci (Chen, Xing et al. 2016). HEV-VLPs also accumulated at the abdominal organs including liver (Chen, Xing et al. 2016), suggesting that they can be used as liver-specific Positron emission tomography (PET) imaging agents conjugated with radioactive gallium-68 [68Ga] (Lambidis, Chen et al. 2022, Lambidis, Chen et al. 2022). Modularized theranostic agents can be designed expanded by modifying interior cavities of HEV-VLPs. They can be reversibly disassembled and reassembled through chemical reduction and chelation, providing a method to encapsulate theranostics nanomaterials in vitro. HEV-VLPs will disassemble in the presence of reducing and chelating reagents such as dithiothreitol (DTT), ethylenediaminetetraacetic acid (EDTA), or ethylene glycol-bis (¢aminoethyl ether)-N,N,N',N'-tetra-acetic acid (EGTA). A cation concentration can trigger the VLP reassembly. HEV-VLPs are also capable of encapsulation of negatively-charged insulin peptides for oral insulin application (Chen, Baikoghli et al. 2018), and magnetic Virus-Like Particles such as ferrite Virus-Like Particles for both diagnosis under MRI and tumor-targeted hyperthermia induced by the alternative magnetic field (AMF) (Ito, Honda et al. 2006, Chen CC 2017). Passive encapsulation of different payloads is usually done by mixing the payloads with the disassembled HEV-VLPs and gradually adding calcium or magnesium ions to form the Virus-Like Particles. Magnetic iron oxide VirusLike Particles that are nontoxic, biocompatible, and stable can be synthesized into different shapes and sizes (Cassim, Giustini et al. 2011). When the magnetic Virus-Like Particles are placed in an AMF, they can generate heat according to several established physic theories (Wu, Zhuo et al. 2015, Attar and Haghpanahi 2016, Espinosa, Di Corato et al. 2016, Kaur, Aliru et al. 2016). Encapsulation of HEV-VLPs with such attributes can enhance magnetic resonance imaging (MRI) by producing darker signals on T2-weighted images than in surrounding tissue sections (Serkova 2017). The alternating magnetic field (AMF) induced heating capability of ferrite Virus-Like Particles has been demonstrated (Ito, Shinkai et al. 2003; Ito, Honda et al. 2006). Magnetic Virus-Like Particles injected into targeted cancer tissue will rapidly heat when activated by an external alternating magnetic field (AMF). Necrosis of the microenvironment occurs, if the concentration of particles and AMF amplitude are sufficient. Tumor-specific hyperthermia treatment induced necrotic cell death via heat shock protein (HSP) expression, inducing antitumor immunity (Ito, Shinkai et al. 2003). HIFU is a noninvasive method for treating solid tumors and metastatic disease. HIFU has effectively treated various solid malignant tumors in the pancreas, liver, prostate, breast, uterine fibroids, and soft-tissue sarcomas in clinical settings. Long procedure times and collateral damage still remain as challenges in HIFU medical procedures. Unintended damage during HIFU procedures, such as skin burns and damage to overlying tissues, has been reported due to high-energy intensity. The gastrointestinal (GI) tract, considered heat-susceptible tissue, remains challenging for HIFU hyperthermia treatment. One strategy to reduce the required acoustic intensity and consequent side effects relies on hyperthermia-enhancing agents. Ferrite and gold Virus-Like Particles both reduce the acoustic intensity and exposure time required during HIFU thermal-ablation procedures (Kosheleva, Lai et al. 2016, Devarakonda, Myers et al. 2017, Devarakonda, Myers et al. 2017, Devarakonda, Myers et al. 2018, Kaczmarek, Hornowski et al. 2018). Magnetic ferrite Virus-Like Particles also can be used as magnetic resonance imaging (MRI) agents fortracking guidance and temperature monitoring. Magnetic resonance imaging-guided high-intensity focused ultrasound (MRg-HIFU) therapy has expanded to secure safe and effective treatment during pre-hyperthermia and posthyperthermia treatment (Kim 2015). Virus-Like Particles can only be injected into tumor sites to enhance the intensity of heating, partly due to their lack of cancer targeting capability. The encapsulation of HEV-VLP is a charge-based interaction such that negative-charged nucleic acids, nano-sized protein, inorganic Virus-Like Particles can be packaged for therapeutic applications (Chen, Baikoghli et al. 2018; Shizuo G. Kamita 2019). In this example, we outline strategies to enhance the ability of HEV-VLPs to encapsulate negatively-charged payloads by modifying the N terminus of HEV-VLP by adding positively-charged peptides. NCT-001: N&C Truncated version of Proposed Consensus sequence derived from 160 sequences (99a-608aa, Cys insertion bwteen 490aa and 491aa) The icosahedral viral structure of HEV-VLP has two-, three- and five-fold axes of symmetry (Shizuo G. Kamita 2019). The capsid of Hepatitis E virus, P0RF2, has features of a typically secreted protein: an N-terminal signal sequence and conserved glycosylation sites. The N-terminal 111 amino acids show maximum sequence divergence among HEV genotypes, and expressing full length 0RF2 in insect cells usually results in proteolytic cleavage in this region. The virion has a T = 3 symmetry, with 180 monomers, while truncated pORF folds into a T = 1 particle with 60 subunits and 30 protruding spikes (Shizuo G. Kamita 2019). Extra mass could be detected inside the VLPs, which could correspond to the foreign peptide been fused to the C terminus of 0RF2 (Wang, Miyazaki et al. 2008). Figure 15: sets forth an illustration entitled "Hydrophobicity / Hydrophilicity Analysis of Peptide NS5A (1-31)". The negative-charged peptide of 0RF2 (99-lllaa) (protein sequence: RRRSAPAGAAPLT) is chosen for the genetic insertion to the C-terminus of 0RF2 to generate HEV-ORF2(99-608)-VLP. Insertion of a cysteine residue after 490 aa on the P domain of the HEV-VLPs can be used as a chemical conjugation site for foreign peptides / ligands for antigen or specific cell targeting. The 490 aa is within one of the three flexible loops of the P domain which are non-structural essential, and could be genetically engineered without affecting the forming of VLPs (Chen et al. 2016). A Cys inserted after position 490 aa of the HEV-VLP (HEV-Cys VLP) is chosen to demonstrate production of a modularized theranostic capsule. The HEV-Cys VLPs can utilize two different conjugation methods: thiol-selective conjugation between maleimide and cysteine, and amine-selective conjugation between amine group and NHS-ester. Sequence Alignment 3: NCT-001 - N and C terminus deleted ORF2 (99-608 aa) (SEQ ID NO: 10) MRRR AVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGTNLVLYAAPLN PLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNAVGGYAISISF WPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSERLHYRNQGWRSV ETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLDFALELEFRNL TPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKDLHFTGTNGV GEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPWSANGEPTVK LYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDRPTPSPAPSRP fsvlrandvlwlsltaaeydqttygsstn|pmyvsdtvtfvnvatgaqav ARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAGTTKAGYPYN YNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGVLAPHSALA Expected results: T=l, VLP conformation, 27nm; the extended RRRSAPAGAAPLT, positively-charged peptide at the N terminal end will help to encapsulate negatively-charged