Method for regulating and controlling rice growth by using NU1-H and application thereof

Abstract

The invention discloses a method for regulating and controlling rice growth by using NU1-H and application of the method, and belongs to the technical field of gene engineering. The invention provides a method for regulating and controlling the growth of rice, which comprises the step of introducing NU1-H into the rice, and the nucleotide sequence of the NU1-H is as shown in SEQ ID NO. 1. The regulation of rice growth comprises regulation of rice nitrogen utilization rate, regulation of rice seed protein content and regulation of rice yield character. The NU1-H plays a key role in regulation and control of rice growth, including rice nitrogen utilization rate, rice yield, rice protein content and the like, and a new gene resource and a research basis are provided for rice nitrogen metabolism research.

Description

Technical Field

[0001] The present invention relates to the technical field of genetic engineering, and in particular to a method for regulating rice growth by utilizing NU1-H and application thereof. Background Art

[0002] Rice is one of the main grain crops in my country, and its yield and quality are closely related to people's lives. The total rice planting area accounts for only 1 / 4 of the total planting area of ​​grain crops, but its yield accounts for 1 / 3 of the total grain output. Behind this high yield phenomenon is the large-scale use of nitrogen fertilizer in the rice production process. According to statistics from the National Bureau of Statistics, my country's nitrogen fertilizer application in 2023 reached 16,033.416 thousand tons. Therefore, improving the utilization rate of rice nitrogen and increasing grain production is a hot research issue.

[0003] So far, a large number of nitrogen utilization genes have been reported, such as: NRT1.1B, OsGATA8, OsTCP19, DEP1, OsAlaAT1, etc. DEP1 can control the erect and dense panicle, thereby increasing yield and achieving high nitrogen utilization rate. OsAlaAT1 regulates the effective utilization of nitrogen by regulating the balance of carbon and nitrogen metabolism in rice, thereby improving rice yield and quality. Among these nitrogen utilization genes, some excellent haplotypes have been reported. Compared with other haplotypes, OsGATA8-H can improve the effective tillering of rice to achieve high nitrogen utilization rate; and OsTCP19-H is more suitable for planting in low-fertilizer areas and mainly exists in wild rice compared with other haplotypes, so the nitrogen utilization rate is also improved. However, there are still many unknowns about the genes and applications of rice nitrogen efficient utilization, which still need to be explored. It is of great significance to explore and study the genes that can affect yield and quality, and further provide excellent gene resources and germplasm resources for nitrogen efficient utilization for rice production. Summary of the invention

[0004] The purpose of the present invention is to provide a method for regulating rice growth using NU1-H and its application, so as to solve the problems existing in the above-mentioned prior art. The present invention provides the application of NU1-H in regulating rice growth, including regulating rice nitrogen utilization, regulating rice seed protein and regulating rice yield.

[0005] In order to solve the above problems, the present invention provides the following solutions:

[0006] Technical solution 1: A method for regulating rice growth, comprising the step of introducing NU1-H into the rice, wherein the nucleotide sequence of the NU1-H is shown in SEQ ID NO.1.

[0007] Furthermore, the regulation of rice growth includes regulating rice nitrogen utilization, regulating rice seed protein content and regulating rice yield traits.

[0008] Furthermore, the rice yield traits include the number of effective tillers and the yield per plant.

[0009] Furthermore, the rice varieties include Nipponbare and Koshihikari.

[0010] The present invention constructs a NU1-H type near-isogenic line under the background of Nipponbare and Koshihikari. The NU1-H type near-isogenic line has increased fresh weight, increased plant height, increased nitrogen content, increased protein content, increased number of effective tillers in the field, increased single plant yield and increased nitrogen utilization rate under a hydroponic environment.

[0011] Technical solution 2: Application of NU1-H or a vector comprising NU1-H in increasing the number of effective tillers of rice, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.

[0012] Technical solution three: Application of NU1-H or a vector comprising NU1-H in increasing the yield per rice plant, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.

[0013] Technical solution 4: Application of NU1-H or a vector comprising NU1-H in improving nitrogen utilization efficiency of rice, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.

