porcine sperm-specific antibodies, their preparation methods and applications
By developing a fusion of porcine sperm-specific nanobodies with Fc fragments and using immunomagnetic beads for magnetic sorting, the problem of low porcine sperm separation efficiency in existing technologies has been solved, achieving efficient and low-cost sex control of porcine semen.
Patent Information
- Authority / Receiving Office
- CN · China
- Patent Type
- Patents(China)
- Current Assignee / Owner
- Filing Date
- 2025-01-06
- Publication Date
- 2026-03-10
AI Technical Summary
Existing technologies are insufficient for efficiently separating X and Y sperm in pig semen. Traditional methods such as Percoll density gradient centrifugation and flow cytometry have problems such as low efficiency, high cost, or damage to sperm motility in pig semen sorting. Immunoassay sorting is less effective in pigs and cannot meet production needs.
We developed porcine sperm-specific nanobodies, optimized the coding sequence using a eukaryotic expression system, prepared recombinant expression antibodies and fused them with Fc fragments, and used immunomagnetic beads for magnetic sorting to achieve efficient and stable separation of X and Y sperm.
It achieves efficient and low-cost pig sperm sorting, with strong antibody specificity and low immunogenicity, making it suitable for industrial applications. It has high sorting efficiency and minimal damage to sperm, simplifying the technology for controlling the sex of pig semen.
Smart Images

Figure CN119751670B_ABST
Abstract
Description
Technical Field
[0001] This invention relates to the fields of antibody preparation and animal breeding, and particularly to a porcine sperm-specific antibody, its preparation method, and its application. Background Technology
[0002] Sex control is a core technology in reproductive biology research, playing a vital role in animal breeding, genetic disease prevention and control, and livestock production. To address practical issues such as livestock quantity and yield, utilizing sex control technology to promote livestock development is essential. Sex control technology is a modern biotechnology that, through artificial selection and separation of X and Y sperm, ultimately yields offspring of the desired sex, possessing significant theoretical and practical implications. Firstly, sex control technology can fully utilize the growth rate and meat quality of male animals, and the reproductive and lactation performance of female animals, thereby achieving substantial economic benefits. Secondly, it can enhance the selection intensity of superior traits, accelerate the breeding process, reduce breeding costs, and maximize genetic progress. Furthermore, controlling the sex of offspring can overcome phenomena such as twin infertility and eliminate the harmful effects of sex-linked genes. Sex-controlled semen can be prepared into frozen semen and inseminated with selected sex for optimal production. Therefore, efficient and accurate separation of sex-controlled semen has become a key research direction in sex control technology, and its research has significant practical production value in livestock production.
[0003] Currently, the main methods for preparing sex-controlled semen from pigs (sorting of pig X and Y sperm) include Percoll density gradient centrifugation, flow cytometry sorting, and immunoassay for X and Y sperm sorting. Regarding Percoll density gradient centrifugation: Cao Shizhen et al.'s research showed that using Percoll discontinuous density gradient separation of bovine qualitative semen resulted in significant differences in the sex ratio of offspring, with the proportion of females in the offspring of qualitative semen rich in X sperm exceeding 60%. Percoll density gradient centrifugation is simple to operate and low in cost; however, during centrifugation, sperm cells easily produce high concentrations of reactive oxygen species (ROS), which damage sperm motility and reduce sperm integrity. Regarding flow cytometry sorting: Xiong Xianrong et al. added Allura Red to their flow cytometry setup to stain and eliminate sperm with incomplete plasma membranes, significantly enhancing the motility of sorted yak sperm and, to some extent, improving the conception rate of sex-controlled frozen semen. However, Zeng Quanyou et al., after using flow cytometry to separate pig sperm for insemination, achieved a 100% litter size with Y sperm and a 91.67% female litter size with X sperm, although the litter size showed a declining trend. Flow cytometry sorting of X and Y sperm is currently a widely used sex control technology in actual production, but its application in sorting pig semen is limited. This is mainly because the volume of semen required for pig insemination is very large, while the efficiency of flow cytometry sorting is limited, making it difficult to meet the required number of inseminations. Furthermore, the longer the flow cytometry sorting process, the greater the sperm loss. Therefore, flow cytometry sorting of X and Y sperm is not currently suitable for the sex control needs of pigs in actual production. Regarding the immunoassay method for sorting X and Y sperm: Studies by Umehara et al. have shown that the TLR7 / 8 encoded by the X chromosome is expressed in the midsection and tail of X sperm, but not in Y sperm. Umehara et al. further used TLR7 / 8 to isolate mouse sperm. Under conditions of added R848 ligand, the motility of X and Y sperm in mice differed significantly, and the solution showed a stratified state. The motility of X sperm was inhibited, and it was located in the lower layer. When R848 was removed, the motility of X sperm was restored, and it still retained its fertilization capacity. Fa Ren et al. obtained the same results when using the TLR7 / 8 receptor in their study of isolating X and Y sperm in dairy goats, and demonstrated that TLR7 / 8 can directly regulate the ATP levels in dairy goats to affect X sperm motility. Liu Weidong's research showed that in beef bovine semen, the TLR7 / 8 agonist R848 could significantly reduce the motility of X sperm, but had no significant effect on sperm acrosome integrity and plasma membrane integrity. Furthermore, using R848 to sort fresh beef bovine semen, the purity of Y sperm reached 88.6%, and the purity of X sperm reached 72.5%. Although the TRL7 / 8 sperm sorting method has a low accuracy rate, it is simple and convenient to operate, does not damage sperm during the test, does not require expensive equipment, and saves production costs.However, R848 and R837 are not very effective in separating boar sperm. A study by Wu Changhua et al. (2023), postgraduate students at South China Agricultural University, showed almost no difference in the expression of R848 and R837 ligands in boar X / Y sperm, thus failing to achieve the separation objective. Currently, related research has been conducted on separating sex-controlled semen from cattle, sheep, and mice, but research on separating boar sperm is still lacking. This is mainly because the large quantity required for boar insemination makes traditional flow cytometry unable to meet the requirements of sex-controlled semen separation in production practice.