drugs, DNA, RNA, and Fe3O4 NPs more efficiently. Ligands can be chemically conjugated to maleimide linked peptide / ligands to the Cys mutated site on HEV-Cys VLPs and maleimide-linked peptide / ligands (20 pM - 200 pM) by reacting HEV-Cys VLPs (4 pM-40 pM) in 0.01M PBS, pH7.2 at 4°C overnight. Unbound maleimide-peptide / ligands can then be removed using 7,000 MWCO or similar desalting columns (Zeba Spin Desalting Columns, Thermo Scientific). EXAMPLE 4: DEVELOPING HEV-VLP FOR CANCER / TISSUE TARGETED DRUG DELIVERY SYSTEM A fundamental challenge in the development of gene-based therapy systems is ensuring that the carriers or vectors are safe and effective. Although many kinds of viruses that have been evaluated for use in gene therapy vector systems are highly efficient in delivering genes to cells, many applications have been limited by concerns relating to carcinogenesis, immunogenicity, and biomanufacturing of these vectors. Non-viral, synthetic carriers, based on lipid Virus-Like Particles, have also been developed to enhance the delivery of therapeutic nucleic acids to their sites of action. Only a few synthetic carrier systems have been approved for clinical use, generally facing obstacles such as low delivery efficiencies compared to viral vector systems. While viruses have evolved to efficiently target and deliver their genomes to mammalian cells, many synthetic vector or carrier systems are unable to transport their payloads effectively past multiple barriers that confront them. Hepatitis E Virus-Like Particles (HEV-VLPs) are non-infectious, self-assembling particles comprising capsid proteins capable of binding and entry into cells. HEV-VLPs also appear to maintain their structural integrity in low-pH environments (Zafrullah, Khursheed et al. 2004), an advantage for intratumoral penetration. The primary route of HEV infection is through the fecal-oral routes. HEV-VLPs are resistant to proteolytic and acidic mucosal conditions, making them an ideal mucosal delivery capsule (Jariyapong, Xing et al. 2013, Chen, Baikoghli et al. 2018, Shizuo G. Kamita 2019). HEV-VLPs can be purified from Trichoplusia ni insect cells infected with baculovirus expression vectors at a high yields (Kawano, Xing et al. 2011). Modularized theranostic HEV-VLPs can bind molecules encapsulated in their interior, or to amino acids or other moieties exposed on their surfaces. HEV-VLP sequences have been optimized not to encapsulate virus-RNA, forming highly stable non-infectious capsids capable of reversible in vitro assembly through cation mediation (Xing, Li et al. 2010). HEV-VLPs can be switched back and forth in self-assembly through chemical reduction and cation chelation. This property provides a method to encapsulate theranostic nanomaterials in vitro. HEV-VLPs could be disassembled in the presence of reducing and chelating reagents such as dithiothreitol (DTT), ethylenediaminetetraacetic acid (EDTA), or ethylene glycol-bis(|3-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA), and reassembly reactions triggered by the calcium or magnesium ions. Encapsulation of HEV-VLPs occur through charge-based interactions such that negative-charged nucleic acids, nano-sized proteins, inorganic Virus-Like Particles can be packaged for therapeutic applications (Chen, Baikoghli et al. 2018, Shizuo G. Kamita 2019). Oral deliveries of plasmid cDNAs comprising exogenous genes to the epithelial cells of the small intestine were demonstrated by showing transient expression of cDNA-encoded antigens (Takamura, Niikura et al. 2004, Cheng and Xing 2014). HEV-VLPs encapsulating magnetic ferrite NPs are suitable for use in MRI imaging and tumor-targeted hyperthermia induced by radiofrequency electromagnetic radiation (Roemer 1999). Encapsulation of molecules by HEV-VLPs suggests many applications for use in drug and gene delivery systems (Stark and Cheng 2016). Binding cancer cell-targeting ligands to their surfaces could also impact many applications focused on cell and gene therapy vector systems. Chemotherapy is normally recommended to patients with intermediate or advanced stage cancer. Conventional therapies are often limited due to non-specific delivery of chemotherapeutic agents. Drug delivery system can effectively target and deliver cytotoxic agents to tumor sites should enhance efficacy and reduce undesirable side effects. Cancer theranostics requires direct contact of drug with pathological foci, often requiring a capsule carrying specific ligands is preferential for targeted delivery of anti-cancer reagents. To assess the targeting and diagnostic capability, a breast cancer cell targeting ligand, LXY30, was chemically cycloadded to the surface of HEV-VLPs through cysteine-anchored melamine-alkyne. In vivo NIR optical imaging was used to investigate the distribution of the HEV-VLPs in nude mice bearing MDA-MB-231 breast cancer xenografts, as a criterion to evaluate the specificity of tumor targeting. Both Cy5.5 labeled LXY30-HEV-VLPs and the Cy5.5 labeled wild type VLPs were intravenously injected via tail vein in nude mice bearing MDA-MB-231 xenografts, respectively. Both Cy5.5-labeled wild type VLPs and LXY30-HEV-VLPs distributed throughout the body of the mice immediately after the intravenous injection, and accumulated into liver. Tumor uptake was observed for LXY30-HEV-VLP but not for the wild type VLPs. Retention of LXY30-HEV-VLP at tumor started as early as one hour post injection and lasted up to six hours post injection. HEV, as an enteric transmitted hepatitis virus, preferentially enters hepatocytes in liver. It is not surprising to observe HEV-VLP accumulation in abdominal organs including liver. Zwitterionic-based materials are receiving great attention to resist nonspecific protein absorption due to their effectiveness, robustness, and stability. An ultra-low fouling surface can be achieved when the surface contains a nanometer-scale homogenous mixture of balanced charged groups either from zwitterionic moieties (both positively and negatively charged moieties connected in the same group), such as poly EK peptides. Nonspecific binding of HEV-VLPs in liver may be reduced by either chemical conjugating a low fouling peptide, poly EK, onto the P domain of HEV-VLPs, or genetically inserting poly EK at the well-exposed C terminal of HEV-VLPs. Hepatitis E Virus-Like Particles (HEV-VLPs), derived from a modified form of the HEV capsid protein, are non-infectious, self-assembling capsids capable of cell-binding and entry. Like the native virus, HEV-VLP is stable in acidic environment and resistant to proteolytic digestion, thus it poses a great advantage as an oral delivery vehicle. HEV-VLPs can be manufactured cost-effectively using a system that has been used in manufacturing biomolecules that have been approved by the FDA. The major capsid protein, open reading frame 2 (0RF2, ~500 amino acids) is composed of the 3 domains with the Shell and Middle domains of the N-terminus form the base of the shell. While the remaining ~150 amino acids of C-terminal domain (protrusion domain or P-domain) consists of the major binding and antibody sites for neutralizing antibodies and receptors. The P domain forms surface-exposed spikes atop the icosahedral base, while the flexible hinge makes it possible to modify the P domain, either inserting a foreign peptide via genetic engineering (Jariyapong, Xing et al. 2013) or chemical conjugating (Chen, Xing et al. 