Patents
Literature
PatSnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

7606results about "Enzymes" patented technology

Enzymatic nucleic acid synthesis: compositions and methods for altering monomer incorporation fidelity

InactiveUS7211414B2Extent of pyrophosphorolysis of a primer extension product is reducedImprove fidelityBiocideSugar derivativesPhosphatePhosphoric acid
Nucleotide triphosphate probes containing a molecular and / or atomic tag on a a γ and / or β phosphate group and / or a base moiety having a detectable property are disclosed, and kits and method for using the tagged nucleotides in sequencing reactions and various assay. Also, phosphate and polyphosphate molecular fidelity altering agents are disclosed.
Owner:LIFE TECH CORP

Chloroplast transit peptides for efficient targeting of DMO and uses thereof

The invention provides for identification and use of certain chloroplast transit peptides for efficient processing and localization of dicamba monooxygenase (DMO) enzyme in transgenic plants. Methods for producing dicamba tolerant plants, methods for controlling weed growth, and methods for producing food, feed, and other products are also provided, as well as seed that confers tolerance to dicamba when it is applied pre- or post-emergence.
Owner:MONSANTO TECH LLC

Delivery and formulation of engineered nucleic acids

ActiveUS20120251618A1Improve the level ofIncrease in level of polypeptideNervous disorderAntipyreticNucleic acidProtein expression
Provided are formulations, compositions and methods for delivering biological moieties such as modified nucleic acids into cells to modulate protein expression. Such compositions and methods include the delivery of biological moieties, and are useful for production of proteins.
Owner:MODERNATX INC

Nucleotide sequences and corresponding polypeptides conferring modulated plant characteristics

The present invention relates to isolated nucleic acid molecules and their corresponding encoded polypeptides able confer the trait of modulated plant size, vegetative growth, organ number, plant architecture, sterility or seedling lethality in plants. The present invention further relates to the use of these nucleic acid molecules and polypeptides in making transgenic plants, plant cells, plant materials or seeds of a plant having such modulated growth or phenotype characteristics that are altered with respect to wild type plants grown under similar conditions.
Owner:CERES INC

Genes conferring herbicide resistance

Compositions and methods for conferring herbicide resistance to plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a polypeptide that confers resistance or tolerance to glyphosate herbicides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants. Compositions also comprise transformed plants, plant cells, tissues, and seeds. In particular, isolated nucleic acid molecules corresponding to glyphosate resistant nucleic acid sequences are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:2 or the nucleotide sequence set forth in SEQ ID NO:1.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

Directed evolution of grg31 and grg36 epsp synthase enzymes

Compositions and methods for conferring herbicide resistance or tolerance to bacteria, plants, plant cells, tissues and seeds are provided. Compositions include polynucleotides encoding herbicide resistance or tolerance polypeptides, vectors comprising those polynucleotides, and host cells comprising the vectors. The nucleotide sequences of the invention can be used in DNA constructs or expression cassettes for transformation and expression in organisms, including microorganisms and plants. Compositions also include transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated polynucleotides encoding glyphosate resistance or tolerance polypeptides are provided, particularly polypeptide variants of SEQ ID NO:2 and 4. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated polynucleotides containing nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:7-28, or the nucleotide sequence set forth in SEQ ID NO:29 or 30.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

Engineered Antibodies and Immunoconjugates

Antibody drug conjugates with predetermined sites and stoichiometries of drug attachment are provided. Also provided are methods of using antibody drug conjugates.
Owner:SEATTLE GENETICS INC

Integrated process for separation of lignocellulosic components to fermentable sugars for production of ethanol and chemicals

