658 results about "Staphylococcus" patented technology

The invention belongs to the technical field of antibiosis and wound healing promotion, and relates to double-response (near-infrared light and hydrogen peroxide double-response photo-thermal / carbon monoxide therapy) antibacterial hydrogel as well as preparation and application thereof. The invention relates to a double-response antibacterial hydrogel. The antibacterial hydrogel is prepared from the following components: drug-loaded nano particles and a hydrogel matrix. The drug-loaded nano particles are prepared by loading dimanganese decacarbonyl (MnCO) into cavities of hollow mesoporous copper sulphide nano particles (HMCuS NPs) and coating the surfaces of the particles with a polydopamine layer (PDA). According to the invention, CO / PTT synergistic treatment of bacterial infected wounds is realized, and the antibacterial effect is significantly improved. An in-vitro antibacterial experiment result shows that the antibacterial hydrogel shows extremely strong inhibition capability on escherichia coli and staphylococcus aureus, and the problem of drug resistance caused by a bacterial biofilm is effectively solved.

The invention discloses an antibacterial peptide fragment intercepted from chitinase IDGF4 protein and application of the antibacterial peptide fragment in preparation of antibacterial drugs. According to the invention, short peptide fragments in chitinase IDGF4 protein are screened, three candidate peptides are obtained through chemical synthesis, the antibacterial performance of the candidate peptides is systematically evaluated, and the evaluation result shows that the peptide fragment with the amino acid sequence as shown in SEQ ID No.2 can effectively inhibit the growth of salmonella and staphylococcus aureus under the concentration of 1mg / mL; the antibacterial effect of the compound is confirmed in inhibition zone experiments, enzyme-labeled turbidimetry and growth curve monitoring, and the compound shows stable and remarkable antibacterial activity and can be used as a novel antibacterial molecule; the invention provides a new candidate sequence for developing the antibacterial peptide with high efficiency and low drug resistance risk, and has application potential in the aspect of preparing clinical antibacterial drugs.

The invention relates to epsilon-polylysine epsilon-PL-loaded modified rice bran protein antibacterial nanoparticles as well as a preparation method and application thereof, and belongs to the technical field of preparation of nanoparticles. The preparation method comprises the following steps: extracting rice bran protein from defatted rice bran to prepare a rice bran protein stock solution; under continuous stirring, adding succinic anhydride into the rice bran protein stock solution to obtain acylated rice bran protein; mixing the acylated rice bran protein stock solution, the lactose stock solution and the epsilon-PL stock solution; and centrifuging and freeze-drying to obtain the epsilon-PL-loaded modified rice bran protein antibacterial nanoparticles. The preparation method disclosed by the invention is simple and low in cost, the prepared nanoparticles have smaller particle size and turbidity and higher stability, the hygroscopicity of epsilon-PL can be reduced to a great extent, the bioavailability of epsilon-PL can be improved, and the nanoparticles have an obvious bacteriostatic effect on escherichia coli and staphylococcus aureus.

The invention discloses an application of an antibacterial peptide and an application of the antibacterial peptide in preparation of antibacterial drugs for treating carbapenem-resistant pseudomonas aeruginosa, klebsiella pneumoniae (ATCC700603), escherichia coli (ATCC25922), staphylococcus aureus and methicillin-resistant staphylococcus aureus, the antibacterial peptide is characterized in that the sequence is w-r-r-w-k-r-w-w-r-r, and the sequence is shown in the description. All amino acids are D-type amino acids; the antibacterial peptide can be used as an antibacterial substance in wash supplies, food preservative additives, medical consumable antibacterial agents and cosmetics, can be synthesized through an Fmoc solid-phase chemical method, and is low in synthesis difficulty and good in in-vivo antibacterial activity. Particularly, the antibacterial peptide has broad-spectrum killing activity against carbapenem pseudomonas aeruginosa, klebsiella pneumoniae (ATCC700603), escherichia coli (ATCC25922), staphylococcus aureus and methicillin-resistant staphylococcus aureus, the cell survival rate of the antibacterial peptide within the range of medium and low concentration (2 mu g / mL-32 mu g / mL) reaches half or more, the toxicity is small, the toxicity is almost avoided, the operability is high, and the antibacterial peptide can be widely applied to the field of medical application. The cost is low.