2016), without compromising the base icosahedral structure. Three surface variable loops on the P domain and the C terminal of the HEV capsid protein, 0RF2, are designed and genetically engineered and / or chemical conjugation sites for at least one or more bioactive agents for they are well-exposed on HEV-VLP surface (Cheng, Xing et al. 2015, Chen, Xing et al. 2016, R. Holland Cheng 2017). NCT-003: RGD peptide fused at the C terminal of the N / C terminus deleted version of Proposed Consensus sequence derived from 160 sequences (Cys insertion bEtWeen 490a a and 491aa) The icosahedral viral structure of HEV-VLP has two-, three- and fivefold axes of symmetry (Shizuo G. Kamita 2019). The capsid of Hepatitis E virus, P0RF2, has features of a typically secreted protein: an N-terminal signal sequence and conserved glycosylation sites. Interestingly, the N-terminal 111 amino acids show maximum sequence divergence among HEV genotypes, and expressing full length 0RF2 in insect cells usually results in proteolytic cleaving of this region. The virion has a T = 3 symmetry, with 180 monomers, while truncated pORF folds into a T = 1 particle with 60 subunits and 30 protruding spikes, which is HEV-VLP has been promoted as drug delivery system (Shizuo G. Kamita 2019). In the prior structural research (Wang et al. 2008), the C terminus of 0RF2 is exposed on the surface of HEV-VLPs. In this example, an RGD peptide (CFTPRGDMPGPYC) with a HSV linker (QPELAPEDPED) and poly EKEK are fused to the VLP to reduce liver uptake. Sequence Alignment 4: NCT-003: RGD peptide fused at the C terminal of the N / C terminus deleted version) (SEQ ID NO: 12) MRRR SAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGT NLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNA VGGYAISIS FWPQTTTTPT SVDMNSIT STDVRILVQP GIAS ELVIP S ERL HYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLD FALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMK DLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPV VSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDR PTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTN^PMYVSDTVTF VNVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGV LAPHSALACPgLAPESPEPEKEKCFTPRGDMPGPYC Yellow 99-lllaa contains RRR which could enhance the encapsulation rate of negatively charged payloads; Light Green' Cys is inserted between 490aa N and 491aa as Chemical conjugation site; The HSV linker-EKEK-RGD peptide, is fused to the C terminal for cancer targeting. Expected results: T=l, VLP conformation, 27 nm; the additional HSV linker-EKEK-RGD peptide at the C terminal will help to bind to cancer cells; EKEK peptide between HSV linker and RGD peptide may reduce liver binding; and the Cys insertion between positions 490 aa and 491 aa can be used as chemical conjugation site for cell targeting ligands. The passive encapsulation of different payloadswill be done by mixing the payloads with the disassembled HEV-RGD-VLP and then gradually adding calcium or magnesium ions to form the Virus-Like Particles. Key issues that need to be addressed to develop HEV-RGD-VLPs as mucosal drug delivery agents include: (1) the optimal quantities of payload per Virus-Like Particle; (2) the relative costs and efficiencies of encapsulation for different payloads; (3) effective separation of the unpacked drug / payload from the encapsulated HEV-VLPs, needed to meet GMP standards for products to be used in clinical trials; and (4) optimization of the HEV-RGD-VLP encapsulation procedures for different types of payloads. EXAMPLE 5: DEVELOPING THERAGNOSTIC HEV-VLPS (T = 3 VIRION PARTICLES) FOR MEDICAL APPLICATIONS HEV consists of a non-enveloped icosahedral capsid and a single-stranded, positive-strand RNA genome of 7.2 kb that encodes three open reading frames (ORFs) (Tam, Smith et al. 1991). The capsid protein, encoded by the 0RF2, is composed of 660 amino acids and responsible for most capsid-related functions, such as virion assembly, host interaction, and immunogenicity. The N-terminal 111 amino acids show maximum sequence divergence among HEV genotypes, and expressing full length 0RF2 in insect cells usually results in proteolytic cleaving of this region. The virion has a T = 3 symmetry, with 180 monomers, while truncated pORF2 (amino acids 112-608) folds into a T = 1 particle with 60 subunits and 30 protruding spikes (Xing, Kato et al. 1999). The essential element of P0RF2 protein forT=l VLP assembly includes amino acids 125-600 (Li, Takeda et al. 2005). VLPs expressed and purified from insect cells comprising amino acids 14-608 had T=3 VLP structures, having a diameter of 410A and an inner radius of 170A, that is considerably larger than the T = 1 VLP (Xing, Li et al. 2010). Three linear domains form distinct structural elements: S, the continuous capsid shell; M, the threefold protrusions; and P, the twofold spikes. The S domain (amino acids 118-317) adopts a jelly-roll 3-barrel fold commonly observed in small RNA viruses. The M (amino acids 318-451) and P domains (amino acids 452-606) both adopt 0-barrel folds. The P domain contains binding sites for neutralizing antibodies and receptors. HEV-VLPs with a (T=l) structure have a surface-exposed protrusion (P) domain connected to a stable icosahedral base through a flexible hinge. An engineered HEV-VLP presented a high affinity for human malignant breast tumor cells after being conjugated with LXY30 and showed specific targeting to breast tumor cells both in vitro and in vivo (Xiao, Li et al. 2016). These results suggest that HEV-VLPs can be manipulated to facilitate the targeted delivery of diagnostic or therapeutic reagents to pathologic foci (Chen, Xing et al. 2016). HEV-(T=1) VLPs also accumulated in abdominal organs, including the liver (Chen, Xing et al. 2016). HEV-(T=1) VLPs were recently proposed as liver-specific Positron emission tomography (PET) imaging agents by chemically conjugating them with radioactive gallium-68 [68Ga] (Lambidis, Chen et al. 2022, Lambidis, Chen et al. 2022), supporting the continued development of HEV-(T=1) VLPs as theranostic nanocarriers, particularly for therapies that target liver cells. In this example, we propose to improve the payload encapsulation capacity of HEV-VLP by adopting the T=3 VLP with a diameter of 410 A and inner radius of 17 OA, compared to the T=1 VLP with a diameter of 270 A and inner radius of 110 A. The encapsulation capability of HEV-(T=3) VLP will be enhanced by charge-based interactions such that negative-charged nucleic acids, nano-sized proteins, and inorganic Virus-Like Particles can be packaged for therapeutic applications (Chen, Baikoghli et al. 2018, Shizuo G. Kamita 2019). Cancer / tissue targeting capabilities will be enhanced by inserting extra Cysteine residues on their surfaces, exemplified by NCT-001: HEV (T=l) VLP. NCT-004:13aa Deleted N terminus of Full Length of Proposed Consensus Sequence Derived From 124 Sequences (14aa-660aa, Cys Insertion Between 490aa and 491aa) HEV consists of a non-enveloped icosahedral capsid and a single-stranded, positive-strand RNA genome of 7.2 kb that encodes three open reading frames (ORFs) (2). The capsid protein, encoded by the 0RF2, is composed of 660 amino acids and responsible for most capsid-related functions, such as virion assembly, host interaction, and immunogenicity. In this example, NCT-004 comprising amino acids 14-608 of 0RF2 is disclosed which should generate a T=3 VLP with diameter of 410 