FtACA13 gene from tartary buckwheat, its expression vector and application

Abstract

The invention discloses a kind of tartary buckwheat-derived FtACA13 Gene and its expression vector and application. The present invention is separated from tartary buckwheat FtACA13 gene; FTACA13 The polynucleotide sequence of the gene is shown in SEQ ID NO.1, and the amino acid sequence of the encoded protein is shown in SEQ ID NO.2. FtACA13 Genetic transformation of buckwheat to obtain overexpression FtACA13 Compared with the control group, the transgenic buckwheat hairy roots overexpressed FtACA13 The growth and fresh weight of hairy roots of buckwheat with the gene increased under salt stress, and the Na + The accumulation is significantly lower, proving FtACA13 The gene can regulate the salt stress resistance of plants, and the present invention has application prospects in cultivating or breeding salt stress-resistant plant varieties, etc.

Description

Technical Field

[0001] The present invention relates to plant-derived Ca 2+ -ATPase and its encoding gene FtACA13 , especially the Ca isolated from Tartary Buckwheat 2+ -ATPase, its encoding gene FtACA13 and its expression vector and its application in regulating plant salt stress resistance, belonging to FtACA13 Genes and their applications. Background Art

[0002] Tartary buckwheat, a cultivated dicotyledonous plant of the genus Fagopyrum in the Polygonaceae family, is rich in minerals and trace elements. It exhibits strong environmental adaptability, a short growing season, and tolerance to cold, infertile conditions. Tartary buckwheat is highly tolerant to salinity and alkalinity, enabling it to grow in saline-alkali soils and improve soil conditions through its physiological properties. This makes it an ideal crop for improving and utilizing saline-alkali land. Tartary buckwheat exhibits high adaptability to poor soils and harsh environments. Its ability to grow in low-nutrient, arid, or salinized soils has led to its widespread cultivation in saline-alkali areas. Cultivating tartary buckwheat effectively utilizes land previously unsuitable for traditional crops. However, the genetic background and key regulatory genes underlying salt-alkali tolerance in tartary buckwheat remain largely unknown. Summary of the Invention

[0003] One of the purposes of the present invention is to provide a Ca isolated from tartary buckwheat. 2+ -ATPase and its encoding gene;

[0004] Another object of the present invention is to provide a method comprising 2+ - an expression cassette of a gene encoding an ATPase, a recombinant expression vector, or a recombinant host cell containing the recombinant expression vector;

[0005] The third object of the present invention is to separate the Ca 2+ -ATPase and its encoding gene, containing the Ca 2+ The expression cassette of the gene encoding the -ATPase, the recombinant expression vector or the recombinant host cell containing the recombinant expression vector is used to regulate the salt stress resistance of plants or cultivate salt stress-resistant plant varieties.

[0006] In order to achieve the above objectives, the main technical solutions adopted by the present invention include:

[0007] One aspect of the present invention provides Ca isolated from tartary buckwheat 2+ -ATPase encoding gene FtACA13 .

[0008] The Ca 2+ -ATPase encoding gene FtACA13 The nucleotide sequence is the nucleotide sequence shown in (a) or (b):

[0009] (a) the polynucleotide sequence shown in SEQ ID NO. 1;

[0010] (b) A polynucleotide sequence encoding the amino acid sequence shown in SEQ ID NO.2.

[0011] Another aspect of the present invention provides Ca isolated from tartary buckwheat. 2+ -ATPase FtACA13.

[0012] The Ca 2+ The amino acid sequence of the -ATPase FtACA13 is shown in (a) or (b):

[0013] (a) amino acids shown in SEQ ID NO. 2;

[0014] (b) A protein variant derived from the amino acid sequence shown in SEQ ID NO. 2 by substitution, deletion or / and insertion of one or more amino acid residues, which still has the function or activity of transporting heavy metal ions.

[0015] Protein variants of the present invention may be produced by genetic polymorphism or artificial manipulation, and these manipulations are generally known in the art. For example, Ca can be prepared by mutation of DNA. 2+ -Amino acid sequence variants or fragments of the ATPase FtACA13, wherein the methods of mutagenesis or alteration of polynucleotides are well known in the art. Among them, conservative substitutions are replacements of one amino acid residue with another amino acid having similar properties.