[0004] Therefore, there is an urgent need to develop a new antibody and a method for efficiently separating X and Y sperm to meet the needs of sex control in pig semen. Summary of the Invention
[0005] The purpose of this invention is to provide a novel porcine sperm-specific antibody that can efficiently and specifically bind to X or Y sperm, thereby achieving efficient separation of X and Y sperm and enabling rapid and stable sorting of porcine semen to solve the aforementioned problems.
[0006] According to a first aspect of the present invention, a porcine sperm-specific antibody is provided, the coding sequence of which is shown in any one of SEQ ID No: 1-3. This antibody is a nanobody, only 10% the size of a conventional antibody, with a simpler structure, and possesses advantages such as high stability, strong specificity, and low immunogenicity. It enables large-scale antibody expression, significantly reducing antibody production costs and facilitating industrial application.
[0007] According to a second aspect of the present invention, a porcine sperm-specific antibody is provided. This antibody is optimized based on the codon usage preferences of a eukaryotic expression system, and the coding sequence of the optimized antibody is shown in SEQ ID No:4. This antibody coding sequence, optimized according to the codon usage preferences of a eukaryotic expression system, can specifically bind to porcine sperm, thus enabling better sorting of porcine semen. Furthermore, this antibody is a nanobody, only 10% the size of traditional antibodies, with a simpler structure, and possesses advantages such as high stability, strong specificity, and low immunogenicity. It allows for large-scale antibody expression, significantly reducing antibody production costs and facilitating industrial application.
[0008] According to a third aspect of the present invention, a porcine sperm-specific antibody is provided, which is a recombinant expression antibody fused with an exogenous Fc fragment, the amino acid sequence of which is shown in SEQ ID No:5. This recombinant expression antibody is formed by fusing a selected nanobody with the Fc fragment of an exogenous (rabbit-derived) IGg antibody to form a VHH-Fc antibody. Upon binding to sperm, it can induce sperm agglutination. The fused Fc fragment can be used to aggregate and couple streptavidin or protein A / G magnetic beads, and to prepare magnetic beads specifically for porcine sperm immunosorting.
[0009] According to a fourth aspect of the present invention, a method for preparing porcine sperm-specific antibodies is provided. The method includes the following steps: S1: immunizing alpacas with whole porcine sperm to prepare a porcine sperm-specific nanobody library; S2: panning the library prepared in step S1; S3: screening the panned library for antibodies that specifically bind to sperm. This method is the first to use whole porcine sperm as an immunogen to immunize alpacas to prepare a nanobody library, achieving a library capacity of 3.4 × 10⁻⁶. 8 PFU has a higher antibody library abundance, higher coverage of whole sperm antigens, and a more complete range of antibody types, thereby improving the capture success rate of porcine sex control specific antibodies. It can efficiently screen out positive antibodies and easily obtain the coding sequence of each antibody, enabling large-scale antibody expression and greatly reducing antibody production costs.
[0010] In some embodiments, the above method may further include the following steps: S1: Immunizing alpacas with whole porcine sperm, and then isolating alpaca peripheral blood cells after immunization; S2: Extracting RNA from peripheral blood cells, reverse transcribing to obtain cDNA, and amplifying the VHH coding sequence of the antibody; S3: Cloning the amplified VHH coding sequence into a phage plasmid vector to prepare a recombinant phage vector carrying the porcine sperm antibody gene; S4: Transforming the recombinant phage vector into E. coli and expanding its culture to obtain a porcine sperm antibody phage display library; S5: Using porcine X / Y sperm to pan the phage display library obtained in step S4 to construct a porcine sperm-specific nanobody library: using X sperm for negative selection and Y sperm for positive selection, and panning to construct a Y sperm-specific nanobody library; using Y sperm for negative selection and X sperm for positive selection, and panning to construct an X sperm-specific nanobody library.
[0011] According to a fifth aspect of the present invention, a porcine sperm-specific antibody prepared using the above-described preparation method is provided. Thus, the above method provides a simple, rapid, efficient, and stable way to obtain positive antibodies with high specificity, high sorting efficiency, strong specificity, and minimal damage to sperm.
[0012] According to a sixth aspect of the present invention, the application of porcine sperm-specific antibodies in the sorting of porcine X and Y sperm is provided. Thus, through this application, efficient sorting of porcine sperm can be achieved, laying the foundation for sex control of porcine semen in production.
[0013] According to a seventh aspect of the present invention, the use of a porcine sperm-specific antibody in the preparation of products for porcine sperm sorting is provided. Thus, products for sperm sorting prepared using this antibody (such as kits, immunomagnetic beads, etc.) can rapidly and efficiently sort sperm, enabling sex control in pigs.