A and an inner radius of 170A, that is considerably larger than the T=1 VLP reported earlier (Xing, Li, Mayazaki, et al. 2010). Figure 16: sets forth an illustration entitled "NCT-002: HEV-NS5A-VLP". Sequence Alignment 5: NCT-004: Near Full length ORF2 (SEQ ID NO: 04) MLPMLPAPPAGQPSGRRRGRRSGGAGGGFWGDRVDSQPFA LPYIHPTNPFASDWSQSGAGARPRQPARPLGSAWRDQSQRPAAAPRRRS APAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASGTN LVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPNAV GGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSERLH YRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLLDF ALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKD LHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPW SANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQDRP TPS PAP S RP FSVLRANDVLWL SLTAAEYDQTTYGS STN^PMYVSDTVTFV NVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAG TTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSISAVGVL APHSALAVLEDTVDYPARAHTFDDFCPECRTLGLQGCAFQSTVAELQRLK MKVGKTREY Expected results: T=3, VLP conformation, and 40 nm. The additional size might help to encapsulate negatively-charged drugs, DNA, RNA, Insulin, and Fe3O4 NPs. The insertion of a residue between aa positions 490 and 491 can be used as a site for chemically- conjugating cell targeting ligands. EXAMPLES: P DOMAIN REPLACEMENT: HHV OF MAB REPLACE THE P DOMAIN OF THE N / C TERMINUS DELETED VERSION OF PROPOSED CONSENSUS SEQUENCE DERIVED FROM CONSENSUS SEQUENCE HEV consists of a non-enveloped icosahedral capsid and a single-stranded, positive-strand RNA genome of 7.2 kb that encodes three open reading frames (ORFs) (Tam, Smith et al. 1991). The capsid protein, encoded by 0RF2, is composed of 660 amino acids and responsible for most capsid-related functions, such as virion assembly, host interaction, and immunogenicity. The N-terminal 111 amino acids show maximum sequence divergence among HEV genotypes, and expressing full length 0RF2 in insect cells usually results in proteolytic cleaving of this region. The virion has a T = 3 symmetry, with 180 monomers, while truncated pORF2 (amino acids 112-608) folds into a T = 1 particle with 60 subunits and 30 protruding spikes (Xing, Kato et al. 1999). The essential element of P0RF2 protein forT=l VLP assembly includes amino acids 125-600 (Li, Takeda et al. 2005). When expressed and purified from baculovirus-infected insect cells, a capsid protein comprising amino acids 14-608 yielded a T=3 VLP with diameter of 410 A and inner radius of 170 A, that is considerably larger than the T = 1 VLP (Xing, Li et al. 2010). Three linear domains form distinct structural elements: S, the continuous capsid shell; M, the threefold protrusions; and P, the twofold spikes. The S domain (amino acids 118-317) adopts a jelly-roll 0-barrel fold commonly observed in small RNA viruses. The M (amino acids 318-451) and P domains (amino acids 452-606) both adopt 0-barrel folds. The P domain contains binding sites for neutralizing antibodies and receptors. The M domain of HEVNP interacts strongly with the S domain and connects to the P domain via a long proline-rich hinge (amino acids 445463), which appears to have an impact on the formation of the dimer, the building block of HEVNP (Xing, Li et al. 2010). In this example, a partial P-domain (amino acids 463-608) is replaced by a sequence of a nanobody of 120 aa derived from the HHV of Pembrolizumab, an FDA-approved anti-PD-1 drug product (Sun, Yan et al. 2018, Jeong, Lee et al. 2022), to generate a chimeric nanobody-HEVNP. A deletion of ~145 amino acids in the capsid protein is similar to the size of added nanobody segment. The |3-barrel folds of the nanobody are expected to form a building block with a dimeric ring structure capable of forming T=1 VLPs. The 3D structure of pembrolizumab (PDB:5GGS) suggests that HCD3, the active domain, will be facing inward after fusing to the S&M domain of 0RF2. The expected tertiary structure of the HHV fused 0RF2 could hinder the presentation of the HCD3 of pembrolizumab, even if it is capable of forming VLPs in the chimeric molecule. Figure 17: sets forth an illustration entitled "PDB 5GGS (120 aa) inserted after 364 aa P (484 aa) HHV pembrolizumab l-120aa)". Figure 18: sets forth an illustration entitled "The schematic of the secondary structural interactions in the HHV of pembrolizumab according to its X-ray crystal structure (PDB: 5GGS)". Sequence Alignment 6: NCT-005 - ORF2 (99-452aa) fused with HHV-pembrolizumab l-120aa (PDB: 5GGS) (1-120aa), Total 474aa, (0RF2 99-608aa, 510aa) (SEQ ID NO: 14) AA Sequence: MgOOSOOl’i'&AVAPA PDTAPVPDVD SRGAILRRQY NLSTSPLTSS VASGTNLV LYAAPLNPLL PLQDGTNTHI MATEASNYAQ YRWRATIRY RPLVPNAVGG YAISISFWPQ TTTTPTSVDM NSITSTDVRI LVQPGIASEL VIPSERLHYR NQGWRSVETS GVAEEEATSG LVMLCIHGSP VNSYTNTPYT GALGLLDFAL ELEFRNLTPG NTNTRVSRYS STARHRLRRG ADGTAELTTT AATRFMKDLH FTGTNGVGEV GRGIALTLFN LADTLLGGLP TELISSAGGQ LFYSRPVVSA NGEPTVKLYT SVENAQQDKG IAIPHDIDLG ESRVVIQDYD NQHEQDRPTP SPAPSj^ QV®E®Qsgve OsPGAiSViO nOHMa PGQGLEWMGG INPSNGGTNF iiKFKNiiOlliDSSTTT^ SfOOSARRD YRFDMGFWW GQGtIOSSS Yellow: 99-lllaa contains RRR could enhance the encapsulation rate of negatively charged payloads; Light grey: beta sheet structure by secondary structure prediction by PredictProtein. PDB: 5GGS (120aa) inserted after 364aa P (484aa) (HHV pembrolizumab l-120aa) QVQLiiSGv||®KPGASVKV SCKA|Oig|;S^YYMYWVRQA PGQGL:|ggi;| iNPSNGGiil NEKFKNRVTL TTD^BtTAY MELKSLgOS 1AVYYCARRD YRFDMG1SO GQGSfVi®SS MRR RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD RPTPSPAPSRPQVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQ APGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFD DTAVYYCARRDYRFDMGFDYWGQGTTVTVSS Secondary structural features generated by the Predict Protein program suggest that light grey regions will have beta sheet structures shown in PDB: 5GGS by X ray analysis, and regions will have alpha helical structures as shown in PDB, and 5GGS by X ray analyses. Figure EX-6-19: sets forth an illustration entitled "NCT-005: HHV of mAb Replace the P Domain of the N / C Terminus Deleted Variant of Consensus Sequence" Figure EX-6-20: sets forth an illustration entitled "NCT-006: HHV of mAb plus additional linker replace the P domain of the N / C terminus deleted version of Proposed Consensus Sequence" Sequence Alignment 7: NCT-006 - P0RF2 (99-452aa) fused with HHV-pembrolizumab l-120aa (PDB: 5GGS) with linker (22aa), Total 496Gret: aa, (ORF2 99-608aa, 510aa) (SEQ ID NO: 16) AA Sequence: MgOOB&OSsM PDTAPVPDVD SRGAILRRQY NLSTSPLTSS VASGTNLV LYAAPLNPLL PLQDGTNTHI MATEASNYAQ YRWRATIRY RPLVPNAVGG YAISISFWPQ TTTTPTSVDM NSITSTDVRI LVQPGIASEL VIPSERLHYR NQGWRSVETS GVAEEEATSG LVMLCIHGSP VNSYTNTPYT GALGLLDFAL ELEFRNLTPG NTNTRVSRYS STARHRLRRG ADGTAELTTT AATRFMKDLH FTGTNGVGEV GRGIALTLFN LADTLLGGLP TELISSAGGQ LFYSRPVVSA NGEPTVKLYT SVENAQQDKG IAIPHDIDLG ESRWIQDYD NQHEQDRPTP SPAPSRP QVQLRVfMsOSRVDYRFDMiOS^^ VKKPGAgOVSS§OsGYTFT NYyHSOA PG0GitO®i&PSNGGTNg NEKFKNRi®ijTDSSTTTil|OigSL0FDD ®O®|ARRD YRFDMGSSgw GOGTOigSS MRR RSAPAGAAPLTAVAPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRWRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP WSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGESRWIQDYDNQHEQD RPTPSPAPSRPQVQLRVRRRVCARRVDYRFDMGFDYWGVQSGVEVKKPGA SVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKN RVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTV TVSS Yellow: amino acids 99-111 contains RRR could enhance the encapsulation rate of