Tobacco cold-tolerance gene NtARR11L and its application
By identifying and using the NtARR11L gene, its low temperature tolerance is regulated in tobacco through genetic transformation or gene editing technology, the problem of tobacco sensitivity to low temperature stress is solved, and the effect of enhancing or reducing low temperature tolerance is achieved, providing gene resources and theoretical support for tobacco breeding.
Patent Information
- Application Number
- CN202410613709.2
- Authority / Receiving Office
- CN · China
- Patent Type
- Patents(China)
- Current Assignee / Owner
- Filing Date
- 2024-05-17
- Publication Date
- 2025-09-02
- Estimated Expiration
- 2044-05-17
AI Technical Summary
Tobacco is sensitive to low-temperature stress. The existing technology is difficult to fundamentally solve the growth problem of tobacco under low-temperature conditions. It mainly relies on timely transplanting and other methods to reduce losses, and lack effective low-temperature-resistant gene resources.
By identifying and using the NtARR11L gene, overexpressing or knocking out the NtARR11L protein-encoded gene in tobacco through genetic transformation or gene editing technology, enhancing or reducing its low temperature tolerance, gene editing technology is used to obtain low temperature or sensitive tobacco varieties.
It has achieved the enhancement or reduction of low-temperature tolerance in tobacco, provided important genetic resources and theoretical basis, laid the foundation for cultivating low-temperature or sensitive tobacco varieties, and reduced the impact on plant growth under low-temperature environments.
Smart Images

Figure BDA0004844426280000031 
Figure BDA0004844426280000041 
Figure BDA0004844426280000051
Abstract
Description
Technical Field
[0001] The invention belongs to the field of biotechnology, and particularly relates to a tobacco low-temperature-resistant gene NtARR11L and an application thereof. Background Art
[0002] Tobacco (Nicotiana tabacum L.), originating in warm South America, is a thermophilic, cold-tolerant leaf crop. Its optimum growth temperature is 25°C to 28°C. However, tobacco is sensitive to cold stress, with temperatures as low as -2°C to -3°C resulting in its death. Cold stress is particularly acute during the seedling stage. At the six- to seven-leaf stage, exposure to temperatures as low as 12°C for approximately two weeks can cause premature flowering, reducing leaf yield and quality, and ultimately, farmers' income. In tobacco-growing areas of southern China, tobacco plants are often subject to "late spring cold snaps" after transplanting, exposing them to cold stress. Currently, timely transplanting is the primary method of combating these "late spring cold snaps." While this approach can mitigate losses caused by cold temperatures to some extent, it does not fundamentally address the problem. Further research is needed to identify and characterize cold-tolerant genes in tobacco plants and to develop more tolerant varieties.
[0003] CBF (C-repeat binding factor) is an early-discovered transcription factor involved in plant response to cold stress. CBF transcription factors belong to the DREB subfamily of the AP2 / ERF (Apetala2 / Ethylene responsive factor) transcription factor family, and therefore all CBF transcription factors possess a highly conserved AP2 / ERF domain. Currently, the most well-studied cold signaling pathway is the ICE-CBF-COR (Inducer of CBF expression-C-repeat binding factor-Cold-responsive genes) pathway. In this pathway, ICE is rapidly expressed upon cold-induced expression, promoting CBF gene expression. CBF then binds to the CRT / DRE (C-repeat / dehydration-responsive element) cis-acting element in the COR gene promoter, activating COR gene expression and thereby enhancing plant resistance to cold.
[0004] Currently, the identification of low-temperature tolerance genes in tobacco is very limited. Summary of the Invention
[0005] In the early stages of this study, a gene called NtARR11L, which interacts with the key transcription factor NtCBF for low-temperature tolerance, was identified through a yeast two-hybrid screening library. Based on this, the present invention conducted functional characterization of this gene, providing genetic resources and a theoretical basis for molecular breeding of tobacco for low-temperature tolerance.
[0006] The present invention provides an application of an NtARR11L protein or a gene encoding the NtARR11L protein in cultivating plants or plant varieties with enhanced or reduced low-temperature tolerance.
[0007] In particular, the plant is dicotyledonous or monocotyledonous, preferably the plant is tobacco.