[0016] The present invention also provides a method comprising 2+ -ATPase FtACA13 The invention relates to a recombinant plant expression vector of a gene and a host cell containing the recombinant plant expression vector.

[0017] Chimeric genes or expression cassettes obtained by chimerizing or connecting the gene shown in SEQ ID NO. 1 of the present invention with other genes fall within the scope of protection of the present invention; recombinant expression vectors containing the chimeric genes or expression cassettes also fall within the scope of protection of the present invention.

[0018] Another aspect of the present invention is to separate the Ca 2+ -ATPase and its encoding gene, containing the Ca 2+-ATPase encoding gene expression cassette, recombinant expression vector or recombinant host cell containing the recombinant expression vector is used to regulate the salt stress resistance of plants.

[0019] In a preferred embodiment of the present invention, the regulation of plant salt stress resistance is to improve plant salt stress resistance, including: promoting plant growth under salt stress or reducing Na + accumulation.

[0020] For reference, the present invention provides an embodiment. 2+ -ATPase encoding gene is overexpressed to improve the plant's resistance to salt stress related to Ca 2+ -ATPase expression or activity, thereby improving the plant's resistance to salt stress.

[0021] A preferred embodiment of the present invention is a method for improving the salt stress resistance of plants, comprising: overexpressing Ca in plants 2+ -ATPase FtACA13 Gene, Ca 2+ -ATPase FtACA13 Increased gene expression or Ca 2 + -ATPase FtACA13 function or activity is enhanced; for example, Ca from buckwheat is 2+ -ATPase FtACA13 The gene is connected to the expression control element to obtain a recombinant plant expression vector for expressing the gene in plants; the recombinant plant expression vector is transformed into plants to make Ca 2+ -ATPase FtACA13 The gene is overexpressed in plants, and the resulting transgenic plants have enhanced salt stress resistance.

[0022] For reference, the present invention provides a Ca 2+ -ATPase FtACA13 Gene plant recombinant expression vector, comprising: Ca derived from tartary buckwheat 2+ -ATPase FtACA13The gene is linked to an expression control element to produce a recombinant plant expression vector. The recombinant plant expression vector may consist of a 5' non-coding region (SEQ ID NO. 1) and a 3' non-coding region. The 5' non-coding region may include a promoter sequence, an enhancer sequence, and / or a translation enhancing sequence. The promoter may be a constitutive promoter, an inducible promoter, or a tissue- or organ-specific promoter. The 3' non-coding region may include a terminator sequence, an mRNA cleavage sequence, and the like. Suitable terminator sequences can be obtained from the Ti-plasmid of Agrobacterium tumefaciens, such as the octopine synthase and nopaline synthase terminator regions.

[0023] The recombinant plant expression vector may also contain a selectable marker gene for selecting transformed cells or tissues. Such marker genes include genes encoding antibiotic resistance and genes conferring resistance to herbicidal compounds. Furthermore, such marker genes also include phenotypic markers, such as β-galactosidase and fluorescent protein.

[0024] The transformation protocol and the protocol for introducing the polynucleotide or polypeptide into the plant may vary depending on the type of plant or plant cell being transformed. Suitable methods for introducing the polynucleotide into plant cells include microinjection, electroporation, Agrobacterium-mediated transformation, direct gene transfer, and high-speed ballistic bombardment. In certain embodiments, various transient transformation methods may be used to introduce the tartary buckwheat Ca 2+ -ATPase FtACA13 The gene is provided to the plant. The transformed cells can be regenerated into stably transformed plants using conventional methods (McCormick et al. Plant Cell Reports. 1986. 5:81-84).

[0025] The present invention also provides a method for cultivating a plant variety tolerant to salt stress, comprising: (1) constructing a Ca-containing 2+ -ATPase FtACA13 (2) transforming the constructed recombinant plant expression vector into plant tissues or plant cells; (3) 2+ -ATPase FtACA13 Genes are overexpressed in plant tissues or cells to screen plant varieties with improved salt stress resistance.

[0026] In a preferred embodiment of the present invention, the plant is a plant of the genus Fagopyrum.