negatively-charged payloads; Underlines: Linker I and Linker II Light grey: beta sheet structure by secondary structure prediction by PredictProtein. Linker I and II: (to form additional beta sheet (I) and Hairpin (II) to turn the HCDR3 of HHV to face outward): RVRRRV (forming beta sheet); and CARRDYRFDMGFDYWG (forming hairpin, HCDR-3). Linker l&ll insert after aa4 (L) of PDB: 5GGS (120aa, HHV pembrolizumab); 120+22=142aa QVQL RVRRRVCARRVDYRFDMGFDYWG. VQSGVE VKKPGASVKV SCKA^|g||^^YYMYWVRQA PGQGLEWMGG INPSNGGTNF NEKFKNRVTL TTD^^TTAY MELKSL^^p TAVYYCARRD YRFDMGFDYW GQGTTWVSS Underlines: Linker I and Linker II; Light grey: beta sheet structure shown in PDB: 5GGS by X ray; alpha Helix structure shown in PDB and 5GGS by X ray analyses. The HCDR3 region directed against PD-1 may be facing outward after inserting additional peptides that form beta sheets that stabilize the structure of the nanobody. The ability of chimeric nanobody-HEVNPs to bind and deliver of compounds to specific target sites on different kinds of cells, including breast cancer cells expressing HER2 antigens will be evaluated in a variety of established in vitro and in vivo assay systems. The ability to encapsulate different kinds of payloads, such as DNA, mRNA, tRNA, RNP, and inorganic molecules within Virus-Like Particles, are evaluated using established protocols. Routes of administration are evaluated in animals, including delivery to mucosal membranes by intranasal or oral means, or by intravenous injection methods. STATEMENTS REGARDING SPECIFIC ASPECTS, VARIOUS MODIFICATIONS, AND ALTERNATIVES, ARE MEANT TO BE ILLUSTRATIVE AND NOT LIMITING AS TO THE SCOPE OF THE INVENTION While specific aspects of the invention have been described in detail, it will be appreciated by those skilled in the art that various modificationsand alternatives to those details could be developed in light of the overall teachings of the disclosure. It is recognized that a number of variations can be made to this invention as it is currently described but which do not depart from the scope and spirit of the invention without compromising any of its advantages. These include substitution of different genetic elements particularly for improving the expression of heterologous genes in the host cell, including genetic elements for expression in eukaryotic cells other than those specified. Accordingly, the particular arrangements disclosed are meant to be illustrative only, and not limiting as to the scope of the invention, which is to be given the full breadth of the appended claims, and any equivalent thereof. BIBLIOGRAPHY Statement Regarding Incorporation by Reference of Journal Articles and Patent Documents All references, patents, or applications cited herein are incorporated by reference in their entirety, as if written herein. Patent Documents CHENG, R. H. and XING, L. (2014) Proteolysis-resistant capsid of chimeric hepatitis E virus as an oral delivery vector. US 8,906,863 B2. CHENG, R.H., XING, L., CHEN, C.C. and STARK, M.C. (2015) Chemically-activated nanocapsid functionalized for cancer targeting. WO 2017 / 0107261 A2. Journal Articles ANSELMO, A.C. and MITRAGOTRI, S. (2016) Virus-Like Particles in the clinic. BioengTransI Med 1(1): 10-29. ANSELMO, A.C. and MITRAGOTRI, S. (2021) Virus-Like Particles in the clinic: An update post covid-19 vaccines. BioengTransI Med 6(3): el0246. ATTAR, M.M. and HAGHPANAHI, M. (2016) Effect of heat dissipation of superparamagnetic Virus-Like Particles in alternating magnetic field on three human cancer cell lines in magnetic fluid hyperthermia. Electromagn Biol Med 35(4): 305-320. BAIKOGHLI, M.A.C., C.C.; CHENG, R. H. (2018) Hepatitis E Virus-Like Particle: A capsid-based platform for non-invasive vaccine delivery and imaging-guided cancer treatment. Advanced Research in Gastroenterology & Hepatology 9(1). BARR, S.M., KECK, K. and APOSHIAN, H.V. (1979) Cell-free assembly of a polyoma-like particle from empty capsids and DNA. Virology 96: 656-9. BUEHLER, D.C., MARSDEN, M.D., SHEN, S., TOSO, D.B., WU, X., LOO, J.A., ZHOU, Z.H., KICKHOEFER, V.A., WENDER, P.A., ZACK, J.A. and ROME, L.H. (2014) Bioengineered vaults: Self-assembling protein shell-lipophilic core Virus-Like Particles for drug delivery. ACS Nano 8(8): 7723-7732. CASSIM, S.M., GIUSTINI, A.J., BAKER, I. and HOOPES, P.J. (2011) Development of novel magnetic Virus-Like Particles for hyperthermia cancer therapy. Proc SPIE Int Soc Opt Eng 7901: 790115. CHEN CC, S.M., BAIKOGHLI MA, CHENG RH (2017) Virus-Like Particle encapsulating nano-theranostic reagent as modularized capsule. Adv Res Gastroentero Hepatol 5(5): 555674. CHEN, C.C., BAIKOGHLI, M.A., and CHENG, R.H. (2018) Tissue targeted nanocapsids for oral insulin delivery via drink. Pharm Pat Anal, 7:121-27. CHEN, C. C„ STARK, M„ BAIKOGHLI, L. and CHENG, R.H. (2018) Surface Functionalization of Hepatitis E VirusLike Particles Using Chemical Conjugation Methods. JoVE (Journal of Visualized Experiments) 135: e57020. CHEN, C.C., BAIKOGHLI, M.A. and CHENG, R.H. (2018) Tissue targeted nanocapsids for oral insulin delivery via drink. Pharm Pat Anal 7(3): 121-127. CHEN, C.C., BAIKOGHLI, M.A. and CHENG, R.H. (2021) Protein-based nanoplatform for detection of tumorigenic polyps in the colon via noninvasive mucosal routes. Pharm Pat Anal 10(1): 13-24. CHEN, C.C., XING, L, STARK, M.,OU,T., HOLLA, P.,XIAO, K., KAMITA, S.G., HAMMOCK, B.D., LAM, K. and CHENG, R.H. (2016) Chemically-activatable viral capsid functionalized for cancer targeting. Nanomedicine (Lond) 11(4): 377390. DEVARAKONDA, S.B., MYERS, M.R. and BANERJEE, R.K. (2018) Comparison of heat transfer enhancement between magnetic and gold Virus-Like Particles during HIFU sonication. J Biomech Eng 140(8). DEVARAKONDA, S.B., MYERS, M.R., GIRIDHAR, D., DIBAJI, S.A. and BANERJEE, R.K. (2017) Enhanced thermal effect using magnetic nano-particles during high-intensity focused ultrasound. PLoS One 12(4): e0175093. DEVARAKONDA, S.B., MYERS, M.R., LANIER, M., DUMOULIN, C. and BANERJEE, R.K. (2017) Assessment of gold Virus-Like Particle-mediated-enhanced hyperthermia using MR-guided high-intensity focused ultrasound ablation procedure. Nano Lett 17(4): 2532-2538. ESPINOSA, A., DI CORATO, R„ KOLOSNJAJ-TABI, J., FLAUD, P„ PELLEGRINO, T. and WILHELM, C. (2016) Duality of iron oxide Virus-Like Particles in cancer therapy: Amplification of heating efficiency by magnetic hyperthermia and photothermal bimodal treatment. ACS Nano 10(2): 2436-2446. FATH-GOODIN, A., KROEMER, J., MARTIN, S., REEVES, K., and WEBB., B.A. (2006) Polydnavirus Genes that Enhance the Baculovirus Expression Vector System, in, Advances in Virus Research (Academic Press). GALAWAY, F. A., and STOCKLEY. P.G. (2013) MS2 virus-like particles: a robust, semisynthetic targeted drug delivery platform. Mol Pharm 10: 59-68. GLASEL, J.A. (1995) Validity of nucleic acid purities monitored by 260nm / 280nm absorbance ratios. Biotechniques 18: 62-3. GUU, T., LIU, Z., YE, Q., MATA, D., LI, K., LIN, C., ZHANG, J. and YTAO, T. (2009) Structure of the hepatitis E viruslike particle suggests mechanisms for virus assembly and receptor binding. Proc Natl Acad Sci U S A 106:12992-97. HIYOSHI, M., KAGESHIMA, A, KATO, T., and PARK, E.Y. (2007) Construction of a cysteine protease deficient Bombyx mori multiple nucleopolyhedrovirus bacmid and its application to improve expression of a fusion protein. J Virol Methods 144: 91-7. HOLLA, P., BAIKOGHLI, M.A., SOONSAWAD, P. and