[0008] Among them, the enhancement of low temperature tolerance is achieved by overexpressing the NtARR11L protein encoding gene in plants.
[0009] Specifically, the overexpression is achieved by overexpressing the NtARR11L protein encoding gene in transgenic plants through genetic transformation, more specifically, the genetic transformation is carried out by Agrobacterium-mediated method or biolistic method.
[0010] The reduction in low temperature tolerance is achieved by knocking out the plant's endogenous NtARR11L protein encoding gene or weakening its expression. Specifically, the knockout is achieved by homologous recombination or gene editing; the weakening can be achieved by RNA interference or homologous recombination or gene editing. Preferably, the target used is TGTCGATGGAGAAACAAGCAGGG or ATGCACGAGGCAAGGGACATCGG.
[0011] Preferably, the amino acid sequence of the NtARR11L protein is as shown in SEQ ID No: 2, or a homologous NtARR11L protein derived from tobacco and having the same function, preferably, the sequence identity is above 99%.
[0012] Specifically, the CDS amino acid sequence of the NtARR11L protein encoding gene is shown in SEQ ID No: 1.
[0013] Optionally, the method further comprises the step of identifying the low temperature tolerance of the transgenic plant (for example, by treating the plant at 4°C for 6-12 hours and observing the appearance of the plant), and optionally further planting to obtain pure varieties.
[0014] Using gene editing technology, tobacco knockout mutants of the NtARR11L gene were generated. Phenotypic characterization of cold tolerance revealed that, compared to wild-type tobacco, both knockout lines exhibited more severe wilting under low-temperature stress and significantly reduced cold tolerance, indicating that NtARR11L positively regulates cold tolerance in tobacco. This suggests that overexpressing this gene in plants can also improve cold tolerance. The functional characterization of this gene provides an important genetic resource and theoretical foundation for cold tolerance breeding in tobacco. For example, plants sensitive to cold tolerance can be cultivated as control materials or breeding materials for specialized conditions, while plants with enhanced cold tolerance can be cultivated to reduce the impact of low temperatures on plant growth, thereby providing superior cold-tolerant varieties. BRIEF DESCRIPTION OF THE DRAWINGS
[0015] Figure 1 This is the phylogenetic tree analysis diagram of NtARR11L.
[0016] Figure 2 This is a homology comparison analysis diagram of the NtARR11L protein sequence.
[0017] Figure 3 The peak map near the arr11l-a target site (left) and the DNA sequence alignment map (right).
[0018] Figure 4 The peak map near the arr11l-b target site (left) and the DNA sequence alignment map (right).
[0019] Figure 5 This is the alignment diagram of the NtARR11L protein sequences in the knockout strains arr11l-a (top) and arr11l-b (bottom) and WT.
[0020] Figure 6 The phenotypes of the wild type and arr11l mutant strains after being treated with low temperature (4°C) for 8 hours. DETAILED DESCRIPTION
[0021] 1 Materials and Methods
[0022] 1.1 Gene sequence acquisition and feature analysis
[0023] Primers were designed using the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov) NtARR11L mRNA sequence (accession number: XM_016608935.1):
[0024] NtARR11L-CDS-F: TTGGGTCTCACACAGCTTCC
[0025] NtARR11L-CDS-R:CGTGGGTAGTTGCTGACCCTT
[0026] PCR product size: 2052 bp.
[0027] The gene was amplified from the cDNA of the leaves of the flue-cured tobacco variety Xiangyan No. 7. The PCR reaction system and procedure are as follows (Table 1):
[0028] Table 1 PCR reaction system and procedure
[0029]
[0030] The obtained PCR products were sequenced to determine the CDS sequence and protein sequence of the gene.
[0031] According to the NtARR11L protein sequence (accession number: XP_016464421.1), gene homology was analyzed using MEGA7.0 software and a phylogenetic tree was constructed using the neighbor-joining method. DNA, CDS, and protein sequences were aligned using DNAMAN software.