A continuous and modular process converts lignocellulosic materials for the production of ethanol principally and / or chemicals such as methanol, butanediol, propanediol, hydrocarbon fuel, etc. Renewable lignocellulosic biomass such as but not all inclusive hardwoods (gum, beech, oak, sweet gum, poplar, eucalyptus, etc.), soft woods (pines, firs, spruce, etc.), corn stovers, straws, grasses, recycled papers, waste products from pulp and paper mills, etc can be used as feedstock. The process is designed to be modular and the feed entry point can be selected to adapt to different biomass feedstock. Lignocellulosic biomass such as hardwood and softwood are subjected to chemical / pressure treatment stages using potent and selective chemicals such as sodium chlorite / acetic acid (anhydrous) and chlorine / chlorine dioxide to separate the main components—lignin, cellulose (glucose) and hemicelluloses (xylose, arabinose, galactose)—into three process streams. The separated carbohydrates are further subjected to washing, cleaning, neutralization, and / or mild hydrolysis and subsequently fermented to produce ethanol. Residual lignin and extractives remained with the cellulose are removed by chemical treatment steps to enhance the fermentations of cellulose. Pre-hydrolysate after neutralization to neutralize and remove toxic components such as acetic acid, furfural, phenolics, etc. containing (xylose, arabinose, galactose) and hexoses (glucose) can be either separately or together with the purified cellulosic fraction fermented to produce ethanol. Approximately 100 gallons of ethanol, suitable to be used as a fuel, can be produced from one dried ton of wood. Significant amount of lignin are separated as a by-product and can be converted to hydrocarbon fuel, surfactant, drilling aid, or can be incinerated for generation of power and steam.
Owner:NGUYEN XUAN NGHINH

Novel epsp synthase genes conferring herbicide resistance

Compositions and methods for conferring herbicide resistance or tolerance to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a polypeptide that confers resistance or tolerance to glyphosate herbicides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated nucleic acid molecules corresponding to glyphosate resistant nucleic acid sequences are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NOS:2, 4, 6, 8, 10, 12, or 14 or the nucleotide sequence set forth in SEQ ID NOS:1, 3, 5, 7, 9, 11, 13, 28, 29, 30, 31, 32, 33, or 34.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

EPSP synthases: compositions and methods of use

Compositions and methods for conferring tolerance to glyphosate in bacteria, plants, plant cells, tissues and seeds are provided. Compositions include novel EPSP synthase enzymes and nucleic acid molecules encoding such enzymes, vectors comprising those nucleic acid molecules, and host cells comprising the vectors.
Owner:ATHENIX

Grg33, grg35, grg36, grg37, grg38, grg39 and grg50: novel epsp synthase genes conferring herbicide resistance

Compositions and methods for conferring herbicide resistance to bacteria, plants, plant cells, tissues and seeds are provided. Compositions include nucleic acid molecules encoding herbicide resistance or tolerance polypeptides, vectors comprising those nucleic acid molecules, and host cells comprising the vectors. The nucleotide sequences of the invention can be used in DNA constructs or expression cassettes for transformation and expression in organisms, including microorganisms and plants. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, the present invention provides for isolated nucleic acid molecules comprising the nucleotide sequence set forth in SEQ ID NO:1, 3, 4, 6, 7, 9, 10, 12, 13, 15, 17, 18, 20, 21, or 23, a nucleotide sequence encoding the amino acid sequence shown in SEQ ID NO:2, 5, 8, 11, 14, 16, 19, or 22, the herbicide resistance nucleotide sequence deposited in a bacterial host as Accession Nos. NRRL B-30932, B-30933, B-30934, B-30945, B-30946, B-30947, or B-30948, as well as variants and fragments thereof.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

Preparation of protein microparticles by supercritical fluid precipitation

InactiveUS6063910AUniform and fine particle sizePowder deliveryPeptide/protein ingredientsMicroparticleSolvent
The present invention comprises passing a solution of a soluble material, preferably a protein, in a solvent through a continuum of supercritical antisolvent fluid and precipitating the soluble material. This can be conducted by passing the solution through the continuum of supercrital fluid in the form of droplets, which can be sprayed through the supercritical fluid. The plurality of droplets can be passed cocurrently or countercurrently with respect to a stream of antisolvent fluid. Alternatively, the solution can be passed through the continuum of supercritical antisolvent fluid in the form of a thin film or a plurality of fine streams.
Owner:THE TRUSTEES FOR PRINCETON UNIV