CHENG, R.H. (2017) Chapter 16 - Toward mucosal DNA delivery: Structural modularity in vaccine platform design. Micro and nanotechnology in vaccine development. SKWARCZYNSKI, M. and TOTH, I., William Andrew Publishing: 303-326. HOM, L.G., OHKAWA, T., TRUDEAU, D., and VOLKMAN, L.E. (2002) Autographa californica M nucleopolyhedrovirus ProV-CATH is activated during infected cell death. Virology 296: 212-8. HUGHES, K.A., MISRA, B., MAGHAREH, M. and BOBBALA, S. (2023) Use of stimulatory responsive soft Virus-Like Particles for intracellular drug delivery. Nano Res: 1-17. HUTCHINSON, E.G., SESSIONS, R.B., THORNTON, J.M. and WOOLFSON, D.N. (1998) Determinants of strand register in antiparallel beta-sheets of proteins. Protein Sci 7(11): 2287-2300. ITO, A., HONDA, H. and KOBAYASHI, T. (2006) Cancer immunotherapy based on intracellular hyperthermia using magnetite Virus-Like Particles: A novel concept of "heat-controlled necrosis" with heat shock protein expression. Cancer Immunol Immunother 55(3): 320-328. ITO, A., SHINKAI, M., HONDA, H., YOSHIKAWA, K., SAGA, S., WAKABAYASHI, T., YOSHIDA, J. and KOBAYASHI, T. (2003) Heat shock protein 70 expression induces antitumor immunity during intracellular hyperthermia using magnetite Virus-Like Particles. Cancer Immunol Immunother 52(2): 80-88. JARIYAPONG, P., XING, L., VAN HOUTEN, N.E., LI, T.C., WEERACHATYANUKUL, W., HSIEH, B., MOSCOSO, C.G., CHEN, C.C., NIIKURA, M. and CHENG, R.H. (2013) Chimeric hepatitis e virus-like particle as a carrier for oral-delivery. Vaccine 31(2): 417-424. JEONG, T.-J., LEE, H.-T., GU, N., JANG, Y.-J., CHOI, S.-B., PARK, U.-B., LEE, S.-H. and HEO, Y.-S. (2022) The high-resolution structure reveals remarkable similarity in pd-1 binding of cemiplimab and dostarlimab, the FDA-approved antibodies for cancer immunotherapy. Biomedicines 10 DOI: 10.3390 / biomedicinesl0123154. JIAN, F„ ZHANG, Y„ WANG, J., BA, K„ MAO, R„ LAI, W. and LIN, Y. (2012) Toxicity of biodegradable nanoscale preparations. Curr Drug Metab 13(4): 440-446. KABA, S.A., SALCEDO, A.M., WAFULA, P.O., VLAK, J.M., and VAN OERS, M.M. (2004) Development of a chitinase and v-cathepsin negative bacmid for improved integrity of secreted recombinant proteins. Journal of Virological Methods 122: 113-18. KACZMAREK, K., HORNOWSKI, T., DOBOSZ, B. and JOZEFCZAK, A. (2018) Influence of magnetic Virus-Like Particles on the focused ultrasound hyperthermia. Materials (Basel) 11(9). KAUR, P., ALIRU, M.L., CHADHA, A.S., ASEA, A. and KRISHNAN, S. (2016) Hyperthermia using Virus-Like Particles--promises and pitfalls. International journal of hyperthermia: The official journal of European Society for Hyperthermic Oncology, North American Hyperthermia Group 32(1):76-88. KAWANO, M., XING, L„ LAM, K.S., HANDA, H„ MIYAMURA, T„ BARNETT, S„ SRIVASTAVA, I.K. and CHENG, R.H. (2011) Design platforms of nanocapsules for human therapeutics or vaccines. Development of vaccines, John Wiley & Sons, Inc.: 125-139. KIM, Y.S. (2015) Advances in MR image-guided high-intensity focused ultrasound therapy. Int J Hyperthermia 31(3): 225-232. KITTS, P.A., AYRES, M.D., and POSSEE, R.D. (1990) Linearization of baculovirus DNA enhances the recovery of recombinant virus expression vectors. Nucleic Acids Res 18(19): 5667-5672. KOSHELEVA, O.K., LAI, T.-C., CHEN, N.G., HSIAO, M. and CHEN, C.-H. (2016) Selective killing of cancer cells by Virus-Like Particle-assisted ultrasound. Journal of Nanobiotechnology 14(1): 46. LAMBIDIS, E., CHEN, C.C., BAIKOGHLI, M., IMLIMTHAN, S., KHNG, Y.C., SARPARANTA, M., CHENG, R.H. and AIRAKSINEN, AJ. (2022) Development of (68)Ga-labeled Hepatitis E Virus-Like Particles for targeted drug delivery and diagnostics with pet. Mol Pharm 19(8): 2971-2979. LAMBIDIS, E., CHEN, C.-C., LUMEN, D., SANCHEZ, A.I.F., SARPARANTA, M., CHENG, R.H. and AIRAKSINEN, AJ. (2022) Biological evaluation of integrin a301-targeted 68ga-labeled HEVNPS in HCT 116 colorectal tumor-bearing mice. European Journal of Pharmaceutical Sciences: 106336. LI, T. C., YAMAKAWA, Y., SUZUKI, K., TATSUMI, M., RAZAK, M.A., UCHIDA, T., TAKEDA, N., AND MIYAMURA, T.. (1997) Expression and self-assembly of empty virus-like particles of hepatitis E virus. J Virol 71: 7207-13. LI,T.C., TAKEDA, N., MIYAMURA,T., MATSUURA, Y., WANG, J.C., ENGVALL, H., HAMMAR, L., XING, L. and CHENG, R.H. (2005) Essential elements of the capsid protein for self-assembly into empty virus-like particles of hepatitis e virus. J Virol 79(20): 12999-13006. LI, T.-C., SUZAKI, Y., AMI, Y., DHOLE, T.N., MIYAMURA, T., and TAKEDA, N. (2004) Protection of cynomolgus monkeys against HEV infection by oral administration of recombinant hepatitis E virus-like particles. Vaccine, 22: 370-77. LUDWIG, C., and WAGNER, R. (2007) Virus-like particles-universal molecular toolboxes. CurrOpin Biotechnol 18: 537-45. MA, Y., NOLTE, R.J., and CORNELISSEN, JJ. (2012) 'Virus-based nanocarriers for drug delivery', Adv Drug Deliv Rev, 64: 811-25. MCINTIRE, J. J., UMETSU, S. E. MACAUBAS, C. HOYTE, E. G. CINNIOGLU, C. CAVALLI-SFORZA, L. L. BARSH, G. S. HALLMAYER, J. F. UNDERHILL, P. A. RISCH, N. J. FREEMAN, G. J. DEKRUYFF, R. H. and UMETSU, D. T. (2003). Immunology: Hepatitis A virus link to atopic disease. Nature 425: 576. MULVANIA, T., HAYES, B., and HEDIN, D. (2004) A Flow Cytometric Assay for Rapid, Accurate Determination of Baculovirus Titers. The BioProcessing Journal (BPJ), 3: 6. NDEUPEN, S., QIN, Z., JACOBSEN, S., ESTANBOULI, H., BOUTEAU, A. and IGYARTO, B.Z. (2021) The mRNA-LNP platform's lipid Virus-Like Particle component used in preclinical vaccine studies is highly inflammatory. iScience 24(12):103479. PMC8604799. NIIKURA, M.,TAKAMURA, S., KIM, G., KAWAI, S., SAIJO, M., MORIKAWA, S., KURANE, I., LI, T.C., TAKEDA, N., and YASUTOMI, Y. (2002) Chimeric recombinant hepatitis E virus-like particles as an oral vaccine vehicle presenting foreign epitopes. Virology 293: 273-80. NILSSON, J., MIYAZAKI, N., XING, L., WU, B., HAMMAR, L., LI, T.C., TAKEDA, N., MIYAMURA, T., and CHENG, R.H. (2005) Structure and assembly of a T=1 virus-like particle in BK polyomavirus. J Virol 79: 5337-45. OLSEN, H. B„ LEUENBERGER-FISHER, M.R., KADIMA, W„ BORCHARDT, D. KAARSHOLM, N.C., and DUNN, M.F. (2003) Structural signatures of the complex formed between 3-nitro-4-hydroxybenzoate and the Zn(ll)-substituted R(6) insulin hexamer. Protein Sci 12: 1902-13. PANDA, S.K., KAPUR, N., PALIWAL, D. and DURGAPAL, H. (2015) Recombinant Hepatitis E virus like particles can function as RNA nanocarriers. Journal of Nanobiotechnology 13: 44. PEYRET, H. (2015) A protocol for the gentle purification of virus-like particles produced in plants. J Virol Methods 225:59-63. PURCEL, R.H. (1996) 'Hepatitis E virus.1 in B.N. Fields, D.M. Knipe and P.M. Howley (eds.), Fields Virology (Lippincott - Raven Publishers: Philadelphia) RICHAUD, A.D., ZHAO, G., HOBLOSS, S. and ROCHE, S.P. (2021) Folding in place: Design of f-strap motifs to stabilize the folding of hairpins with long loops. J Org Chem 86(19): 13535-13547. ROEMER, R.B. (1999) Engineering aspects of hyperthermia therapy. Annu Rev Biomed Eng 1: 347-376. RUSSELL, L.M., HULTZ, M. and SEARSON, P.C. (2018) Leakage kinetics of the liposomal chemotherapeutic agent doxil: The role of dissolution, protonation, and passive transport, and implications for mechanism of action. Journal of controlled release : Official journal of the Controlled Release Society 269:171-176. SCHOFIELD, D. J., GLAMANN, J., EMERSON, S.U., and