[0014] According to an eighth aspect of the present invention, a method for sorting pig X and Y sperm is provided. The method includes the following steps: S1: Biotinylating a recombinant expression antibody with an amino acid sequence as shown in SEQ ID No:5, and then labeling the biotinylated recombinant expression antibody onto streptavidin magnetic beads to prepare biotinylated immunomagnetic beads; S2: Diluting the semen to be sorted and adding the immunomagnetic beads, incubating at room temperature, and then placing it on a magnetic rack. Sperm that did not bind to the magnetic beads in the supernatant are then collected. The sperm enriched by the immunomagnetic beads after removing the supernatant are then resuspended to obtain sperm of the other sex. Thus, by preparing biotinylated immunomagnetic beads from this antibody and performing magnetic sorting, sperm of one sex are found in the supernatant that did not bind to the magnetic beads, while sperm of the other sex are enriched by the magnetic beads. This allows for simple, convenient, and efficient sorting of pig sperm and achieves sex control of pig semen.
[0015] In some embodiments, the conditions for sperm sorting are: magnetic bead diameter of 300 nm or 1 μm; room temperature incubation time of 30 minutes or more; and sperm density of 350 million / mL or more.
[0016] According to a ninth aspect of the present invention, a method for sorting pig X and Y sperm is provided. The method includes the following steps: S1: Immobilizing a recombinant expression antibody with an amino acid sequence as shown in SEQ ID No:5 onto Protein A / G magnetic beads to construct Protein A / G immunomagnetic beads; S2: Diluting the semen to be sorted and adding Protein A / G immunomagnetic beads, collecting sperm that are not enriched with the magnetic beads from the supernatant, and collecting sperm that are enriched with the magnetic beads separately, thereby achieving the sorting of X and Y sperm. Thus, through magnetic sorting, pig sperm can be sorted simply, conveniently, and efficiently, achieving sexual control of pig semen.
[0017] The beneficial effects of this invention are as follows: A nanobody library is prepared by immunizing alpacas with whole porcine sperm. This library can then be used to screen for antibodies that specifically bind to X or Y sperm, enabling the separation of X and Y sperm. Furthermore, the screened antibodies are nanobodies, only 10% the size of traditional antibodies, with a simpler structure, high stability, strong specificity, and low immunogenicity. This allows for large-scale antibody expression, significantly reducing antibody production costs and facilitating industrial application. When the screened antibodies are applied to sex control in porcine semen, the different binding abilities of the antibodies to X and Y sperm induce agglutination reactions in sperm of specific sexes. For example, antibody W17 can induce X sperm agglutination, achieving an enrichment efficiency of 80% for X sperm. Therefore, X sperm can be efficiently enriched using W17 antibody immunomagnetic beads (unenriched sperm are Y sperm), thus achieving efficient sorting of pig X and Y sperm. Moreover, the separation of X and Y sperm using this antibody and its sorting method is highly efficient and causes little damage to sperm, which is more advantageous than sperm flow cytometry technology. It does not rely on expensive equipment and professional technicians, which is conducive to establishing an economical and efficient pig semen sex control technology. Attached Figure Description
[0018] Figure 1 Figure showing the results of monoclonal antibody abundance analysis for porcine sperm panning library;
[0019] Figure 2 Figure showing the results of monoclonal antibody binding specificity analysis for porcine sperm screening libraries;
[0020] Figure 3 Figure showing the results of differential antibody flow cytometry analysis;
[0021] Figure 4 This is a diagram showing the location of the differentially bound antibody.
[0022] Figure 5 Image showing the diameter screening results of W17 biotin-based immunomagnetic beads;
[0023] Figure 6 Figure showing the results of optimized incubation time for W17 biotin-based immunomagnetic beads;
[0024] Figure 7 Figure showing the results of optimized sperm density during incubation;
[0025] Figure 8 Figure showing the results of optimized dosage of biotin immunomagnetic beads;
[0026] Figure 9 The image shows the enrichment results of W17 biotin-based immunomagnetic beads on semen from different pig breeds.
[0027] Figure 10 Image showing the effect of protein A / G immunomagnetic beads on bovine semen sorting;
[0028] Figure 11The results of the agglutination effect of immunomagnetic beads on porcine sperm. Detailed Implementation
[0029] The invention will now be described in further detail with reference to the accompanying drawings.
[0030] Example 1: Construction and Panning of a Pig Whole Sperm Immunization Alpaca Nanobody Library
[0031] 1.1 Construction of a library of porcine sperm-immunized alpaca nanobody
[0032] Healthy alpacas were selected, and 10 million fresh boar sperm were collected. These sperm were centrifuged at 800g for 10 minutes at room temperature, the supernatant was discarded, and the cells were washed with 1 mL of PBS. This process was repeated twice. After washing, the cells were resuspended in 1 mL of PBS and subcutaneously injected into the alpacas for immunization. A booster immunization was performed 14 days later, and this process was repeated three times. During the immunization process, alpaca serum was isolated, and the titer of boar sperm-specific antibodies in the serum was monitored using immunofluorescence. After the antibody titer stabilized, alpaca peripheral blood cells (PBMCs) were isolated, total RNA was extracted, and reverse transcribed into cDNA. The coding sequence of the variable region (VHH) of the alpaca antibody heavy chain was amplified using the cDNA as a template and cloned into the phage plasmid pCom3XSS. ( The plasmid was electroporated into TG1 Escherichia coli (Apak Biotechnology, P001), and the culture was expanded to obtain an antibody bacterial library. The library size was determined to be 3.4 × 10⁻⁶. 8 PFU was detected with a positive rate of 96% and a diversity of 100%. The bacterial library was added to 100 mL of 2×TY medium until the OD600 reached 0.1, and cultured at 37℃ and 250 rpm until the OD600 reached approximately 0.5. Helper phage M13KO7 (New England Biolabs (NEB, N0315S)) was added at a ratio of 1:20 (bacterial count: helper phage count) for rescue, and the culture was expanded. The progeny phages were purified using PEG / NaCl solution, and the resulting primary antibody phage library was determined to have a titer of 1.2 × 10⁻⁶. 14 pfu / mL.