Genes conferring herbicide resistance

Compositions and methods for conferring herbicide resistance to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a polypeptide that confers resistance or tolerance to glyphosate herbicides are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated nucleic acid molecules corresponding to glyphosate resistant nucleic acid sequences are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:3 or the nucleotide sequence set forth in SEQ ID NO:1 or 2.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

Grg32: a novel epsp synthase gene conferring herbicide resistance

Compositions and methods for conferring herbicide resistance to bacteria, plants, plant cells, tissues and seeds are provided. Compositions include nucleic acid molecules encoding herbicide resistance or tolerance polypeptides, vectors comprising those nucleic acid molecules, and host cells comprising the vectors. The nucleotide sequences of the invention can be used in DNA constructs or expression cassettes for transformation and in organisms, including microorganisms and plants. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, the present invention provides for isolated nucleic acid molecules comprising the nucleotide sequence set forth in SEQ ID NO:1 or 14, a nucleotide sequence encoding the amino acid sequence shown in SEQ ID NO:2, the herbicide resistance nucleotide sequence deposited in a bacterial host as Accession Nos. NRRL B-30931, as well as variants and fragments thereof.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

Grg23 epsp synthases: compositions and methods of use

Compositions and methods for conferring herbicide resistance or tolerance to bacteria, plants, plant cells, tissues and seeds are provided. Compositions include polynucleotides encoding herbicide resistance or tolerance polypeptides, vectors comprising those polynucleotides, and host cells comprising the vectors. The nucleotide sequences of the invention can be used in DNA constructs or expression cassettes for transformation and expression in organisms, including microorganisms and plants. Compositions also include transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated polynucleotides encoding glyphosate resistance or tolerance polypeptides are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed. In particular, the present invention provides for isolated polynucleotides containing nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, or 35, or the nucleotide sequence set forth in SEQ ID NO:6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, or 34.
Owner:BASF AGRICULTURAL SOLUTIONS SEED LLC

Genomic plant sequences and uses thereof

The present invention discloses rice genomic promoter sequences. The promoters are particularly suited for use in rice and other cereal crops. Methods of modifying, producing, and using the promoters are also disclosed. The invention further discloses compositions, transformed host cells, transgenic plants, and seeds containing the rice genomic promoter sequences, and methods for preparing and using the same.
Owner:MONSANTO TECH LLC

High arachidonic acid producing strains of Yarrowia lipolytica

Engineered strains of the oleaginous yeast Yarrowia lipolytica capable of producing greater than 10% arachidonic acid (ARA, an ω-6 polyunsaturated fatty acid) in the total oil fraction are described. These strains comprise various chimeric genes expressing heterologous desaturases, elongases and acyltransferases, and optionally comprise various native desaturase and acyltransferase knockouts to enable synthesis and high accumulation of ARA. Production host cells are claimed, as are methods for producing ARA within said host cells.
Owner:DUPONT US HLDG LLC

Novel antioxidants

This invention comprises administering to a human or animal in need of treatment an effective amount of an antioxidant lipoic acid derivative and / or pharmaceutically acceptable salts and solvates thereof for the treatment or prevention of pathological (inflammatory, proliferative and degenerative diseases, e.g. diabetes mellitus, atherosclerosis, Alzheimer's disease and chronic viral diseases) and non-pathological (e.g. skin aging and wrinkle formation) conditions caused by oxidative damage. Methods of synthesizing novel antioxidant lipoic acid derivatives and their use in preventing or treating diseases or conditions caused by oxidative stress and other free radical mediated conditions are described. Another aspect of this invention is the use of these antioxidant compositions for the protection of skin from damage caused by ultraviolet radiation and dessication, and to provide improved skin feel by desquamating, cleansing and clarifying the skin. The compositions described in this invention increase cellular viability of epidermal cells, promote cytoprotection, and decrease the production of inflammatory mediators such as inflammatory cytokines in these cells. The antioxidant compositions are incorporated into sunscreen products, soap, moisturizing lotions, skin toners, and other skin care products.
Owner:BETHESDA PHARMA