PURCELL, R.H. (2000) Identification by phage display and characterization of two neutralizing chimpanzee monoclonal antibodies to the hepatitis E virus capsid protein. J Virol 74: 5548-55. SEBESTIK, J., NIEDERHAFNER, P. and JEZEK, J. (2011) Peptide and glycopeptide dendrimers and analogous dendrimeric structures and their biomedical applications. Amino Acids 40(2): 301-370. SERKOVA, N.J. (2017) Virus-Like Particle-based magnetic resonance imaging on tumor-associated macrophages and inflammation. Front Immunol 8: 590. SHI, Y., VAN DER MEEL, R., CHEN, X. and LAMMERS, T. (2020) The EPR effect and beyond: Strategies to improve tumor targeting and cancer nanomedicine treatment efficacy. Theranostics 10(17): 7921-7924. SHIZUO G., KAMITA, M.A.B., LUIS M. DE LA MAZA, and CHENG, R.H. (2019) A noninvasive, orally stable, mucosapenetrating polyvalent vaccine platform based on Hepatitis E Virus-Like Particle. Synthetic Biology-New Interdisciplinary Science. SIEVERS F., WILM A., DINEEN D., GIBSON T.J., KARPLUS K., LI W., LOPEZ R., MCWILLIAM H., REMMERT M., SODING J., THOMPSON J.D. AND HIGGINS D.G. (2011) Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega. Mol. Syst. Biol. 7:539. STARK, M. and CHENG, R.H. (2016) Surface modulatable nanocapsids for targeting and tracking toward nanotheranostic delivery. Pharm Pat Anal 5(5): 307-317. STARK, M. C., BAIKOGHLI, M.A, LAHTINEN, T., MALOLA, S., XING, L., NGUYEN, M., NGUYEN, M., SIKAROUDI, A., MARJOMAKI, V., HAKKINEN, H., and CHENG, R.H. (2017) Structural characterization of site-modified nanocapsid with monodispersed gold clusters. Sci Rep 7: 17048. STARK, M., and Cheng, R.H. (2016) Surface modulatable nanocapsids for targeting and tracking toward nanotheranostic delivery. Pharm Pat Anal 5: 307-17. SUN, X., YAN, X., ZHUO, W., GU, J., ZUO, K., LIU, W., LIANG, L., GAN, Y., HE, G., WAN, H., GOU, X., SHI, H. and HU, J. (2018) Pd-ll nanobody competitively inhibits the formation of the pd-l / pd-ll complex: Comparative molecular dynamics simulations. Int J Mol Sci 19(7) TAKAMURA, S., NIIKURA, M., LI, T.C., TAKEDA, N., KUSAGAWA, S., TAKEBE, Y., MIYAMURA, T. and YASUTOMI, Y. (2004) DNA vaccine-encapsulated virus-like particles derived from an orally transmissible virus stimulate mucosal and systemic immune responses by oral administration. Gene Ther 11(7): 628-635. TAM, A.W., SMITH, M.M., GUERRA, M.E., HUANG, C.C., BRADLEY, D.W., FRY, K.E. and REYES, G.R. (1991) Hepatitis E virus (HEV): Molecular cloning and sequencing of the full-length viral genome. Virology 185(1): 120-131. VAN OERS, M.M. 2011. Opportunities and challenges for the baculovirus expression system. Journal of Invertebrate Pathology 107: S3-S15. VARGASON, A.M., ANSELMO, A.C. and MITRAGOTRI, S. (2021) The evolution of commercial drug delivery technologies. Nature Biomedical Engineering 5(9): 951-967. WANG, C.Y., MIYAZAKI, N., YAMASHITA, T., HIGASHIURA, A., NAKAGAWA, A., LI, T.C., TAKEDA, N., XING, L., HJALMARSSON, E., FRIBERG, C., LIOU, D.M., SUNG, Y.J., TSUKIHARA, T., MATSUURA, Y., MIYAMURA, T. and CHENG, R.H. (2008) Crystallization and preliminary X-ray diffraction analysis of recombinant hepatitis e virus-like particle. Acta Crystallogr Sect F Struct Biol Cryst Commun 64(Pt 4): 318-322. WARD, K, FAN, Z.H. (2015) Mixing in microfluid devices and enhancement methods. J Micromech Microeng, 25(9). WU, Z., ZHUO, Z., CAI, D., WU, J., WANG, J. and TANG, J. (2015) An induction heating device using planar coil with high amplitude alternating magnetic fields for magnetic hyperthermia. Technol Health Care 23 Suppl 2: S203-209. XIA, W., WANG, Y., YANG, A. and YANG, G. (2017) DNA Compaction and Charge Inversion Induced by Organic Monovalent Ions. Polymers (Basel) 9. XIAO, W., LI, T., BONONI, F.C., LAC, D., KEKESSIE, I.A., LIU, Y., SANCHEZ, E., MAZLOOM, A., MA, A.H., LIN, J., TRAN, J., YANG, K., LAM, K.S. and LIU, R. (2016) Discovery and characterization of a high-affinity and high-specificity peptide ligand lxy30 for in vivo targeting of alphas integrin-expressing human tumors. EJNMMI Res 6(1): 18. XING, L, LI, T.C., MIYAZAKI, N., SIMON, M.N., WALL, J.S., MOORE, M., WANG, C.Y.,TAKEDA, N. WAKITA, T., MIYAMURA, T., and CHENG, R.H. (2010) Structure of hepatitis E virion-sized particle reveals an RNA-dependent viral assembly pathway. J Biol Chern 285: 33175-83. XING, L., WANG, J.C., LI, T.C., YASUTOMI, Y., LARA, J., KHUDYAKOV, Y., SCHOFIELD, D., EMERSON, S.U., PURCELL, R.H.,TAKEDA, N., MIYAMURA, T., and CHENG, R.H. (2011) Spatial configuration of hepatitis E virus antigenic domain. J Virol 85: 1117-24. XING, L., KATO, K., LI, T., TAKEDA, N., MIYAMURA, T., HAMMAR, L. and CHENG, R.H. (1999) Recombinant hepatitis E capsid protein self-assembles into a dual-domain T=1 particle presenting native virus epitopes. Virology 265(1):35-45. XING, L„ LI, T.C., MAYAZAKI, N„ SIMON, M.N., WALL, J.S., MOORE, M„ WANG, C.Y., TAKEDA, N„ WAKITA, T„ MIYAMURA, T. and CHENG, R.H. (2010) Structure of hepatitis e virion-sized particle reveals an RNA-dependent viral assembly pathway. J Biol Chern 285(43): 33175-33183. YAMASHITA, T., MORI, Y., MIYAZAKI, N., CHENG, H., YOSHIMURA, M., UNNO, H., SHIMA, R., MORIISHI, K., TSUKIHARA, T„ LI, T.C., TAKEDA, N„ MIYAMURA, T„ and MATSUURA, Y. (2009) Biological and immunological characteristics of hepatitis E virus-like particles based on the crystal structure. Proc Natl Acad Sci U S A 106: 1298691. YU, H., LI, S. YANG, C.Y., WEI, M., SONG, C., ZHENG, Z., GU, Y., DU, H., ZHANG, J., and XIA, N.S. (2010) Homology model and potential virus-capsid binding site of a putative HEV receptor Grp78. J Mol Model (In press). ZAFRULLAH, M., KHURSHEED, Z., YADAV, S., SAHGAL, D., JAMEEL, S. and AHMAD, F. (2004) Acidic pH enhances structure and structural stability of the capsid protein of Hepatitis E virus. Biochem Biophys Res Commun 313(1): 6773. ZENG, C., ZHANG, C., WALKER, P.G. and DONG, Y. (2022) Formulation and delivery technologies for mRNA vaccines. CurrTop Microbiol Immunol 440: 71-110.
Claims
1. A nucleotide sequence encoding a polypeptide sequence derived from a consensus of Hepeviridae capsid proteins comprising one or more amino acid substitutions, insertions, or deletions, capable of forming a functional Virus-Like Particle (VLP), wherein said VLP encapsulates or is conjugated to one or more molecules selected from the group consisting of nucleic acids, polypeptides, inorganic nanoparticles, or small molecule drug products.
2. The nucleotide sequence of Claim 1, wherein said consensus of Hepeviridae capsid proteins are derived from the subfamily Orthohepevirinae.
3. The nucleotide sequence of Claim 2, wherein said consensus of Hepeviridae capsid proteins are derived from the subfamily Orthohepevirinae, species Paslahepevirus balayani.
4. The nucleotide sequence of Claim 1, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions in variable or invariable domains of the consensus sequence.
5. The nucleotide sequence of Claim 1, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions in variable domains of the consensus sequence.
6. The nucleotide sequence of Claim 1, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions in invariable domains of the consensus sequence.
7. The nucleotide sequence of Claim 1, wherein said polypeptide sequence comprises one or more amino acid deletions.
8. The nucleotide sequence of Claim 7, wherein said polypeptide sequence comprises a deletion at the amino, carboxy, or amino and carboxy termini of the consensus sequence.