[0027] The present invention cloned Ca from tartary buckwheat 2+ -ATPase FtACA13 Gene, the present invention uses genetic engineering to 2+ -ATPase FtACA13Genetic transformation of tartary buckwheat explants to obtain overexpression FtACA13 Compared with the control group, the transgenic buckwheat hairy roots overexpressed FtACA13 The growth and fresh weight of hairy roots of buckwheat with the gene increased under salt stress, and the Na + Accumulation is significantly lower; proof FtACA13 The gene can regulate the salt stress resistance of plants. 2+ -The study of the function of ATPase family proteins has application prospects in the cultivation or selection of salt-alkali tolerant plant varieties.

[0028] Definitions of terms used in this invention

[0029] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.

[0030] The term "polynucleotide" or "nucleotide" means deoxyribonucleotides, deoxyribonucleosides, ribonucleosides, or ribonucleotides and polymers thereof in single-stranded or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides that have binding properties similar to the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise specifically limited, the term also refers to oligonucleotide analogs, including PNA (peptide nucleic acid), DNA analogs used in antisense technology (phosphorothioates, phosphamidates, etc.). Unless otherwise specified, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (including but not limited to degenerate codon substitutions) and complementary sequences as well as explicitly specified sequences. In particular, degenerate codon substitutions can be achieved by generating a sequence in which position 3 of one or more selected (or all) codons is substituted with mixed bases and / or deoxyinosine residues.

[0031] The terms "polypeptide," "peptide," and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. That is, a description directed to a polypeptide applies equally to describing a peptide and describing a protein, and vice versa. The terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally encoded amino acid. As used herein, the terms encompass amino acid chains of any length, including full-length proteins (i.e., antigens), in which the amino acid residues are linked via covalent peptide bonds.

[0032] As used herein, "stringent hybridization conditions" refer to conditions of low ionic strength and high temperature as known in the art. Generally, under stringent conditions, the detectable degree of hybridization of a probe to its target sequence is higher than the detectable degree of hybridization to other sequences (e.g., at least 2-fold above background). Stringent hybridization conditions are sequence-dependent and will vary under different environmental conditions, with longer sequences hybridizing specifically at higher temperatures. By controlling the stringency of hybridization or washing conditions, target sequences that are 100% complementary to the probe can be identified. For detailed guidance on nucleic acid hybridization, reference is made to the relevant literature (Tijssen, et al., 2001). Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays. 1993). More specifically, the stringent conditions are usually selected to be lower than the thermal melting point (T) of the specific sequence at a defined ionic strength pH. m ) about 5-10℃. T m The temperature (under specified ionic strength, pH, and nucleic acid concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (because the target sequence is present in excess, the temperature at T m Stringent conditions may be those in which the salt concentration is less than about 1.0 M sodium ion concentration, typically about 0.01 to 1.0 M sodium ion concentration (or other salts), at pH 7.0 to 8.3, and the temperature is at least about 30°C for short probes (including but not limited to, 10 to 50 nucleotides) and at least about 60°C for long probes (including but not limited to, greater than 50 nucleotides). Stringent conditions may also be achieved by the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal may be at least two times background hybridization, optionally 10 times background hybridization. Exemplary stringent hybridization conditions may be as follows: 50% formamide, 5× SSC, and 1% SDS, incubation at 42°C; or 5× SSC, 1% SDS, incubation at 65°C, wash in 0.2× SSC, and wash in 0.1% SDS at 65°C. The washing may be performed for 5, 15, 30, 60, 120 minutes or longer.

[0033] The term "recombinant host cell strain" or "host cell" refers to a cell comprising a polynucleotide of the present invention, regardless of the method used for insertion to produce the recombinant host cell, such as direct uptake, transduction, f-mating, or other methods known in the art. The exogenous polynucleotide may be maintained as a non-integrating vector, such as a plasmid, or may be integrated into the host genome. The host cell may be a prokaryotic cell or a eukaryotic cell, and the host cell may also be a monocotyledonous or dicotyledonous plant cell.

[0034] The term "operably linked" refers to a functional connection between two or more elements. The operably linked elements may be contiguous or non-contiguous.