The invention belongs to the technical field of antibacterial peptides, and particularly relates to an antibacterial peptide Mh-GC21 as well as a precursor and application thereof. The amino acid sequence of the antibacterial peptide Mh-GC21 provided by the invention is as shown in SEQ ID NO.1, and two cysteines are oxidized to form a pair of intermolecular disulfide bonds; the C tail end of the antibacterial peptide Mh-GC21 is subjected to amidation modification. The antibacterial peptide Mh-GC21 provided by the invention is from microhyla microcarpa, has broad-spectrum antibacterial activity, has relatively good antibacterial and bactericidal effects on standard strains of acinetobacter baumannii, escherichia coli and staphylococcus aureus and clinically sourced drug-resistant strains, and can be used for targeted destruction of cell membranes of bacteria, removal of biological membranes and inhibition of formation of the biological membranes. Moreover, the antibacterial peptide Mh-GC21 has the advantages of good stability, no hemolytic activity and cytotoxicity, and difficulty in inducing strains to generate drug resistance.

A Bifidobacterium longum subsp. longum dipro-017. The Bifidobacterium longum subsp. longum dipro-017 used has the ability to metabolize tryptophan to produce indole-3-lactic acid, can inhibit the pathogenic bacteria Salmonella Typhimurium, Staphylococcus aureus, and Escherichia coli, and can effectively mitigate weight loss caused by ulcerative colitis, improve a DAI score, improve colon length, mitigate the content of lipopolysaccharide (LPS) in blood, and increase the level of anti-inflammatory cytokine IL-10, as well as mitigate the content of bone metabolism indicators tartrate-resistant acid phosphatase (TRAP) and N-terminal propeptide of type I procollagen (PINP) in blood.

The invention discloses a lactobacillus paracasei strain with an effect of relieving inflammatory bowel diseases and application thereof, and belongs to the technical field of microbial fermentation. The strain is Lactobacillus paracasei JGSLP08, and the preservation number of the Lactobacillus paracasei JGSLP08 is CGMCC (China General Microbiological Culture Collection Center) NO.34274. The invention further discloses a preparation method of the Lactobacillus paracasei JGSLP08. The strain has the characteristics of strong acid resistance, bile salt resistance and gastrointestinal fluid resistance, can effectively inhibit salmonella typhimurium, escherichia coli and staphylococcus aureus, and has an excellent antioxidant effect. A DSS-induced colitis mouse model shows that the lactobacillus paracasei can effectively improve the DIA score of a mouse, regulate inflammatory factors, reduce oxidative stress injury, relieve inflammatory cell infiltration and protect the integrity of mucosal epithelium, so that the inflammatory bowel disease is relieved and / or treated.

The invention belongs to the technical field of fermentation engineering, and particularly relates to a staphylococcus pseudoxylosus strain and application of the staphylococcus pseudoxylosus strain in enhancing the flavor of fermented food, and the preservation number of the staphylococcus pseudoxylosus strain is GDMCC NO: 66815. The strain can produce lipase and protease, and can significantly enhance the content of flavor substances such as ketones, alcohols, esters, pyrazine furans and the like in fermented food. And inoculating the staphylococcus pseudoxylosus E2 into food to be fermented, and fermenting at 25-40 DEG C for 5-35 days. Compared with natural fermentation, the content of flavor substances in fermented food can be remarkably increased, and the method is suitable for commercialization.

The invention belongs to the technical field of bacterium detection, and discloses a multiple PCR primer for simultaneously detecting eight respiratory tract pathogenic bacteria and application thereof. On the basis of a Luminex liquid phase chip technology, specific primers are designed aiming at eight common respiratory tract infection pathogenic bacteria including pseudomonas aeruginosa, staphylococcus aureus, streptococcus pneumoniae, klebsiella pneumoniae, acinetobacter baumannii, stenotrophomonas maltophilia, haemophilus influenzae and escherichia coli; the multiple PCR primers which are high in amplification efficiency, good in specificity and suitable for simultaneously detecting the eight respiratory tract pathogenic bacteria are screened out, the multiple PCR system and microsphere hybridization conditions are continuously optimized, the multiple PCR method for the eight respiratory tract pathogenic bacteria is successfully constructed by applying the Luminex xTAG technology, and the multiple PCR method can be applied to rapid detection of multiple pathogenic microorganisms.