[0033] 1.2 Screening of Targeted Swine Sperm-Specific Nanobodies
[0034] 10 million fresh bovine sperm were collected, washed three times with PBS, resuspended in 2 mL of PBS, and added to 6-well cell cultures at a ratio of 10 million sperm per well. The cells were centrifuged at 1200 g for 10 minutes, the supernatant was removed, and the cells were dried at 37-50 °C. The cells were fixed with 4% paraformaldehyde for 15 minutes and blocked with 3% BSA solution for 1 hour. After washing three times with PBS, the wells without sperm fixation were used as blank controls. A bovine sperm-immunized alpaca nanobody library was added for the first round of panning. Positive phages from the first round of screening were recovered and amplified, and the resulting screening antibody library was used for the next round of panning. Using the same method, flow cytometry-sorted porcine X sperm and Y sperm were immobilized into 12-well cell culture plates. X sperm were used for negative selection and Y sperm for positive selection, or Y sperm for negative selection and X sperm for positive selection. This process was repeated for 4-7 rounds. The number of positive phages in each round was measured. The positive rate of each round was calculated by dividing the number of bound phages by the number of phages introduced, in order to evaluate the antibody enrichment effect.
[0035] Seven rounds of positive screening were performed on the nanobody library using porcine Y sperm, resulting in effective enrichment of the library. The seventh round (using 5.76 × 10⁻⁶ sperm samples) yielded the best results. 7 PFU and the number of phages bound to the virus were 5.04 × 10⁻⁶. 4 The positive rate was 8.75 × 10⁻⁶. -4 The selection process was compared to the first round (3.40 x 10 documents were used). 11 PFU and the number of phages bound to the virus were 5.06 × 10⁻⁶. 5 The positive rate was 1.49 × 10⁻⁶. -6 The antibody library was enriched 587 times (Table 1).
[0036] Table 1. Results of the selection of porcine Y sperm-specific nanobodies
[0037] Selection rounds Library usage / pfu Phage number / pfu Positive rate Round 1 3.40 x 10 11 ]]> 5.06 x 10 5 ]] 1.49 x 10 -6 ]] Round 2 5.06 x 10 8 ]] 1.83 x 10 5 ]]> 3.62 x 10 -4 ]] Round 3 1.83 x 10 8 ]]> 3.78 x 10 5 ]] 2.07 x 10 -3 ]]> Round 4 3.78 x 10 8 ]]> 3.50 x 10 5 ]]> 9.26 x 10 -4 ]]> Round 5 3.50 x 10 8 ]]> <![CDATA[8.64×10 4 ]]> <![CDATA[2.47×10 -4 ]]> Round 6 <![CDATA[8.64×10 7 ]]> <![CDATA[5.76×10 4 ]]> <![CDATA[6.67×10 -4 ]]> Round 7 <![CDATA[5.76×10 7 ]]> <![CDATA[5.04×10 4 ]]> <![CDATA[8.75×10 -4 ]]>
[0038] Note: Positive rate = Nth round of screening, number of phages / amount of library used.
[0039] Four rounds of positive screening using porcine X sperm were conducted to enrich the nanobody library. The library was effectively enriched in the fourth round (using 5.76 × 10⁻⁶ cells / mL). 8 PFU and phage binding count: 1.05 × 10⁻⁶ 6 The positive rate was 1.82 × 10⁻⁶. -3 The selection process, compared to the first round (with a document usage of 3.40 × 10), involved a significant increase in the number of documents used. 11 PFU and the number of phages bound to the virus were 5.06 × 10⁻⁶. 5 The positive rate was 1.49 × 10⁻⁶. -6The antibody library was enriched 1221-fold. To reduce the size of the X sperm-specific library and simplify antibody identification, phages were added at 100 times the size of the fourth-round screening library for a fifth round of screening, yielding 2.64 × 10⁻⁶ positive phages. 4 (Table 2)
[0040] Table 2. Results of the selection of porcine X sperm-specific nanobodies
[0041] Selection rounds Library usage / pfu Phage number / pfu Positive rate Round 1 <![CDATA[3.40×10 11 ]]> <![CDATA[5.06×10 5 ]]> <![CDATA[1.49×10 -6 ]]> Round 2 <![CDATA[5.06×10 8 ]]> <![CDATA[4.08×10 5 ]]> <![CDATA[8.06×10 -4 ]]> Round 3 <![CDATA[4.08×10 8 ]]> <![CDATA[5.76×10 5 ]]> <![CDATA[1.41×10 -3 ]]> Round 4 <![CDATA[5.76×10 8 ]]> <![CDATA[1.05×10 6 ]]> <![CDATA[1.82×10 -3 ]]> Round 5 <![CDATA[1.05×10 8 ]]> <![CDATA[2.60×10 4 ]]> <![CDATA[2.48×10 -4 ]]>
[0042] Note: Positive ratio = Nth round of screening, combined with phage count / amount of library used. Example 2: Functional validation of porcine sperm-specific nanobody library and screening of specific antibodies.