[0035] The term "recombinant plant expression vector" refers to one or more DNA vectors used to achieve plant transformation; these vectors are often referred to in the art as binary vectors. Binary vectors, along with vectors with helper plasmids, are most commonly used for Agrobacterium-mediated transformation. Binary vectors typically include the cis-acting sequences required for T-DNA transfer, a selectable marker engineered for expression in plant cells, and the heterologous DNA sequence to be transcribed.

[0036] The term "transformation" refers to a process by which a heterologous DNA sequence is introduced into a host cell or organism.

[0037] The term "expression" refers to the transcription and / or translation of an endogenous gene or a transgene in a plant cell. BRIEF DESCRIPTION OF THE DRAWINGS

[0038] Figure 1 for FtACA13 Figure 2 shows the cloning results of the gene CDS.

[0039] Figure 2 For overexpression FtACA13 PCR identification of Tartary Buckwheat hairy roots with the gene; N is a negative control, the material is wild-type hairy roots; P is a positive control, the material is FtACA13 pCAMBIA 1307- constructed from the CDS sequence of the gene FtACA13 Recombinant plasmid.

[0040] Figure 3 For overexpression FtACA13 Tartary buckwheat hairy roots containing the gene and Tartary buckwheat hairy roots containing the empty vector pCAMBIA 1307 FtACA13 The relative expression levels of genes were detected by qRT-PCR.

[0041] Figure 4 The hairy roots of the control group and the overexpression FtACA13 Phenotype of hairy roots of the gene under excess NaCl treatment.

[0042] Figure 5 The hairy roots of the control group and the overexpression FtACA13 Fresh weight statistics of hairy roots of the gene under excess NaCl treatment.

[0043] Figure 6 The hairy roots of the control group and the overexpression FtACA13 Na in hairy roots + Content statistics chart. DETAILED DESCRIPTION

[0044] The present invention will be further described below in conjunction with specific embodiments, and the advantages and features of the present invention will become clearer as the description proceeds. However, it should be understood that the embodiments are merely exemplary and do not limit the scope of the present invention in any way. It should be understood by those skilled in the art that the details and forms of the technical solutions of the present invention may be modified or replaced without departing from the spirit and scope of the present invention, but such modifications or replacements fall within the scope of protection of the present invention.

[0045] Example Ca 2+ -ATPase FtACA13 Cloning of gene CDS

[0046] 100 mg of leaves from 4-week-old buckwheat seedlings were thoroughly ground in liquid nitrogen, and total RNA was extracted using the Trizol method. This RNA was used as a template for reverse transcription using the HiScript® III 1st Strand cDNA Synthesis Kit (+gDNAwiper) (Nanjing Novozymes Biotechnology Co., Ltd.) to obtain cDNA from buckwheat (Pinku No. 1).

[0047] according to FtACA13 Specific primers were designed for the ORF of the gene. The nucleotide sequences of the primers used are as follows:

[0048] FtACA13- F: ATGGTGATGGAGGAGATAAAAGCAAG (SEQ ID NO.3);

[0049] FtACA13- R: TGAAACTGGAATGCACTTGGCTAAC (SEQ ID NO. 4).

[0050] PCR amplification was performed using the cDNA of tartary buckwheat (Pinku No. 1) as a template to obtain the CDS sequence of the target gene ( Figure 1 ).

[0051] The PCR program was 95°C for 3 min, followed by 32 cycles of 95°C for 30 s, 56°C for 60 s, and 72°C for 90 s. The purified PCR products were sequenced, analyzed, and assembled. FtACA13 Full-length sequence of the gene.

[0052] FtACA13

[0053] FtACA13 The amino acid sequence of the protein encoded by the gene is shown in SEQ ID NO.2: MVMEEIKQEFEVLHVEAFNSEKKRSGVVVRRKGEDGVHVHWKGAAEMIVAICSKYYDHVGMMKAMDDYERSRFIETIQGMAAKSLRCIAFAHKTTKVFDHDDNLGEMTLIGIVGLKDPCRPGVKEAVECCRNAGVNIKMVTGDNVFTAKVIAIECGILNQDDLNDESIVEGKDFRSYSDEERMARVESIRVMARSSPFDKLLMVRCLKQRGHVVAVTGDGTNDAPALKEADIGL SMGIQGTKVAKESSDIVILDDNFASVVTVSRWGRCVYSNIQKFIQFQLTVNAAALTINFVAAVSSGNIPLTAVQLLWVNLIMDTLGALALATEQPTNDLMKKPPVGRTEPLVTRVMWRNL ILQAVYQVVVLLTLQFKGESIFGVDRRVKDTLIFNCFVFCQVFNEFNARELEKKNIFQGVLKNKLFLGIVGVTVVLQVIMVEFLKRFANTERLNWAQWGACIGIAIVSWPIGWLAKCIPVS (SEQ ID NO. 2).