An Fc-binding polypeptide with improved alkaline stability comprising a mutant of the Fc-binding domain of Staphylococcus protein A (SpA), said mutant being defined by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 22, SEQ ID NO 51 or EQ ID NO 52, wherein at least the asparagine or serine residue at a position corresponding to position 11 in SEQ ID NO: 4-7 has been mutated to an amino acid selected from the group consisting of glutamic acid, lysine, tyrosine, threonine, phenylalanine, leucine, isoleucine, tryptophan, methionine, valine, alanine, histidine and arginine.

The invention belongs to the field of biosensing and microbiological detection, and relates to a staphylococcus aureus rapid counting method based on fluorescence confinement discretization. According to the method, oat bran is used as a natural carbon source, lysozyme active fragments are used as targeting ligands, targeting carbon quantum dots are synthesized through a one-step hydrothermal method, the targeting carbon quantum dots are modified by fluorescent dye SRB to obtain luminescence enhanced carbon quantum dots, and the luminescence enhanced carbon quantum dots can be specifically combined with cell walls of staphylococcus aureus, so that the staphylococcus aureus has stable fluorescence signals. And then, by taking the marked thalli as a core layer and a high-molecular polymer as a shell layer, preparing a core-shell nanofiber membrane by adopting a coaxial electrostatic spinning technology to realize spatial confinement and monomer discretization of the thalli, so that a group fluorescence signal is converted into a single-thalli distinguishable signal, and rapid and sensitive quantitative detection of the staphylococcus aureus is realized. The method is simple, convenient, high in sensitivity, suitable for rapid visualization and quantitative detection of staphylococcus aureus in foods such as dairy products, meat products and beverages, and wide in application prospect.

The invention provides a plant fiber containing a ginger extract and a preparation process of the plant fiber. After the plant fiber is washed for 50 times, the bacteriostasis rates of the plant fiber to staphylococcus aureus, escherichia coli, klebsiella pneumoniae and candida albicans are all greater than or equal to 95%, the killing rates of the plant fiber to influenza viruses H3N2 and H1N1 are all greater than or equal to 99%, the far infrared emissivity is 0.89-0.95, the highest temperature rise of moisture absorption and heating is 4-12 DEG C, and the average temperature rise is 3-8 DEG C. A vapor deposition method is adopted, a biomass component A and a biomass component B are combined to form a biomass component C, on one hand, the biomass component B serves as a tube bundle-shaped base material, rhizome plants are calcined to form a porous carbon structure framework, the porous carbon structure framework serves as a solid for vapor deposition, and a solution containing the biomass component A is small in gas molecular weight; after being vaporized along with the solution, the solution is caught by a porous structure of the biomass component B and uniformly filled into pores of the biomass component B, so that the durability of plant functions is ensured, and meanwhile, a protection effect at high temperature is achieved.

This invention relates to a 1,3,4-thiadiazole peptide deformylase inhibitor and its preparation and application. The structural formula is shown in formula (1): wherein, R 1 It is n-butyl or cyclopentylmethyl; R 2 The compounds are hydrogen-containing, straight-chain alkanes, cyclic alkanes, aromatic rings, substituted biphenyls, or heterocyclic rings. The 1,3,4-thiadiazole peptide deformylase inhibitors provided by this invention can effectively inhibit bacterial protein synthesis, thereby achieving sterilization. These compounds exhibit excellent inhibitory activity against Gram-positive drug-resistant bacteria, especially the clinically challenging methicillin-resistant Staphylococcus aureus (MRSA). In particular, some preferred compounds show inhibitory activity 4-8 times that of the control standards vancomycin and linezolid. The 1,3,4-thiadiazole peptide deformylase inhibitors provided by this invention also exhibit inhibitory activity against Gram-negative drug-resistant bacteria, especially against drug-resistant Acinetobacter baumannii, known as "superbugs," with an inhibitory activity reaching 0.5 μg / mL, far superior to vancomycin and linezolid.