[0043] The antibody library eluent obtained in Example 2 was used to infect TG1 Escherichia coli, plated on 2×TY solid culture plates containing ampicillin, and cultured overnight. Single colonies were picked and sent to BGI Genomics for first-generation sequencing to analyze antibody coding sequence information and abundance. The results of single-clone colony sequencing and abundance analysis are as follows: Figure 1 As shown in the figure: After screening of pig sperm, positive antibodies were effectively enriched, with the highest abundance being 13.19%. Finally, 47 nanobodies with the highest sequence abundance were selected for subsequent specific detection.
[0044] Pig X and Y sperm were sorted by flow cytometry, then centrifuged at 800g for 10 minutes. The supernatant was removed, and the cells were resuspended in CBS coating buffer (pH 9.6). 300,000 sperm cells per well were added to a 96-well ELISA plate and incubated overnight at 4°C. The supernatant was gently removed, and the cells were dried at 50°C. The plates were fixed with 4% paraformaldehyde for 15 minutes, blocked with 3% BSA for 1 hour, and washed three times with PBST. Wells containing phage cells without antibody were used as negative controls, and wells without antibody were used as blank controls. The same amount of the same antibody strain was added to both X and Y sperm wells, and the plates were incubated at room temperature for 2 hours. After washing three times with PBST, the secondary antibody anti-M13 Bacteriophage (HRP) (11973-MM05T-H, Sino Biological Inc) was added, and the plates were incubated at room temperature for 1 hour. After washing six times with PBST, the plates were developed with TMB chromogenic buffer, and the OD370 absorbance was measured to screen for differentially binding antibodies to X and Y sperm. The binding specificity of 47 highly abundant antibodies was detected using ELISA technology. A specificity screening criterion was a ratio of X sperm OD370 value to Y sperm OD370 value (OD370-X / Y) greater than or equal to 1.3. Figure 2 The results showed that 11 antibodies had a stronger binding ability to X sperm, namely W9, W10, W14, W17, W23, W37, W56, W57, W81, S92, and S94.
[0045] Immunofluorescence and flow cytometry were used to analyze the binding site and specificity of differentially expressed antibodies on the sperm membrane surface. One hundred million fresh porcine sperm cells were collected, washed three times with PBS, fixed with 4% paraformaldehyde at room temperature for 15 minutes, blocked with 3% BSA for 1 hour, and washed three times with PBST. Using phages that did not display antibodies as a control, the selected differentially expressed antibodies were added, and the cells were incubated at room temperature for 2 hours, washed three times with PBST, and then incubated with the secondary antibody anti-M13 Bacteriophage (FITC) (11973-MM05T-P; SinoBiological Inc.) for 1 hour at room temperature. The cells were washed 10 times with PBST and resuspended in 1 mL of PBS. 700 μL of the antibody was used to incubate the sperm cells, and the fluorescence ratio was detected by flow cytometry to analyze antibody specificity. Separately, 300 μL of antibody was incubated in sperm cells in a 48-well cell culture plate. The plate was centrifuged at 1200 g for 10 minutes, the supernatant was discarded, and DAPI staining solution was added. The plate was incubated at room temperature for 20 minutes, and the binding sites of the antibody on the sperm membrane were observed under a fluorescence microscope. Flow cytometry analysis results are as follows: Figure 3 As shown, all 11 antibodies (W9, W10, W14, W17, W23, W37, W56, W57, W81, S92, and S94) exhibited high affinity for porcine sperm. W17 showed the strongest specificity, followed by W37 and W57. Therefore, antibody W17 was selected for subsequent research. Fluorescence observation results are shown below. Figure 4 As shown, the binding sites of all 11 antibodies were located on the mitochondrial sheath at the sperm tail, indicating that the antibodies can specifically recognize and bind to sperm.