[0014] Technical solution five: Use of NU1-H or a vector comprising NU1-H in increasing the protein content of rice seeds, wherein the nucleotide sequence of NU1-H is shown in SEQ ID NO.1.

[0015] Furthermore, the amino acid sequence of the protein encoded by the NU1-H is shown in SEQ ID NO.2.

[0016] The present invention discloses the following technical effects:

[0017] The present invention identified the superior haplotype NU1-H of the gene NU1, and constructed the NU1-H type near-isogenic lines in the Nipponbare and Koshihikari backgrounds. Compared with the control, the Nipponbare NU1-H In the hydroponic environment, the plant fresh weight increased, the plant height increased, and the nitrogen content increased. In the field environment, the plant nitrogen content increased, the protein content increased, the number of effective tillers in the field increased, and the yield per plant increased; Koshihikari NU1-H Under the hydroponic environment, there was no significant change in plant height, but the dry and fresh weight increased, and the nitrogen content of the plant increased. Under the field environment, the nitrogen content of the plant increased, the protein content increased, the number of effective tillers in the field increased, and the yield per plant increased.

[0018] In summary, the superior haplotype NU1-H can increase the nitrogen content, protein content, effective tillering and single plant yield of rice, and improve the nitrogen utilization rate of rice. Therefore, the superior haplotype NU1-H plays a key role in regulating rice growth, including rice nitrogen utilization rate, rice yield, rice protein content, etc. The present invention provides a new gene resource and research basis for rice nitrogen metabolism research. BRIEF DESCRIPTION OF THE DRAWINGS

[0019] In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings required for use in the embodiments will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For ordinary technicians in this field, other drawings can be obtained based on these drawings without paying creative work.

[0020] Figure 1 This is the NU1 haplotype analysis, where A: haplotype analysis of NU1 based on the 3,000 rice resource public database; B: distribution of two haplotypes in different rice populations; C: distribution of two haplotypes in different rice populations;

[0021] Figure 2 The plant type comparison diagram of Nipponbare, Koshihikari and their NU1-H type near-isogenic lines under different nitrogen concentration treatments, among which A: Nipponbare and Nipponbare under low nitrogen conditions NU1-H Comparison; B: Nipponbare and Nipponbare under high nitrogen conditions NU1-H Comparison; C: Koshihikari and Koshihikari under low nitrogen conditions NU1-H Comparison; D: Koshihikari and Koshihikari under high nitrogen conditions NU1-H Contrast; NIP: Nipponbare; Ruler: 10cm;

[0022] Figure 3 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Analysis of growth characteristics of hydroponic seedlings under different nitrogen concentrations, where A: Nipponbare and Nipponbare under different nitrogen concentrations NU1-H Comparison of seedling height; B: Nipponbare and Nipponbare under different nitrogen concentrations NU1-H Comparison of seedling fresh weight; C: Nipponbare and Nipponbare under different nitrogen concentrationsNU1-H Comparison of seedling dry weight; D: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Comparison of seedling height; E: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Comparison of seedling fresh weight; F: Koshihikari and Koshihikari under different nitrogen concentrations NU1-H Comparison of seedling dry weight; **: P < 0.01; *: P < 0.05; ns: no significant difference; NIP: Nipponbare;

[0023] Figure 4 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Nitrogen content of hydroponic seedlings under different nitrogen concentrations, where A: Nipponbare and Nipponbare under different nitrogen concentrations NU1-H Comparison of nitrogen content in plants; B: Koshihikari and Koshihikari under different nitrogen concentration conditions NU1-H Comparison of nitrogen content in plants; NIP: Nipponbare; **: P < 0.01;

[0024] Figure 5 Nipponbare and Nipponbare under different nitrogen fertilizer conditions NU1-H and Koshihikari and Koshihikari NU1-H Comparison of plant types, among which A: Nipponbare and Nipponbare under low nitrogen conditions NU1-H Comparison of plant types; B: Nipponbare and Nipponbare under high nitrogen conditions NU1-H Comparison of plant types; C: Koshihikari and Koshihikari under low nitrogen conditions NU1-H Comparison of plant types; D: Koshihikari and Koshihikari under high nitrogen conditions NU1-H Plant type comparison, NIP: Nipponbare; scale: 10 cm;