The application discloses a staphylococcus and application of the staphylococcus in preparation of a control agent for tobacco black shank and tobacco bacterial wilt, relates to the technical field of microorganisms, and the staphylococcus 3C obtained by the application has obvious inhibiting effect on tobacco phytophthora and ralstonia solanacearum, and the fermentation liquor prepared from the staphylococcus 3C has obvious prevention and treatment effect on tobacco black shank and tobacco bacterial wilt.

The invention discloses multifunctional hydrogel as well as a preparation method and application thereof, and belongs to the technical field of medicines. The preparation method of the multifunctional hydrogel comprises the following steps: preparing an HAMA solution, a PVA solution and a MnO2 solution, constructing C18 / SDS / NaCl micelles, concentrating, mixing the components, adding a photoinitiator, carrying out ultraviolet curing, and carrying out circulating freeze thawing and cationic crosslinking to obtain a final product. The hydrogel disclosed by the invention has physiological-adaptive mechanical properties, strong adhesion in air / water, 99.8% of staphylococcus aureus resistance rate and 23.6% of ROS clearance rate in 12 hours, nearly 100% healing of mouse diabetic ulcer can be realized in 16 days, and the hydrogel is suitable for repairing chronic difficult-to-heal wounds and has remarkable clinical application value.

The application discloses a marine source penicillium and a fermentation method and application thereof. The marine source penicillium is named Penicillium sp. DSF059, and the preservation number is CCTCC NO: M 20232310. Penicilliu The application optimizes the culture condition of the strain, selects a culture medium and culture condition with high yield of antibacterial active compounds to carry out fermentation, so that more target products can be obtained, the operation is simple, the cost is low, and meanwhile, the marine source penicillium Penicilliu Penicillium sp. DSF059 can provide an excellent strain for new drug development of resisting plant pathogenic fungi such as coffee leaf blight, coffee brown spot disease, grape gray mold disease, Chinese cinnamon brown spot disease, citrus black rot disease, pepper late blight, hickory leaf blight, coffee black spot disease and four pathogenic fungi separated from coffee leaf diseases and Staphylococcus aureus, and has a good application prospect for preventing and treating the plant pathogenic fungi and Staphylococcus aureus.

The invention belongs to the technical field of food bacteriostatic agents, and particularly relates to a composite natural bacteriostatic agent and a preparation method and application thereof. The bacteriostatic agent comprises the following components in parts by weight: 2-4 parts of garlic powder, 1-3 parts of tea polyphenol and 1-3 parts of pediococcus pentosaceus freeze-dried powder. The natural plant source antibacterial components (garlic powder and tea polyphenol) and the microbial source antibacterial component (pediococcus pentosaceus freeze-dried powder) are scientifically compounded, so that a remarkable antibacterial effect is generated, and particularly, a high-efficiency inhibition effect is achieved on common putrefying bacteria (bacillus subtilis) and pathogenic bacteria (staphylococcus aureus) in meat prefabricated food.

The application provides a pediococcus acidilactici M4 for low-moisture fermented feed and an application thereof, and belongs to the field of microbial application and feed technology. The application uses the pediococcus acidilactici M4 to prepare fermented total mixed ration. The bacteria have the characteristics of high osmosis and fast acid production, and can reduce the pH value of the fermentation system in a short time; have strong broad-spectrum bacteriostatic effect on escherichia coli, chicken white dysentery salmonella and staphylococcus aureus; and perfectly adapt to the fermentation of low-moisture total mixed ration. The strain is used as the fermentation strain of low-moisture total mixed ration, can significantly reduce the content of acid detergent fiber and neutral detergent fiber, improve the crude protein level, and then improve the digestibility of the daily ration, increase the content of probiotics such as lactic acid bacteria and yeast in the daily ration, reduce the content of pathogenic bacteria such as escherichia coli in the daily ration, and also can improve the content of volatile fatty acid in the daily ration, improve the quality of the daily ration, and improve the feeding value of the daily ration.