[0054] Test Example 1 Ca 2+ -ATPase FtACA13 Detection of gene expression and expression levels in Tartary Buckwheat hairy roots

[0055] Design homologous recombination primers to FtACA13 The PCR purified product of the gene was used as template and 1307-FtACA13-F / R as primers for PCR amplification. FtACA13 Full-length sequence of the gene.

[0056] The nucleotide sequence of primer 1307-FtACA13-F / R is as follows:

[0057] 1307-FtACA13-F:gtatctagaactagtggatccATGGGTGATGGAGGAGATAAAGCAAG (SEQ IDNO.5);

[0058] 1307-FtACA13-R:gtcgacggtatcgataagcttTGAAACTGGAATGCACTTGGCTAAC (SEQ ID NO. 6).

[0059] After subsequent recovery and ligation transformation, FtACA13 The full-length sequence was inserted into the downstream of the CaMV35S promoter of the pCAMBIA 1307 vector in the forward direction, and the overexpression vector pCAMBIA 1307- FtACA13 .

[0060] Sequencing confirmed the correct pCAMBIA 1307- FtACA13 The recombinant plasmid and the pCAMBIA 1307 empty vector plasmid were transformed into Agrobacterium rhizogenes A4 competent cells by heat shock method. FtACA13 Recombinant plasmid-positive bacteria, pCAMBIA 1307 empty vector-positive bacteria.

[0061] pCAMBIA 1307- FtACA13 Recombinant plasmid-positive bacteria and pCAMBIA 1307 empty vector-positive bacteria were picked into liquid culture medium and shaken at 28°C and 200 rpm until OD 600 =0.8, use the bacterial solution to infect the leaves and stems of the tartary buckwheat variety Ku Yihao, place them on MS solid culture medium containing 25 mg / L hygromycin (Hyg) resistance, and culture them for 1-2 weeks. Those that can grow hairy roots are preliminarily identified as candidate positive hairy roots.

[0062] The transformation was successfully detected by PCR using primers 1307-F / R of the pCAMBIA 1307 vector. The PCR procedure was the same as described above. qRT-PCR was performed using primers FtACA13-qPCR-F / R. FtACA13 The expression level of the gene. FtACTIN The gene was used as an internal reference, and the primers used were FtACTIN-qPCR-F / R. Real-time fluorescence quantitative PCR (qRT-PCR) was used for detection on a BAI 7500 real-time fluorescence quantitative PCR instrument. FtACA13 The expression level of the gene. In this experiment, RQ (relative expression level) = 2 -ΔΔCT The relative expression level of the target gene was calculated using the algorithm, and the expression value of the hairy roots transformed with the empty vector was set to 1. Three biological replicates were performed.

[0063] The nucleotide sequences of primers 1307-F / R, FtACA13-qPCR-F / R, and FtACTIN-qPCR-F / R are as follows:

[0064] 1307-F:GAGAGCTTGGGCGACCTCA (SEQ ID NO.7);

[0065] 1307-R: GAGAGAGACTGGTGATTTTTGC (SEQ ID NO. 8).

[0066] FtACA13-qPCR-F: GGTGAGATGACCTTGATTGGGATAGTT (SEQ ID NO.9);

[0067] FtACA13-qPCR-R: GATTCAAGATCCCACACTCGATTGC (SEQ ID NO. 10).

[0068] FtACTIN-qPCR-F: ATGGCAGAATCTGAGGACATTCAG (SEQ ID NO. 11);

[0069] FtACTIN-qPCR-R: GAAACACTTTCTGTGGACAATTGATG (SEQ ID NO. 12).