[0025] Figure 6 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Comparison of plant height and effective tiller number under different nitrogen fertilizer conditions, among which A: Nipponbare and Nipponbare under low nitrogen and high nitrogen conditions NU1-HComparison of plant height; B: Nipponbare and Nipponbare under low nitrogen and high nitrogen conditions NU1-H Comparison of effective tillering books; C: Koshihikari and Koshihikari under low nitrogen and high nitrogen conditions NU1-H Comparison of plant height; D: Koshihikari and Koshihikari under low nitrogen and high nitrogen conditions NU1-H Comparison of effective tiller numbers; **: P < 0.01; *: P < 0.05; ns: no significant difference; NIP: Nipponbare;

[0026] Figure 7 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Comparison of single plant yield under different nitrogen fertilizer conditions, A: Nipponbare and Nipponbare under low nitrogen and high nitrogen conditions NU1-H Comparison of single plant yield; B: Koshihikari and Koshihikari under low nitrogen and high nitrogen conditions NU1-H Comparison of single plant yield; **: P < 0.01; *: P < 0.05; NIP: Nipponbare;

[0027] Figure 8 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Under normal nitrogen fertilizer conditions, the protein content of grains is: A: Nipponbare and Nipponbare NU1-H Comparison of grain protein content; B: Koshihikari and Koshihikari NU1-H Comparison of grain protein content; P<0.05; NIP: Nipponbare. DETAILED DESCRIPTION

[0028] Various exemplary embodiments of the present invention will now be described in detail. This detailed description should not be considered as limiting the present invention, but should be understood as a more detailed description of certain aspects, features, and embodiments of the present invention.

[0029] It should be understood that the terms described in the present invention are only for describing a particular embodiment and are not intended to limit the present invention. In addition, for the numerical range in the present invention, it should be understood that each intermediate value between the upper and lower limits of the scope is also specifically disclosed. The intermediate value in any stated value or stated range, and each smaller range between any other stated value or intermediate value in the described range is also included in the present invention. The upper and lower limits of these smaller ranges can be independently included or excluded in the scope.

[0030] Unless otherwise indicated, all technical and scientific terms used herein have the same meanings as those generally understood by those skilled in the art. Although the present invention describes only preferred methods and materials, any methods and materials similar or equivalent to those described herein may also be used in the implementation or testing of the present invention. All documents mentioned in this specification are incorporated by reference to disclose and describe the methods and / or materials associated with the documents. In the event of a conflict with any incorporated document, the content of this specification shall prevail.

[0031] It will be apparent to those skilled in the art that various modifications and variations may be made to the specific embodiments of the present invention description without departing from the scope or spirit of the present invention. Other embodiments derived from the present invention description will be apparent to those skilled in the art. The present invention description and examples are exemplary only.

[0032] The words “include,” “including,” “have,” “contain,” etc. used in this document are open-ended terms, meaning including but not limited to.

[0033] Example 1 Haplotype Analysis of Rice Nitrogen Utilization Gene NU1

[0034] The present invention analyzes the haplotype of NU1 through the Rice SNP-Seek Database (https: / / snpseekv3.irri-e-extension.com / v2 / ), and the specific steps are as follows:

[0035] Open the "Search-Genotype" function on the website https: / / snpseekv3.irri-e-extension.com / v2 / , enter the gene number of NU1 "LOC_Os10g25130" in the "Genelocus" column, click "Non-synonymous only" in the "IncludeSNPs" option, leave other settings as default, and click the "Search" button to obtain the haplotype distribution of NU1 in 3,000 rice samples (such as Figure 1There is a SNP site (A / G) at 12969703bp in the second exon of the NU1 coding region. This SNP site will result in two forms of the 17th amino acid: Asn / Ser. Based on this SNP site, the NU1 gene can be divided into two haplotypes: NU1-L (Asn) and NU1-H (Ser) (as shown in Figure 1). Figure 1 The subpopulation information provided by the RiceSNP-SeekDatabase website was classified and it was found that the haplotype NU1-L mainly existed in indica and japonica rice, while NU1-H mainly appeared in Aus rice population and Southeast Asian aromatic rice Aromatic population (as shown in Figure 2A). Figure 1 In modern indica and japonica cultivated rice, NU1-L accounts for more than 98%; in the older Aus rice and Southeast Asian aromatic rice, NU1-H accounts for more than 80% (as shown in Figure 2). Figure 1 (as shown in C).