The application belongs to the technical field of antibacterial peptides, and particularly relates to an antibacterial peptide Mp-GC21, a precursor thereof and application. The amino acid sequence of the antibacterial peptide Mp-GC21 is shown as SEQ ID NO:1, wherein the C terminal is subjected to amidation modification, and two cysteines are connected through a disulfide bond; and the amino acid sequence of the precursor is shown as SEQ ID NO:3. The antibacterial peptide Mp-GC21 is separated from the flower frog, has broad-spectrum antibacterial activity, and has good bacteriostatic and bactericidal effects on standard strains and clinically derived drug-resistant strains of Acinetobacter baumannii, Escherichia coli and Staphylococcus aureus, and can target to destroy the cell membrane of bacteria, remove the biofilm and inhibit the formation of the biofilm. Moreover, the antibacterial peptide Mp-GC21 has good stability, does not have hemolytic activity, cytotoxicity and in-vivo toxicity, and is not easy to induce drug resistance of strains.

The application discloses a fabric yellowing reagent and a fabric yellowing method, and relates to the technical field of daily chemical products. 5 The fabric yellowing reagent comprises 1-3% of histidine solution and a bacterial suspension with a bacterial concentration of 1*10 5 CFU / mL-9*10 The bacteria are a mixture of one or more of Staphylococcus epidermidis and Micrococcus luteus; the solvent of the histidine solution is normal saline containing 0.15-1% of trypsin peptone; and the solvent of the bacterial suspension is normal saline containing 0.1-0.2% of trypsin soybean peptone liquid culture medium. The fabric yellowing reagent can be used for simulating fabric yellowing, and has good operability, reproducibility and data reliability.

The invention relates to application of golden larch bark acetic acid in preparation of methicillin-resistant staphylococcus aureus (MRSA) biological membrane and bacterium holding inhibitor. A biological membrane formation inhibition experiment shows that the pseudolaric acid can remarkably inhibit formation of an MRSA biological membrane, a fluorescent quantitative PCR experiment shows that the pseudolaric acid remarkably reduces transcription of related genes of the MRSA biological membrane, and a persistent bacterium killing experiment shows that the pseudolaric acid enhances the killing capability of gentamicin on MRSA persistent bacteria. Lung epithelial cell adhesion tests find that the golden larch bark acetic acid significantly reduces the adhesion effect of the MRSA strain on epithelial cells. A test for constructing an MRSA infected greater wax moth model shows that the golden larch bark acetic acid has a system protection effect on the MRSA infected greater wax moth model.

The invention relates to the technical field of organic chemistry, and particularly discloses an amide derivative containing a thiazole oxime structure as shown in a general formula 8 and a preparation method and application of the amide derivative. The derivative shows remarkable antibacterial activity on staphylococcus aureus, escherichia coli, pseudomonas aeruginosa and fluoroquinolone-resistant escherichia coli, particularly has a remarkable effect on gram-negative bacteria, has broad-spectrum antibacterial potential and can be used for preparing drugs for treating related bacterial infection, and the activity of part of compounds is superior to that of a control drug.

The invention discloses a probe for targeting staphylococcus aureus and application of the probe. The amino acid sequence of a nano antibody in the probe is as follows: QVQLVESGGLVQPGGSLRLSCITSGSRFRFGAGW YRQAPGKSRERVAAINFGSF TNYADSVKGRFTISRDDAANTLYLQMNNLRPEDDTAVYYCNTGNYWGEGTQVTVSS, and the amino acid sequence of the nano antibody in the probe is as follows: the amino acid sequence of the nano antibody in the probe is as follows: QVQLVESGGLVQPGGSLSCITSGSRFGAGW YRQAPGKSRERVAAINFGSF The phage display nano antibody has the advantages of high sensitivity, high stability, low cost, easiness in modification, high biological safety and the like. The phage display nano antibody screened by the invention can realize direct detection of staphylococcus aureus, and has high accuracy. The sandwich sensor constructed by the invention can realize the detection limit of 158-2455 CFU / mL, and the detection limit is far lower than that of an existing immunological method.

The invention belongs to the technical field of natural pharmaceutical chemistry and medical application, and discloses a quinolone antibiotic synergist and application thereof in preparation of a medicine for treating bacterial infection. The structural formula of the quinolone antibiotic synergist is shown in the specification. The quinolone antibiotic synergist can effectively inhibit the activity of a staphylococcus aureus efflux pump, and the survival rate of mice infected with staphylococcus aureus can be remarkably increased when the quinolone antibiotic synergist is combined with quinolone antibiotics for use.