[0032] 1.2 Functional identification of NtARR11L in tobacco cold tolerance
[0033] 1.2.1 Construction of gene editing vector
[0034] (1) Target design
[0035] Using the online analysis tool http: / / crispor.gi.ucsc.edu / , we designed target sites within gene exons. The following two specific targets were identified: Target1, TGTCGATGGAGAAACAAGCAGGG, and Target2, ATGCACGAGGCAAGGGACATCGG. The first base and the final NGG residue were removed from both target sites, leaving only 19 nt. The 19-nt target sequence of Target1 (in italics) was inserted into primers DT1-F0 and DT1-BsF. The inverted complementary sequence of Target2 (in italics) was inserted into primers DT2-R0 and DT2-BsR.
[0036] Then, primers for constructing the CRSIPR vector were designed, and their sequence information is as follows:
[0037] DT1-BSF:ATATATGGTCTCGATTGGTCGATGGAGAAACAAGCAGTT
[0038] DT1-F0:TGGTCGATGGAGAAACAAGCAGTTTTAGAGCTAGAAATAGC
[0039] DT2-R0:ACTGCACGAGGCAAGGGACATCAATCTCTTAGTCGACTCTAC
[0040] DT2-BSR:ATTATTGGTCTCGAAACTGCACGAGGCAAGGGACATCAA
[0041] (2) PCR amplification
[0042] Four-primer PCR amplification was performed using the pCBC-DT1T2 vector (chloramphenicol resistance) as a template. DT1-BsF / DT2-BsR is the normal primer concentration (100 μM); DT1-F0 / primer DT2-R0 is the diluted concentration (10 μM). 4 μL of each of the four primers was taken and added to 4 μL of sterile water to prepare a 20 μL primer stock solution. High-fidelity enzyme For Max DNA Polymerase amplification, add 2 μL of primer master mix to 50 μL of the system. The PCR product size is 626 bp. PCR amplification was performed using the following protocol: denaturation at 98°C for 10 s, annealing at 55°C for 5 s, and extension at 72°C for 20 s for 30 cycles.
[0043] The target fragment (626 bp) was cut out under ultraviolet light by 1.5% agarose gel electrophoresis at 5 v / cm for 20 min, and the PCR product was recovered according to the operating instructions of a common agarose gel DNA recovery kit.
[0044] (3) Ligation of knockout vector
[0045] The connection system and reaction conditions are as follows (Table 2):
[0046] Table 2 Connection system
[0047]
[0048] (4) Transformation and identification
[0049] 10 μL of the ligation product was transformed into competent E. coli (following the competent E. coli transformation method in the kit).
[0050] Transform the cells onto kanamycin-resistant plates, incubate at 37°C for 12 h, and perform colony PCR using primers U626-IDF and U629-IDR. Sequencing was performed using primers U626-IDF and U629-IDF.
[0051] Pick 10 single colonies for PCR identification. The colony PCR and sequencing primers are as follows:
[0052] U626-IDF:TGTCCCAGGATTAGAATGATTAGGC
[0053] U629-IDF:TTAATCCAAACTACTGCAGCCTGAC
[0054] U629-IDR:AGCCCTCTTTCTTTCGATCCATCAAC
[0055] PCR product size: 726 bp.
[0056] The PCR reaction system and procedure are as follows (Table 3):
[0057] Table 3 Colony PCR reaction system and procedure
[0058]
[0059] Take 100 μL of the bacterial solution corresponding to the three positive bands of about 726 bp for sequencing, and inoculate the remaining 400 μL of bacterial solution into 10 ml of LB containing kanamycin resistance. Shake the tube and wait for the sequencing results to come out. Extract the plasmid from the bacterial solution with correct sequencing and store it in a -20℃ refrigerator.
[0060] 1.2.2 Tobacco genetic transformation
[0061] (1) Preparation of Agrobacterium
[0062] Add 1 μL of plasmid to 50 μL of GV3101 competent Agrobacterium cells (following the Agrobacterium transformation protocol in the kit). Transform into kanamycin-resistant plates and incubate at 28°C for 48 hours before colony PCR analysis. The PCR reaction system and procedure are shown in Table 3. PCR products were detected by gel electrophoresis. If the bacterial sample and positive control show clear, correctly sized electrophoretic bands, and the negative control shows no bands, the bacterial sample is suitable for tobacco transformation.