[0036] Nucleotide sequence of NU1-H:

[0037]

[0038] Amino acid sequence of the protein encoded by NU1-H:

[0039] MAAPSVAVDNLNPKVLSCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATTILASIPGRATGAYSHSQGIKGL RDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSASIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEENQRD IVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKD GILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYALRLLEEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD*(SEQ IDNO.2).

[0040] Example 2 Identification of nitrogen utilization ability of rice haplotype NU1-H plants with excellent nitrogen utilization

[0041] Construction of NU1-H near-isogenic line Nipponbare in Nipponbare and Koshihikari backgrounds NU1-H and Koshihikari NU1-H , hydroponic experiments with different nitrogen concentration gradients were carried out to detect the growth characteristics of plants under different nitrogen concentration conditions.

[0042] 1. The hydroponic experimental method is as follows

[0043] (1) Wash the seeds with 75% anhydrous ethanol for 1 min, then soak the seeds in 50% sodium hypochlorite for 30 min, then wash them thoroughly with distilled water, and then soak them in distilled water at 37°C for 24 h;

[0044] (2) After soaking, wrap the seeds with a wet towel and place them at 37°C in the dark for 48 h to germinate;

[0045] (3) The formula of the standard nitrogen nutrient solution refers to the recommended standard of the International Rice Research Institute (IRRI). The present invention also sets two nitrogen concentrations, namely low nitrogen (0.5 times the recommended standard nitrogen content) and high nitrogen (4 times the recommended standard nitrogen content). The contents of other elements refer to the recommended standards. The formula is shown in Table 1;

[0046] (4) After germination, seeds with relatively consistent bud and root lengths were selected and sown into hydroponic boxes and cultured in a 25°C light incubator (12 h light, 12 h dark);

[0047] (5) The hydroponic method is: hydroponic culture for 3 days, standard nitrogen nutrient solution culture for 4 days, and nutrient solution culture with different nitrogen concentrations for 7 days, for a total of 14 days, and the nutrient solution was replaced every 3 days;

[0048] Hydroponics Notes:

[0049] 1) The water temperature should not be too high or too low, it should be around 25℃;

[0050] 2) The roots should be kept away from light to prevent algae growth and root respiration loss;

[0051] 3) When cultivating in large water bodies, the pH of the culture solution should be between 5 and 6, and the lowest should not be lower than 4;

[0052] 4) Cultivation in large water bodies requires water circulation to avoid precipitation of trace elements such as iron under low oxygen conditions;

[0053] 5) The culture medium can be replaced every 3-4 weeks in large water bodies and every 3-5 days in small water bodies. If the seedlings turn yellow, nitrogen should be supplemented in time.

[0054] 6) After 14 days of hydroponic culture, 10 representative plants with basically the same growth were randomly selected to examine the agronomic traits and nitrogen content of the seedlings.

[0055] Table 1 Hydroponic nutrient solution (recommended standard nitrogen content) formula

[0056]

[0057]

[0058] Note: All of the above are mother solutions. They need to be diluted 1000 times when prepared into working solutions. The amount of macroelements used in the seedling stage is 1 / 4 of the normal amount. For every 10L of trace element mother solution, add 500mL of concentrated sulfuric acid and 10-15g of EDTA. When prepared into working solution, the pH needs to be adjusted to around 5.5.