[0046] Analysis of the first-generation sequencing results revealed the coding sequences for the W17, W37, and W57 antibodies as shown in SEQ ID No: 1-3:
[0047] W17 antibody coding sequence (SEQ ID No:1):
[0048] GATGTGCAGCTGCAGGAGTCTGGAGGAGGCTTGGTGCAGGCTGGGGGGTCTCTGAGACTCACCTGTGCAGCCTCTAGAAGCATCGACAATATCCTTACCATGGGCTGGTACCGCCAGGCTCCAGGGAAGCAGCGCGAGTCGGTCGCGCGAATTCCTAATGGTAGTACTACAATCTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACACAGTCTATCTACAAATGAATAGCCTGAAACCTGAGGACACAGCCGTCTATTACTGTGCAGCCGGGTATGAGGACAGCGACTACAAAGGGAATGACTACTGGGGCCAGGGGACCCAGGTCACCGTCTCCAGC
[0049] W37 antibody coding sequence (SEQ ID No: 2):
[0050] GATGTGCAGCTGCAGGAGTCTGGAGGAGGATTGGTGCAAACTGGGGGGTCTCTGAGACTCTCCTGTGCAGCCTCTGGAAACATCTTCAGTTTCCATTCCTGGGCCTGGTACCGCCAGCCTCCAGGGAAGCAGCGCGACTTGGTCGCACGGTTTAATAGTGGTGGTGGCACAAACTATGCAGACTCCGTGAAGGACCGATTCACCATCTCCAGAGACGTCGCCAAGAAAACAATGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACAGCCGTCTATAGCTGTTATGCATTTGGGGGCGACTATGACGATGGCTACAGGTATTTCGAAGTTTGGGGCCAGGGCACCCAGGTCACCGTCTCCAGC
[0051] W57 antibody coding sequence (SEQ ID No: 3):
[0052] GATGTGCAGCTGCAGGAGTCTGGGGGAGGCTTGGTGCAGGCTGGGGGCTCTCTGAGACTCTCCTGTGCAGCCTCTGGAAGTGCCTTCACTCTCGATGCCATGGGCTGGTACCGCCAGGCTCCAAGGAAACAGCGGGAGTTGGTCGCAACTGTTGTTAGTGGTGGGAGCACAAACTATGCGGACT CCGTGAAGGGCCGATTCACCATCTCCGAGGACGTCGCCAAGAACACGTTCAATCTGCAAATGAACAGCCTGAAACCTGAGGACACAGCCACCTACTACTGCCACGCCGAGGGCACATCCTACAGTGGGCCTTACCCAAGGAAGTATAATTCATGGGGCCAGGGGGACCCAGGTCACCGTCTCCAGC
[0053] Example 3: Recombinant Expression of Nanobodies and Preparation of Immunomagnetic Beads
[0054] The coding sequence of the W17 antibody (SEQ ID No:1) was codon-optimized according to the codon usage preference of the CHO cell eukaryotic expression system. The optimized sequence (as shown in SEQ ID No:4) was fused with the Fc fragment of the rabbit IGg antibody to construct a fusion expression plasmid. The plasmid was transfected into CHO cells for fusion expression. The recombinant expressed antibody (amino acid sequence shown in SEQ ID No:5) was purified from the cell culture medium. The antibody concentration was measured to be 2.01 mg / mL using a micro spectrophotometer, yielding a total of 6.31 mg of recombinant expressed antibody. Protein purity was determined using SDS-PAGE and SEC-HPLC techniques: SDS-PAGE results showed that the purity of the recombinant expressed antibody was greater than 95%, with a reduced molecular weight of 39 kDa and a non-reduced molecular weight of 78 kDa, consistent with the target protein size; SEC-HPLC results showed that the purity of the recombinant expressed antibody was 99.73%. Endotoxin content was detected using an endotoxin detection kit. The endotoxin content of the recombinant expressed antibody was less than 1 EU / mg, meeting the requirements for immunomagnetic bead preparation.
[0055] Preparation of biotin-conjugated immunomagnetic beads: Recombinant expression antibodies were biotinylated using a biotin-conjugated kit (Abcam, UK). Following the streptavidin instructions (Beaver Biotechnology, Suzhou), the biotinylated recombinant antibodies were labeled onto streptavidin magnetic beads with diameters of 300 nm, 1 μm, 2.8 μm, and 5 μm, respectively, to prepare biotin-conjugated immunomagnetic beads of four diameters.
[0056] Preparation of Protein A / G Immunomagnetic Beads: Following the operating procedure of the BeaverBeads Protein A / G Antibody Purification Kit (Beaver Biotechnology, 2020), the recombinant expressed antibody was immobilized onto Protein A / G magnetic beads to construct Protein A / G immunomagnetic beads, which were named PW-17.
[0057] The codon-optimized W17 antibody coding sequence is as SEQ ID No: 4 shows: GATGTTCAGCTCCAGGAAAGCGGCGGAGGCCTCGTACAAGCAGGCGGCTCCCTGAGACTCACCTGTGCAGCTTCCAGGTCTATCGACAACATCCTTACCATGGGATGGTACAGGCAAGCTCCAGGTAAGCAGAGGGAAAGCGTAGCACGCATTCCAAACGGATCAACCACCATTTA CGCAGACTCTGTTAAGGGCCGTTTCACTATTTCTCGGGACAATGCCAAAAACACCGTGTACCTTCAGATGAACTCTCTGAAACCCGAAGACACAGCCGTTTATTATTGCGCCGCTGGGTACGAAGACTCAGACTATAAGGGAAACGATTACTGGGGGCAGGGCACCCAAGTGACTGTGAGTTCC
[0058] The amino acid sequence of the W17 recombinant expression antibody is shown in SEQ ID No:5: MHSSALLCCLVLLTGVRA DVQLQES GGGLVQAGGSLRLTCAASRSIDNILTMGWYRQAPGKQRESVARIPNGSTTIYADSVKGRFTISRDNAKNTVYLQMNS LKPEDTAVYYCAAGYEDSDYKGNDYWGQGTQVTVSS APSTASKPTCPPPELLGGPSVFIFPPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVSTLPIAHQDWLRGKEFKCKVHNKALPAPIE KTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK
[0059] (Note: The italicized part is the signal peptide sequence, the underlined and bolded part is the W17 amino acid sequence, and the rest is the rabbit Fc amino acid sequence.)