[0063] (2) Tobacco genetic transformation
[0064] Tobacco seeds (Xiangyan No. 7) were sterilized in 75% alcohol for 30 seconds, rinsed with sterile water for 1 minute, and then disinfected with 84 disinfectant for 3-5 minutes. Three rinses were performed with sterile water, each for 1 minute. The sterilized tobacco seeds were sown on germination medium at 23°C with a photoperiod of 16 hours light / 8 hours dark. The seeds were incubated for 4-5 weeks. Sterile tobacco leaves were cut into small pieces with a scalpel and inoculated onto the pre-incubation medium. Agrobacterium was selected and placed in the inoculation solution. An Agrobacterium suspension was prepared to an OD600 of 0.2. Tobacco leaves pre-incubated for 2-3 days were inoculated with the Agrobacterium suspension for 10-15 minutes. The inoculated leaves were then inoculated onto filter paper, the liquid was aspirated, and the leaves were inoculated onto co-cultivation medium for 48-72 hours. The leaves were then transferred to induction medium for callus induction, and callus tissue was grown for approximately 10 days. Select calli that meet the criteria and inoculate them onto a screening medium for the appropriate resistance. Incubate at 23°C with a photoperiod of 16 hours light / 8 hours dark for 15-30 days. Inoculate actively growing positive calli onto differentiation medium, 4-5 calli per dish. Incubate at the same temperature, photoperiod, and duration as for the screening medium. If seedlings form from the calli during differentiation, inoculate them onto seedling-strengthening medium for growth.
[0065] 1.2.3 Sequencing analysis of positive seedlings
[0066] Use Nanjing Novozymes Biotech Co., Ltd. Genomic DNA was extracted from leaves of positive seedlings using the Plant DNA Isolation MiniKit (refer to the manufacturer's instructions for detailed methods). PCR amplification of knockout lines was performed using the high-fidelity enzyme PrimeSTAR Max DNA Polymerase.
[0067] Two pairs of primers were designed for PCR detection of target sites Target1 and Target2 respectively.
[0068] Target site Target1 detection primer:
[0069] ARR11-F3: CTCTTTCCTTACGTACTAAC
[0070] ARR11-R3: GCCGGAAATAAAAAGCATTA
[0071] Target site Target2 detection primer:
[0072] ARR11-F4: TGCTGATTTTTCATATTACCTTTCC
[0073] ARR11-R4:TCTTTTGGTGCAACTTAAAGAGAAA
[0074] The target fragment length is approximately 350 bp.
[0075] The PCR amplification system and procedure are shown in Table 4.
[0076] Table 4 Target site detection PCR reaction system and procedure
[0077]
[0078] The resulting PCR products were sent to Beijing Qingke Biotechnology Co., Ltd. for sequencing. Sequencing peak plots and sequence alignment were analyzed using SnapGeneViewer and DNAMAN, respectively.
[0079] 1.2.4 Identification of low temperature tolerance of knockout strains
[0080] Seeds from transgenic pure lines and wild-type plants with uniformly plump and large grains were selected, sterilized, and placed in a 4°C low-temperature treatment for 48 hours. They were then sown in 9-cm-diameter pots and covered with transparent plastic lids to maintain heat and moisture. When the seeds reached four leaves and a single heart, the lids were removed. The incubation temperature was set at 23°C, and the photoperiod was set at 16 hours of light and 8 hours of darkness. Thirty days after sowing (at the six-leaf, one-heart stage), seedlings of uniform growth were selected and placed in a 4°C incubator for low-temperature treatment. The phenotypes were observed and photographed.
[0081] 2 Results Analysis
[0082] 2.1 Analysis of NtARR11L Sequence Characteristics
[0083] The CDS sequence and protein sequence of NtARR11L were obtained by PCR amplification and sequencing.