[0059] 2. Hydroponic experiment results

[0060] 2.1 Comparison of plant types of Nipponbare, Koshihikari and NU1-H near-isogenic lines under different nitrogen treatments Figure 2 shown. Figure 2 The following is a comparison of the plant types of hydroponic seedlings of Nipponbare, Koshihikari and their NU1-H type near-isogenic lines under different nitrogen concentration treatments. The japonica rice varieties Nipponbare and Koshihikari carry the NU1-H type haploid type, and the AUS rice variety Kasalath carries the NU1-H type haploid type. Molecular marker-assisted backcrossing was performed with Kasalath as the donor, Nipponbare and Koshihikari as the recipient to mark the target haploid type (NU1-H) in rice. Rice individuals with the target haploid type were directly selected at the DNA level without relying on phenotype. Through molecular marker-assisted selection, plants containing the NU1-H haploid type were screened from a large number of rice plants, and finally the lines Nipponbare and Koshihikari carrying the NU1-H haploid type were obtained with Nipponbare and Koshihikari as the backgrounds. NU1-H and Koshihikari NU1-H The hydroponic experiment with different nitrogen concentrations showed that Nipponbare NU1-H The seedling heights of Nipponbare and Koshihikari NU1-H The seedling height is not much different from Koshihikari.

[0061] 2.2 Results of agronomic trait testing of NU1-H near-isogenic lines constructed from Nipponbare and Koshihikari backgrounds under different nitrogen concentration treatments Figure 3 As shown in the figure, under low nitrogen and high nitrogen conditions, the fresh weight and dry weight of NU1-H type near-isogenic line plants were significantly higher than those of Nipponbare and Koshihikari. This indicates that NU1-H type near-isogenic line plants have changed the agronomic traits of rice plants and promoted growth. Figure 3 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Analysis of growth-related traits of hydroponic seedlings under different nitrogen concentration treatments. NU1-H The height and fresh weight of seedlings in low nitrogen and high nitrogen treatments were significantly higher than those in Nipponbare. NU1-H The seedling dry weight of Nipponbare was significantly higher than that of Figure 3 A- Figure 3 C) in Koshihikari NU1-H The fresh weight and dry weight of seedlings under low nitrogen and high nitrogen treatments were significantly higher than those of Koshihikari ( Figure 3 E and Figure 3 F); indicating that the NU1-H haplotype can improve the absorption and utilization of nitrogen in rice seedlings under low nitrogen and high nitrogen conditions.

[0062] 2.3 Take 5 seedlings that grow basically the same under different nitrogen levels as a group, and measure the nitrogen content of 3 groups of seedlings. The sample to be tested was sterilized at 108℃ for 1 hour, dried at 80℃ to constant weight, and crushed with a grinder after weighing. The seed nitrogen content determination method in Example 3 was used for detection. The test results are as follows: Figure 4 As shown in the figure, it can be seen that under low nitrogen and high nitrogen conditions, the nitrogen content of NU1-H type near-isogenic line plants is higher than that of the wild type, indicating that NU1-H type near-isogenic line plants have changed the absorption and transfer of nitrogen elements in rice seedlings and improved nitrogen utilization efficiency. Figure 4 The nitrogen content of Nipponbare seedlings under different nitrogen concentration treatments. NU1-H The nitrogen content in seedlings was significantly higher than that in Nipponbare ( Figure 4 A) in Koshihikari NU1-H The nitrogen content in seedlings was significantly higher than that in Koshihikari ( Figure 4 B), indicating that the NU1-H haplotype can improve the nitrogen absorption of rice under high nitrogen conditions.

[0063] Example 3 Determination of nitrogen content in rice plants and protein content in seeds

[0064] First, the nitrogen content of mature seeds, leaves and stems of wild-type and NU1-H near-isogenic lines was measured using a SEALAutoAnalyzer 3 rheometer. Then, the protein content of seeds was calculated according to the following formula based on the nitrogen content measurement data:

[0065] Protein content (%) = C0×0.1×5.95÷(200×(1-water content))×100.

[0066] C0 is the N content (mg / L) measured by the rheometer; the moisture content of rice flour is generally around 8%, and this embodiment is calculated based on 8%.

[0067] The method for determining the nitrogen content of seeds is as follows:

[0068] (1) Weigh 200 mg of the sample to be tested and place it in a digestive tube, with 3 replicates for each sample;

[0069] (2) Add 5 mL of H2SO4 to the digestive tube and digest at 290°C for 20 min. After boiling, remove the digestive tube and shake it well.