[0070] PCR test results such as Figure 2 As shown, three overexpression FtACA13 The hairy roots of genes (OE1, OE2, OE3); qRT-PCR test results are as follows Figure 3 As shown, overexpression FtACA13 Hairy roots FtACA13 The gene expression level was higher than that in hairy roots transformed with pCAMBIA-1300 (CK).

[0071] Test Example 2 FtACA13 Experiment on Gene Regulation of Salt Stress Resistance in Tartary Buckwheat

[0072] 1 Test method

[0073] Overexpression FtACA13 Equal amounts of the gene-transfected hairy roots and the hairy roots transformed with pCAMBIA-1300 were transferred to MS solid medium containing 50 mM NaCl and cultured for 2 weeks. Three biological replicates were set up to observe the growth of the hairy roots and weigh the fresh weight of the hairy roots.

[0074] Hairy roots were dried at 80°C for 5 days, crushed, and filtered through a 40-mesh sieve. 0.2000 g (accurate to 0.0001 g) of sample was accurately weighed and placed in a 15-ml digestion tube. 1 ml of distilled water and 4 ml of a HNO₃-H₂O₂ mixture were added. After a short period of stagnation, the tube was placed in an inner barrel and digested using an ultra-microwave digestion system (EXPEC 790S, China). After digestion, the sample was transferred to a 50-ml plastic volumetric flask and sodium was determined using an inductively coupled plasma mass spectrometer (SUPEC 7000, Puyu Technology, Hangzhou, China). + The concentration of the elements was determined by three biological replicates.

[0075] 2 Test results

[0076] Overexpression FtACA13 After 2 weeks of treatment with 50 mM NaCl, the hairy roots of the gene showed a significant growth trend ( Figure 4 ) and fresh weight ( Figure 5 ) was significantly better than the control group (CK), indicating that overexpression FtACA13 The hairy roots of the gene showed strong tolerance to salt stress. The hairy roots treated with NaCl were detected by ICP-MS. + Compared with the control group (CK), the three overexpression FtACA13 Na + The accumulation was significantly lower ( Figure 6 The above results show that FtACA13 Genes can improve salt tolerance and reduce Na in buckwheat + The accumulation of FtACA13 Genes can make buckwheat Na + Ions are repelled outside the cell, preventing them from entering the cell.

Claims

1. Ca 2+ -ATPase FtACA13 Gene, Ca 2+ -ATPase FtACA13 Gene encoding protein, containing Ca 2+ -ATPase FtACA13 Gene expression cassette or recombinant expression vector, or containing Ca 2+ -ATPase FtACA13 The application of a recombinant host cell containing a gene in regulating the salt stress resistance of tartary buckwheat is characterized by: Reducing Na in Tartary Buckwheat under Salt Stress + accumulation; The Ca 2+ -ATPase FtACA13 The polynucleotide sequence of the gene is shown as (a) or (b): (a) the polynucleotide sequence shown in SEQ ID NO. 1; (b) a polynucleotide sequence encoding the amino acid sequence shown in SEQ ID NO. 2; The Ca 2+ -ATPase FtACA13 The amino acid sequence of the protein encoded by the gene is shown in SEQ ID NO.

2.

2. The use according to claim 1, characterized in that: (1) Constructing a Ca 2+ -ATPase FtACA13 (2) transforming the constructed recombinant expression vector into buckwheat tissue or plant cells; (3) 2+ -ATPase FtACA13 The gene is overexpressed in buckwheat tissues or cells to improve the salt stress resistance of buckwheat.

3. A method for cultivating a salt-stress-tolerant tartary buckwheat variety, characterized by: (1) Constructing Ca 2+ -ATPase FtACA13 (2) transforming the constructed recombinant expression vector into buckwheat tissue or plant cells; (3) 2+ -ATPase FtACA13 Overexpression of the gene in tartary buckwheat tissues or cells to screen for tartary buckwheat varieties with improved salt stress resistance; The Ca 2+ -ATPase FtACA13 The polynucleotide sequence of the gene is shown as (a) or (b): (a) the polynucleotide sequence shown in SEQ ID NO. 1; (b) a polynucleotide sequence encoding the amino acid sequence shown in SEQ ID NO. 2; The Ca 2+ -ATPase FtACA13 The amino acid sequence of the protein encoded by the gene is shown in SEQ ID NO.2.

Images