[0084] (1) NtARR11L CDS sequence (SEQ ID NO: 1):
[0085] ATGATGGAGAATAGTAAGACCACTGCAGGGTTTTCTTCTCCAAGAAGTGATAATTTCCCGGCTGGTCTACGGGTTTCTTGT
[0086] TGTTGATGATGATCCTACCTGGTTGAAAATTCTTGAAAAGATGCTTAAGAAGTGCTCTTATGAAGTGACGGTATGTGGTC
[0087] TAGCACGAGAGGCTCTGAATCTGCTCCGAGAAAGAAAGGATGGGTTTGACATTGTGATTAGTGATGTTAACATGCCTGAC
[0088] ATGGATGGATTTAAGCTTCTTGAGCATGTTGGACTTGAGATGGATCTTCTCTGTCATAATGATGTCTGTCGATGGAGAAAC
[0089] AAGCAGGGTGATGAAGGGCGTTCAACACGGTGCATGTGATTATCTCTTGAAGCCTATACGGATGAAAGAACTTAGAAACA
[0090] TATGGCAGCATGTCCTCAGAAAAGGATGCACGAGGCAAGGGACATCGGAAACCATGAAATGGACCAATTTGATGAAGTG
[0091] TGGATGCTTAATGGAACTGAACTCCTTTCGGGCAAGAAGAGAAAAGATTTTGACAATGAAAAAGAAATTTCTGATTCAAG
[0092] ATGTGTTGATTCTTCTTCCATGAAGAAAGCCAGAGTAGTTTGGACTGTAGATCTTCATCAGAAATTTGTCAAAGCCGTAA
[0093] ACCAGATTGGATTTGACAAAGCTGGTCCCAAGAAGATACTGGACTTGATGGGTGTTCCATGGTTGACTAGAGAAAATGTT
[0094] GCTAGCCACTTACAGAAGTATCGCCTATACTTGACTAGGTTGCAGAAAGAAAATGAAGTCAAAGCTTCATTTTGTGGGAT
[0095] GAAGCATCCGAATGTTTCTTCTAAAGAAAATTCTCCTCAGAATCCAGTGGATGTGTGCGCTGATGTTATAAATGACAAGT
[0096] GTAGTGGTGTTTCTGGAGACAAGGCTATTGTTCAAAATGGGAAGGCCAACATATATGAGAGCAAGGTAAAGGGTGTTGTT
[0097] TCAATGCCAGTAGCAGAGCCTAGGTCTGTGGTTGGAGATAACTTTGGTTCAAAGACAAGCCTCAGTGATTCCTTTGCATT
[0098] GATCAATACCGATGTAAAAAGTCTCAATGTACCCACTCCATATTGCTTTACTGGAGAAGCTCCACAACCTCAATACAAAC
[0099] AAGATTTCAAACCACGTTTTCCGTCTTGCACACAACCAACTTGTTCTCTCAACTTTGTACCTTCTCATGAAGTGAGGGAC
[0100] AGAGTTTCCAGTAAAGAAAATAAGCCTTCTTTCTTCAAGAGCAGAAGTGGAGTAGGAAAATTATCTGCATTGGAAGCCAT
[0101] TCAACCTGTGAGCCATCAAATAAATTTTCATGCTCTTGAGCAAATTCCAAGTACTACATGGAGTATGACGAGTCAAAATG
[0102] TAGATCAAAATCTAGTCAATGGTCTGCAATCAAGCCCAGGAAATCTAACTTTGGGAAGTGGATCAGTTGTTGCATCTCTA
[0103] GGTGAGGATGCTTCTATTCAAGGTGAATGTTTTCCAGCTTATTATGGACTTCGGAACATACAACAATTTGACTACAGTGA
[0104] TCCACAAACCATTTCTGGAGTTCCAACATGCTTGTATGATACATTGAGGTTTGATTATGAGTATCCAAATGATTCATTGGAAGGTATTGTGTTGGACCAAGGTCTGTTCATAGTCTAA。 [[ID=2३]]
[0105] (2) NtARR11L protein sequence (SEQ ID NO: २):
[0106] It should be noted that there seems to be an error in the original text where "NtARR11L蛋白序列(SEQ ID NO:2)" is followed by some text in Chinese and then the translation continues with the English text. Also, the tags and
[0105] seem to be left untranslated in the expected format. If this is a special requirement to keep them as is, then the above translation is adjusted accordingly. If not, please clarify for a more accurate translation. Additionally, the "२" in the translation of "SEQ ID NO: २" should probably be "2" for a more standard English representation.MMENSKTTAGFSSPRSDNFPAGLRVLVVDDDPTWLKILEKMLKKCSYEVTVCGLAREALNLLRERKDGFDIVISDVNMPD
[0107] MDGFKLLEHVGLEMDLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELRNIWQHVLRKRMHEARDIGNHEMDQFDEV
[0108] WMLNGTELLSGKKRKDFDNEKEISDSRCVDSSSMKKARVVWTVDLHQKFVKAVNQIGFDKAGPKKILDLMGVPWLTRENV
[0109] ASHLQKYRLYLTRLQKENEVKASFCGMKHPNVSSKENSPQNPVDVCADVINDKCSGVSGDKAIVQNGKANIYESKVKGVV
[0110] SMPVAEPRSVVGDNFGSKTSLSDSFALINTDVKSLNVPTPYCFTGEAPQPQYKQDFKPRFPSCTQPTCSLNFVPSHEVRD
[0111] RVSSKENKPSFFKSSRSGVGKLSALEAIQPVSHQINFHALEQIPSTTWSMTSQNVDQNLVNGLQSSPGNLTLGSGSVVASLGEDASIQGECFPAYYGLRNIQQFDYSDPQTISGVPTCLYDTLRFDYEYPNDSLEGIVLDQGLFIV.