The application belongs to the technical field of antibacterial medicine, and particularly relates to a cinnamaldehyde-modified polypyridine ruthenium complex for inhibiting hemolysis, a preparation method and application thereof. The cinnamaldehyde-modified polypyridine ruthenium complex has a structure as shown in formula I. 1 , formula I 2 or formula I 3 The cinnamaldehyde-modified polypyridine ruthenium complex can effectively reduce the hemolysis of red blood cells caused by toxins released by Staphylococcus aureus, and the ruthenium complex does not induce the drug resistance of bacteria, and can significantly increase the sensitivity of Staphylococcus aureus to aminoglycoside antibiotics.

The invention relates to the technical field of pharmaceutical preparations, in particular to application of phencycloqualinium bromide as an antibacterial active component and a preparation of the phencycloqualinium bromide. It is found that benzene ring quinaldinium bromide can be used as an antibacterial active component and has an inhibiting effect on various common bacteria and fungi (including but not limited to staphylococcus aureus, pseudomonas aeruginosa, escherichia coli, aspergillus niger, candida albicans and the like); triethanolamine or other bacteriostatic activity enhancers are mixed with the phencycloqualinium bromide, so that the bacteriostatic activity of the phencycloqualinium bromide can be remarkably improved; when a benzene ring quinaldinium bromide related preparation is prepared, other bacteriostatic agent components are not added, a good bacteriostatic effect can still be achieved, and the safety is higher.

The present invention relates to an antibacterial or antifungal composition and a pharmaceutical composition for preventing or treating bacterial or fungal infections, both comprising VLX600. The antibacterial composition comprising VLX600 according to one aspect of the present invention exhibits antibacterial or antifungal activity against a wide range of strains, including Mycobacterium spp., Escherichia spp., Pseudomonas spp., Staphylococcus spp., Acinetobacter spp., Candida spp., and the like. The pharmaceutical composition comprising VLX600 demonstrates excellent antibacterial, antifungal, and therapeutic efficacy against pathogens and can be effectively utilized for the prevention or treatment of bacterial or fungal infections. Furthermore, VLX600 exhibits a synergistic effect with conventional antibiotics and thus is effective in treating infections caused by antibiotic-resistant bacterial strains.

The application discloses a bocachito Nat10 antibacterial peptide, a coding sequence and use and a preparation method thereof, and relates to a method based on multiomics, a biological big data based on multiomics data of bocachito, screening and identifying an antibacterial peptide precursor gene sequence, and obtaining an amino acid sequence of the bocachito Nat10 antibacterial peptide through translation design, as shown in SEQ ID NO: 3. Through activity simulation prediction and in-vitro experiment verification, the bocachito Nat10 antibacterial peptide shows inhibitory effects on the growth activities of Streptococcus agalactiae, Salmonella enteritidis, Staphylococcus aureus, Vibrio anguillarum and Escherichia coli, especially on Staphylococcus aureus, and shows the best antibacterial effect at a concentration of 2.5 micromoles per liter. The bocachito Nat10 antibacterial peptide can be used for preparing various bactericidal preparations, including bacteriostatic agents, medicines or additives, and has good practical value and social ecological benefits.

The application discloses a preparation method of near-infrared light enhanced response Cu, Fe-Lyz / AgNPs nanoscale enzyme. The method uses Cu, Fe doped carbon dots as a reducing agent to prepare silver nanoparticles, and then the silver nanoparticles are modified by lysozyme to prepare Cu, Fe-Lyz / AgNPs nanoscale enzyme with positive charges on the surface. The Cu, Fe-Lyz / AgNPs nanoscale enzyme has dual activities of peroxidase-like and glutathione oxidase-like and photo-thermal performance. Meanwhile, the near-infrared light can significantly enhance the POD-like activity of the nanoscale enzyme. The Cu, Fe-Lyz / AgNPs nanoscale enzyme has good antibacterial effect on escherichia coli and staphylococcus aureus. Meanwhile, based on the enhancement of the penicillin G potassium on the Cu, Fe-Lyz / AgNPs oxidase-like activity, the application establishes a rapid colorimetric detection method for the penicillin G potassium, and when the method is used for detecting the penicillin G potassium in blood plasma and milk powder samples, the detection limit is as low as 0.05 mu g / mL, and the method has high reliability and accuracy.