[0060] Example 4: Optimization of incubation conditions for enriching porcine sperm with W17 biotin-based immunomagnetic beads 4.1 Screening for biotin-based immunomagnetic bead diameter
[0061] Five 1.5 mL centrifuge tubes were used, each containing 12.5 million porcine sperm cells. The tubes were centrifuged at 800 g for 10 minutes, the supernatant was gently aspirated, and the sperm were resuspended in 500 μL of sperm dilution and preservation solution. Using unlabeled magnetic beads as a control, 20 μL of W17 immunomagnetic beads (300 nm, 1 μm, 2.8 μm, and 5 μm) were added to four of the tubes, respectively. The tubes were gently incubated at room temperature for 2 hours. After incubation, the centrifuge tubes were placed on a magnetic rack and allowed to stand for 5 minutes. The supernatant was aspirated, the tubes were washed once with sperm dilution and preservation solution, and the mixture was resuspended in 100 μL of PBS to obtain immunomagnetically enriched sperm. Take 20 μL of enriched sperm, centrifuge to remove the supernatant, add 30 μL of alkaline sperm lysis buffer, lyse at 65℃ for 20 minutes, add 30 μL of neutralization buffer to neutralize, and dilute with sterile water to 120 μL. Purify sperm genomic DNA using the MicroEluteGenomic DNA Kit (OMEGA, D3096). Quantitative PCR was used to detect the X and Y sperm ratios in the enriched sperm. The results of magnetic bead size optimization are shown below. Figure 5 As shown, all four types of W17 immunomagnetic beads can effectively enrich X sperm. Among them, the 1μm magnetic beads have the best enrichment effect, with an enrichment efficiency of 72.19%, followed by the 300nm magnetic beads with an enrichment efficiency of 59.51%. However, since the 300nm magnetic beads have better dispersibility, the 300nm W17 magnetic beads were selected for subsequent optimization experiments.
[0062] 4.2 Screening of incubation time
[0063] Using the same method, porcine sperm were enriched with 300nm W17 immunomagnetic beads, and incubation times were set to 30 minutes, 60 minutes, 90 minutes, 120 minutes, 150 minutes, and 180 minutes to explore the optimal incubation time for the immune antibodies. The results of the optimized incubation time are shown below. Figure 6 As shown, co-incubation of immunomagnetic beads with sperm for 30 minutes yielded a good enrichment effect with an enrichment efficiency of 75.70%. The optimal enrichment effect was achieved after 90 minutes of incubation, with an enrichment efficiency of 82.95%. Further extending the incubation time did not further optimize the enrichment effect.
[0064] 4.3 Sperm density screening
[0065] Sperm density was set at 2 million / mL, 2.5 million / mL, 3 million / mL, 3.5 million / mL, 4 million / mL, 4.5 million / mL, 5 million / mL, 6 million / mL, 6.5 million / mL, 7 million / mL, 7.5 million / mL, 8.5 million / mL, 9 million / mL, 10 million / mL, 20 million / mL, 30 million / mL, 40 million / mL, 50 million / mL, 60 million / mL, 70 million / mL, 80 million / mL, 90 million / mL, 100 million / mL, 110 million / mL, 120 million / mL, and 130 million / mL. Sperm enrichment assays were performed using 300nm W17 magnetic beads. Sperm enriched by the magnetic beads were collected to test the enrichment effect, in order to explore the optimal sperm density for sperm enrichment by immunomagnetic beads. Results of optimized sperm density during incubation: Figure 7 As shown, when the sperm density reached 350 million / mL, the W17 immunomagnetic beads began to show an enrichment effect on X sperm, with an enrichment efficiency of 62.42%. When the sperm density increased to 450 million / mL, the enrichment efficiency was 84.10%, and with further increases in sperm density, the enrichment efficiency stabilized at around 80%.
[0066] 4.4 Screening of Magnetic Bead Dosage
[0067] The sperm density was set to 33.19 million / mL. Sperm were enriched using 10 μL, 20 μL, 30 μL, 40 μL, 50 μL, 60 μL, 70 μL, 80 μL, 90 μL, 100 μL, 110 μL, 120 μL, and 130 μL of 300 nm W17 immunomagnetic beads to determine the optimal bead dosage. The results of the optimized bead dosage are shown below. Figure 8 As shown: with a fixed sperm density of 3319 million / mL, 79.50% enrichment efficiency for X sperm can be achieved using 10 μL of W17 immunomagnetic beads. Further increasing the amount of magnetic beads did not improve the enrichment efficiency further.
[0068] In summary, the conditions for using biotinylated magnetic beads for sperm sorting are: a bead diameter of 300 nm or 1 μm; an incubation time of 30 minutes or more at room temperature; and a sperm density of 350 million / mL or higher.
[0069] Example 5: Enrichment of different strains of boar semen using W17 immunomagnetic beads
[0070] Semen was collected from eight lean-type pig breeds of Wens Foodstuff Group, including Duroc breeds S21, S22, S23, and S29; Large White breeds W64 and W65; and Landrace breeds W55 and W57. The sperm density was then diluted to 25 million / mL. Three 500 μL aliquots of semen from each breed were centrifuged at 800g for 10 minutes and gently resuspended in 500 μL of sperm dilution and preservation solution. To increase the number of enriched sperm, 20 μL of unlabeled antibody-coated magnetic beads were added to the control group, 20 μL of 300 nm W17 biotin-coated immunomagnetic beads were added to experimental group 1, and 20 μL of 1 μm W17 biotin-coated immunomagnetic beads were added to experimental group 2. The mixtures were incubated at room temperature for 30 minutes, then allowed to stand on a magnetic rack. The immunomagnetic beads were collected to enrich the sperm, and the ratio of X to Y sperm in the enriched sperm was analyzed using absolute quantitative PCR.