Methods, compositions, and kits comprising linker probes for quantifying polynucleotides

The present invention is directed to methods, reagents, kits, and compositions for identifying and quantifying target polynucleotide sequences. A linker probe comprising a 3′ target specific portion, a loop, and a stem is hybridized to a target polynucleotide and extended to form a reaction product that includes a reverse primer portion and the stem nucleotides. A detector probe, a specific forward primer, and a reverse primer can be employed in an amplification reaction wherein the detector probe can detect the amplified target polynucleotide based on the stem nucleotides introduced by the linker probe. In some embodiments a plurality of short miRNAs are queried with a plurality of linker probes, wherein the linker probes all comprise a universal reverse primer portion a different 3′ target specific portion and different stems. The plurality of queried miRNAs can then be decoded in a plurality of amplification reactions.
Owner:APPL BIOSYSTEMS INC

Postpartum cells derived from umbilical cord tissue, and methods of making and using the same

Cells derived from human umbilical cords are disclosed along with methods for their therapeutic use. Isolation techniques, culture methods and detailed characterization of the cells with respect to their cell surface markers, gene expression, and their secretion of trophic factors are described.
Owner:DEPUY SYNTHES PROD INC

Locked nucleic acid hybrids and methods of use

The invention relates to methods for inhibiting, cloning, modifying or labelling an endogenous DNA sequence using compositions comprising recombinases in combination with exogenous polynucleotides containing “anchoring” or “locking” sequences. The anchoring sequences serve to stabilize structures formed by the exogenous polynucleotides and the endogenous DNA. The stabilized structure thus can either serve to regulate gene transcription or replication, or can allow the endogenous sequences to be labelled or pulled out, i.e. cloned, or modified.
Owner:LIFE TECH CORP

Optimized strains of yarrowia lipolytica for high eicosapentaenoic acid production

Engineered strains of the oleaginous yeast Yarrowia lipolytica capable of producing greater than 50 weight percent of eicosapentaenoic acid [“EPA”], an ω-3 polyunsaturated fatty acid, in the total oil fraction are described. These strains over-express heterologous Δ9 elongases, Δ8 desaturases, Δ5 desaturases, Δ17 desaturases, Δ12 desaturases and C16 / 18 elongases, and optionally over-express diacylglycerol cholinephosphotransferases. Preferred gene knockouts are also described. Production host cells, methods for producing EPA within said host cells, and products comprising EPA from the optimized Yarrowia lipolytica strains are claimed.
Owner:DUPONT US HLDG LLC

Micro plasminogen mutant with function of inhibiting platelet aggregation and preparation method and application thereof

The invention discloses a micro plasminogen mutant with a function of inhibiting platelet aggregation, which has an amino acid sequence of KLYDYCKGDWPCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN. A preparation method of the micro plasminogen mutant comprises the following steps of: replacing a D-V-P-Q sequence at 7 to 10 positions of a micro plasminogen sequence with a K-G-D-W-P sequence; forming a convex Loop structure on the replaced sequence; and placing a K-G-D sequence at the top end of the Loop structure. Meanwhile, the invention provides application of the micro plasminogen mutant to preparation of a medicament for preventing and treating thrombotic diseases and ophthalmic diseases.
Owner:ZHENGZHOU UNIV

Targeted therapeutic proteins

Targeted therapeutics that localize to a specific subcellular compartment such as the lysosome are provided. The targeted therapeutics include a therapeutic agent and a targeting moiety that binds a receptor on an exterior surface of the cell, permitting proper subcellular localization of the targeted therapeutic upon internalization of the receptor. Nucleic acids, cells, and methods relating to the practice of the invention are also provided.
Owner:BIOMARIN PHARMA INC