[0112] Phylogenetic tree analysis revealed that NtARR11L is most closely related to NsARR11L of Nicotiana tabacum ( Figure 1 Protein sequence comparison analysis found that the NtARR11L protein sequence has a high homology with the ARR11L gene of Solanaceae crops ( Figure 2 ).
[0113] 2.2 Screening of arr11l homozygous knockout strains
[0114] By sequencing and analyzing the target sites of transgenic positive seedlings, two successfully edited lines, arr11l-a and arr11l-b, were screened, and both had mutations in target 2. The mutation site of the arr11l-a line was a clear single peak ( Figure 3The left figure in the middle shows that the strain is a homozygous mutation. Sequence alignment revealed that a base A was inserted near the second target site ( Figure 3 Middle right figure); the mutation site of arr11l-b strain is a clear single peak ( Figure 4 Left middle image), indicating that this strain is a homozygous mutation. Sequence alignment revealed a deletion of two bases AC near the second target site ( Figure 4 Protein sequence alignment revealed that NtARR11L protein translation terminated prematurely in arr11l-a and arr11l-b strains ( Figure 5 ), indicating that the function of the NtARR11L gene was disrupted in these two knockout lines.
[0115] 2.3 Functional identification of the NtARR11L gene in tobacco low temperature tolerance
[0116] like Figure 6 As shown, under normal temperature conditions, the NtARR11L knockout lines arr11l-a and arr11l-b showed no significant phenotype differences from Xiangyan 7 (WT). After 8 hours of low-temperature treatment at 4°C, the two knockout lines arr11l-a and arr11l-b experienced whole-plant wilting, while the WT leaves only showed slight drooping. These results indicate that the chilling tolerance of the arr11l-a and arr11l-b lines is significantly reduced. These results suggest that NtARR11L positively regulates chilling tolerance in tobacco.
Claims
1. A use of an NtARR11L protein or a gene encoding the NtARR11L protein in cultivating a transgenic plant or transgenic plant variety with reduced low-temperature tolerance; the reduced low-temperature tolerance is achieved by knocking out the endogenous NtARR11L protein encoding gene in the plant or weakening its expression; the plant is tobacco; The amino acid sequence of the NtARR11L protein is shown in SEQ ID No:
2.
2. The use according to claim 1, characterized in that The knockout is achieved by homologous gene recombination or gene editing; the attenuation is achieved by RNA interference.
3. The use according to claim 2, characterized in that The targets used were tgtcgatggagaaacaagcaggg or atgcacgaggcaagggacatcgg.
4. The use according to claim 1, wherein The CDS sequence of the NtARR11L protein encoding gene is shown in SEQ ID No:
1.
5. The use according to any one of claims 1 to 4, characterized in that It is characterized by: The method also includes the step of identifying the low temperature tolerance of the transgenic plant.
6. The use according to claim 5, characterized in that The low temperature tolerance of the transgenic plants was determined by treating the plants at 4°C for 6-12 hours and observing the appearance of the plants.
7. The use according to claim 6, characterized in that It also includes the step of further cultivation to obtain purebreds.
Citation Information
Patent Citations
Tobacco low-temperature-resistant gene NtZFP66L1 and application thereof
CN116716315A
Plant having resistance to low-temperature stress and method of production thereof
WO2010004070A1