9. The nucleotide sequence of Claim 7, wherein said polypeptide sequence comprises one or more deletions in variable domains of the consensus sequence.
10. The nucleotide sequence of Claim 1, wherein said polypeptide sequence comprises one or more amino acid insertions.
11. The nucleotide sequence of Claim 10, wherein said polypeptide sequence comprises one or more insertions in variable domains of the consensus sequence.
12. The nucleotide sequence of Claim 10, wherein said polypeptide sequence comprises one or more insertions in invariable domains of the consensus sequence.
13. The nucleotide sequence of Claim 1, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions, and one or more insertions or one or more deletions in variable or invariable domains of the consensus sequence.
14. The nucleotide sequence of Claim 13, wherein all of said conservative amino acid substitutions, insertions or deletions are in variable domains of the consensus sequence.
15. The nucleotide sequence of any of Claims 1-14 further comprising one or more insertions of DNA segments encoding heterologous polypeptides selected from the group consisting of nucleic acid binding domains, hydrophobic binding domains, hydrophilic binding domains, polypeptide binding domain, and antibody binding domains.
17. The nucleotide sequence of Claim 15, wherein said domain is a nucleic acid binding domain.
18. The nucleotide sequence of Claim 15, wherein said domain is a hydrophobic or a hydrophilic binding domain.
19. The nucleotide sequence of Claim 15, wherein said domain is a polypeptide binding domain.
20. The nucleotide sequence of Claim 15, wherein said domain is an antibody binding domain.
21. A vector comprising a nucleotide sequence of any of Claims 1-20 encoding a functional Virus-Like Particle.
22. The vector of Claim 21, wherein said vector is selected from the group consisting of a cloning vector and an expression vector.
23. The vector of Claim 22, wherein said vector is an expression vector comprises a nucleotide sequence encoding a functional Virus-Like Particle operably linked to a promoter at its 5' end and optionally a transcriptional termination signal at its 3' end.
24. The vector of Claim 23, wherein said expression vector is baculovirus expression vector.
25. The vector of Claim 24, wherein said baculovirus expression vector comprises a baculovirus promoter operably-linked to a nucleotide sequence encoding a functional Virus-Like Particle.
26. The vector of claim 25, wherein said promoter is a polyhedrin promoter.
27. The vector of claim 25, wherein said promoter is a PIO promoter.
28. The vector of Claim 23, wherein said expression vector is bacterial expression vector.
29. The vector of Claim 23, wherein said expression vector is mammalian expression vector.
30. A vector of any one of Claims 21-29, comprising a nucleotide sequence represented by SEQ ID NOs: 01, 03, 05, 07, 09,11, and 12.
31. A prokaryotic or eukaryotic cell harboring a vector of Claim 21.
32. The cell of claim 31, wherein said cell is a eukaryotic cell.
33. The cell of claim 32, wherein said cell is an insect cell.
34. The cell of claim 33, wherein said cell is a Lepidopteran insect cell.
35. The cell of claim 34, wherein said Lepidopteran insect cell is selected from the group consisting of Spodopterafrugiperda, Trichoplusia ni, and Bombyx mori.
36. The cell of claim 32, wherein said cell is a mammalian cell.
37. The cell of claim 33, wherein said cell is a human cell.
38. The cell of claim 32, wherein said cell is a yeast cell.
39. The cell of Claim 31, wherein said cell is prokaryotic cell.
40. The cell of claim 33, wherein said cell is an Escherichia coli cell.
41. A polypeptide sequence derived from a consensus of Hepeviridae capsid proteins comprising one or more amino acid substitutions, insertions, or deletions, capable of forming a functional Virus-Like Particle, wherein said Virus-Like Particle encapsulates or is conjugated to one or more molecules selected from the group consisting of a nucleic acid, a polypeptide, an inorganic nanoparticle, and a small molecule drug product.
42. The polypeptide sequence of Claim 41, wherein said consensus of Hepeviridae capsid proteins are derived from the subfamily Orthohepevirinae.
43. The polypeptide sequence of Claim 42, wherein said consensus of Hepeviridae capsid proteins are derived from the subfamily Orthohepevirinae, species Paslahepevirus balayani.
44. The polypeptide sequence of Claim 41, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions in variable or invariable domains of the consensus sequence.
45. The polypeptide sequence of Claim 44, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions in variable domains of the consensus sequence.
46. The polypeptide sequence of Claim 44, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions in invariable domains of the consensus sequence.
47. The polypeptide sequence of Claim 41, wherein said polypeptide sequence comprises one or more amino acid deletions.
48. The polypeptide sequence of Claim 47, wherein said polypeptide sequence comprises a deletion at the amino, carboxy, or amino and carboxy termini of the consensus sequence.
49. The polypeptide sequence of Claim 47, wherein said polypeptide sequence comprises one or more deletions in variable domains of the consensus sequence.
50. The polypeptide sequence of Claim 41, wherein said polypeptide sequence comprises one or more amino acid insertions.
51. The polypeptide sequence of Claim 50, wherein said polypeptide sequence comprises one or more insertions in variable domains of the consensus sequence.
52. The polypeptide sequence of Claim 50, wherein said polypeptide sequence comprises one or more insertions in invariable domains of the consensus sequence.
53. The polypeptide sequence of Claim 41, wherein said polypeptide sequence comprises one or more conservative amino acid substitutions, and one or more insertions or one or more deletions in variable or invariable domains of the consensus sequence.
54. The polypeptide sequence of Claim 53, wherein all of said conservative amino acid substitutions, insertions or deletions are in variable domains of the consensus sequence.
55. The polypeptide sequence of any of Claims 41-54 further comprising one or more insertions of DNA segments encoding heterologous polypeptides selected from the group consisting of one or more nucleic acid binding domains, hydrophobic binding domains, polypeptide binding domain, and antibody binding domains.
56. The polypeptide sequence of Claim 55, wherein said domain is a nucleic acid binding domain.
57. The polypeptide sequence of Claim 55, wherein said domain is a hydrophobic binding domain.
58. The polypeptide sequence of Claim 55, wherein said domain is a hydrophilic binding domain.
59. The polypeptide sequence of Claim 55, wherein said domain is a polypeptide binding domain.
60. The polypeptide sequence of Claim 55, wherein said domain is an antibody binding domain.
61. A functional Virus-Like Particle derived from a consensus of Hepeviridae capsid proteins comprising one or more amino acid substitutions, insertions, or deletions, wherein said Virus-Like Particle encapsulates or is conjugated to one or more molecules selected from the group consisting of a nucleic acid, a polypeptide, an inorganic nanoparticle, and a small molecule drug product.
62. The functional Virus-Like Particle of Claim 61, wherein said Virus-Like Particle encapsulates a nucleic acid.
63. The functional Virus-Like Particle of Claim 62, wherein said Virus-Like Particle encapsulates a single-stranded RNA (ssRNA) molecule.
64. The functional Virus-Like Particle of Claim 62, wherein said Virus-Like Particle encapsulates a double- stranded RNA (dsRNA) molecule.
65. The functional Virus-Like Particle of Claim 62, wherein said Virus-Like Particle encapsulates a single-stranded DNA (ssDNA) molecule.
66. The functional Virus-Like Particle of Claim 62, wherein said Virus-Like Particle encapsulates a double-stranded DNA (dsDNA) molecule.
67. The functional Virus-Like Particle of Claim 61, wherein said Virus-Like Particle encapsulates a polypeptide.
68. The functional Virus-Like Particle of Claim 61, wherein said Virus-Like Particle encapsulates one or more molecules selected from the group consisting of a nucleic acid, a polypeptide, and an inorganic nanoparticle.
69. The functional Virus-Like Particle of Claim 61, wherein said Virus-Like Particle encapsulates a small molecule drug product.
70. A method of isolating functional Virus-Like Particles derived from a consensus of Hepeviridae capsid proteins comprising one or more amino acid substitutions, insertions, or deletions comprising the steps of (a): infecting susceptible insect cells with a baculovirus expression vector comprising a nucleotide sequence encoding a functional Virus-Like Particle under the control of a baculovirus promoter; (2) monitoring the expression of capsid protein over time; (3) concentrating, binding, and eluting purified capsid proteins; and (4) forming functional Virus-Like Particles.