[0071] Quantitative results of sperm population enrichment by biotin-enriched immunomagnetic beads are as follows: Figure 9 As shown, W17 immunomagnetic beads exhibited stable enrichment effects on sperm from eight lean-type pigs. The average enrichment efficiency of 300nm immunomagnetic beads was 77.86%, and that of 1μm immunomagnetic beads was 78.43%. Specifically, the enrichment efficiency for Duroc pig sperm was as follows: 300nm immunomagnetic beads achieved a maximum of 85.92%, a minimum of 64.45%, and an average of 78.88%; 1μm immunomagnetic beads achieved a maximum of 83.02%, a minimum of 69.83%, and an average of 77.98%. For Large White pig sperm, the enrichment efficiency was as follows: 300nm immunomagnetic beads achieved a maximum of 81.06%, a minimum of 76.61%, and an average of 78.84%; 1μm immunomagnetic beads achieved a maximum of 81.19%, a minimum of 78.97%, and an average of 80.08%. Enrichment efficiency of Landrace pig X sperm: 300nm immunomagnetic beads had the highest efficiency of 84.45%, the lowest efficiency of 65.23%, and an average efficiency of 74.84%; 1μm magnetic beads had the highest efficiency of 78.75%, the lowest efficiency of 76.61%, and an average efficiency of 77.68%.
[0072] Semen was collected from two Large White pigs and named YY1 and YY2. This was used to test the sorting effect of protein A / G immunomagnetic beads PW-17 on pig X / Y sperm. The results are as follows: Figure 10 As shown, PW-17 magnetic beads can effectively enrich X sperm, with an enrichment efficiency of 76.45% for X sperm in YY1 semen and 82.73% for X sperm in YY2 semen, with an average enrichment efficiency of 79.59%.
[0073] In summary, because W17 antibodies have different binding abilities to X and Y sperm, they can induce agglutination reactions in sperm of specific sexes. For example, antibody W17 can induce agglutination of X sperm (e.g., Figure 11As shown in the figure, the enrichment efficiency for X sperm reaches 80%. Therefore, X sperm can be efficiently enriched using W17 antibody immunomagnetic beads. The enriched sperm are X sperm, while the unenriched supernatant contains Y sperm, thus achieving convenient and efficient sorting (separation) of pig X and Y sperm. Furthermore, this antibody and its sorting method offer high efficiency in separating X and Y sperm with minimal sperm damage, providing greater advantages than sperm flow cytometry. It does not rely on expensive equipment or specialized technicians, facilitating the establishment of an economical and efficient sex control technology. Moreover, this antibody is a nanobody, only 10% the size of traditional antibodies, with a simpler structure, high stability, strong specificity, and low immunogenicity. It allows for large-scale antibody expression, significantly reducing antibody production costs and facilitating industrial application.
[0074] The above descriptions are merely some embodiments of the present invention. For those skilled in the art, various modifications and improvements can be made without departing from the inventive concept of the present invention, and all such modifications and improvements fall within the scope of protection of the invention.
Claims
1. A porcine sperm-specific antibody, wherein, The coding sequence of the antibody is shown in any one of SEQ ID No: 1-3.
2. A pig sperm specific antibody, wherein, The antibody is an antibody optimized according to the codon usage bias of a eukaryotic expression system of cells, and the coding sequence of the optimized antibody is shown in SEQ ID No:
4.
3. A pig sperm specific antibody, wherein, The antibody is a recombinant expression antibody fused with an exogenous Fc fragment, and the amino acid sequence of the recombinant expression antibody is shown in SEQ ID No:
5.
4. The antibody as claimed in any one of claims 1-3 for use in sorting X, Y sperm of pigs.
5. The antibody as claimed in any one of claims 1-3 for use in the preparation of a product for sorting sperm of pigs.
6. A method of sorting pig X, Y sperm wherein, The method comprises the following steps: S1: biotinylating a recombinant expression antibody with an amino acid sequence shown in SEQ ID No: 5, and then labeling the biotinylated recombinant expression antibody to streptavidin magnetic beads to prepare biotin immunomagnetic beads; S2: diluting the semen to be sorted, adding the biotin immunomagnetic beads, incubating at room temperature, standing on a magnetic stand after incubation, and then collecting the sperm not combined with the magnetic beads in the supernatant, and resuspending the sperm after removing the supernatant and enriched by the immunomagnetic beads to obtain sperm of the other gender.
7. A method of sorting pig X, Y sperm wherein, The method comprises the following steps: S1: fixing a recombinant expression antibody with an amino acid sequence shown in SEQ ID No: 5 to Protein A / G magnetic beads to construct Protein A / G immunomagnetic beads; S2: diluting the semen to be sorted, adding the Protein A / G immunomagnetic beads, collecting the sperm not enriched with the magnetic beads in the supernatant, and separately collecting the sperm enriched with the magnetic beads to achieve sorting of X, Y sperm.
Citation Information
Patent Citations
Preparation method of anti-sheep Y sperm IgY
CN117510620A
Anti-CD28 nano antibody as well as preparation method and application thereof
CN117534761A