[0070] (3) Continue digestion for 1 h, shaking every 20 min;

[0071] (4) Remove the digestive tube, wait for it to cool to room temperature, add 2 mL of H2O2, and shake well;

[0072] (5) Digest again for 10 min. After the digestion, observe whether the sample solution becomes clear. If it becomes clear, remove the digestion tube and cool it to room temperature. If the sample still has color, add 200 μL of H2O2 after cooling to room temperature, shake well, and digest again for 10 min. Repeat this step until the sample solution becomes clear.

[0073] (6) Add ddH2O to the digestive tube cooled to room temperature and make up to 100 mL;

[0074] (7) Shake the sample to be tested before testing. After standing for 20 minutes, take the supernatant of the sample to be tested with a sample cup and test it with SEALAutoAnalyzer 3 rheometer. The nitrogen content of the test data is calculated according to the following formula:

[0075] Nitrogen content (mg / g) = C0×0.1÷0.2.

[0076] Wherein, C0 is the N content (mg / L) measured by the rheometer; 0.1 is the volume of the 100mL sample to be tested, converted to 0.1L; 0.2 is the sample mass.

[0077] The protein content test results are as follows Figure 8 shown. Figure 8 for Nipponbare and Nipponbare NU1-H and Koshihikari and Koshihikari NU1-H Protein content in mature seeds. NU1-H and Koshihikari NU1-H The protein content in the grains was significantly higher than that in Nipponbare and Koshihikari, indicating that the NU1-H haplotype can improve the nitrogen utilization efficiency of rice.

[0078] Example 4 Investigation of agronomic traits of rice

[0079] 1. Investigation of hydroponic seedlings

[0080] The height and fresh weight of the seedlings that were basically the same after 14 days of hydroponic culture under different nitrogen levels were measured, with 5 seedlings in a group and repeated 3 times. The remaining seedlings were wrapped in tin foil and put in an oven at 108℃ for 1h, dried at 80℃ to constant weight, and the dry weight was measured. Figure 3 shown.

[0081] 2. Investigation of field agronomic traits under low nitrogen and high nitrogen conditions

[0082] The nitrogen fertilizer application rate for low nitrogen fields was 75 kg·ha-1, and the nitrogen fertilizer application rate for high nitrogen fields was 180 kg·ha-1. The application rates of other fertilizers were exactly the same. At maturity, 10 representative plants with basically the same growth were randomly selected, and the number of effective tillers and the height from the ground to the highest point of the main ear of each plant were counted, and photographed and recorded ( Figure 5 ), the calculated average value is the final data of effective tillering and plant height (such as Figure 6 The results showed that Nipponbare NU1-H The plant height and effective tiller number of Koshihikari were higher than those of Nipponbare; under low nitrogen and high nitrogen conditions, NU1-H The effective tiller number of NU1-H was higher than that of Koshihikari, indicating that the NU1-H haplotype can improve the nitrogen utilization of rice under low-nitrogen and high-nitrogen conditions.

[0083] At the same time, the single plant yield of each strain was counted (such as Figure 7 The results showed that Nipponbare NU1-H The yield per plant of Koshihikari was higher than that of Nipponbare. NU1-H The single-plant yield of NU1-H was higher than that of Koshihikari, indicating that the NU1-H haplotype can improve the single-plant yield and nitrogen utilization efficiency of rice under low-nitrogen and high-nitrogen conditions.

[0084] The embodiments described above are only descriptions of the preferred modes of the present invention, and are not intended to limit the scope of the present invention. Without departing from the design spirit of the present invention, various modifications and improvements made to the technical solutions of the present invention by ordinary technicians in this field should all fall within the protection scope determined by the claims of the present invention.

Claims

1. A method for regulating rice growth, characterized in that: The method comprises the step of introducing NU1-H into the rice, wherein the nucleotide sequence of the NU1-H is shown as SEQ ID NO.

1.

2. The method according to claim 1, characterized in that The rice growth regulation includes regulating rice nitrogen utilization rate, regulating rice seed protein content and regulating rice yield traits.

3. The method according to claim 2, characterized in that The rice yield traits include effective tillering number and single plant yield.

4. Use of NU1-H or a vector comprising NU1-H in increasing the number of effective tillers of rice, characterized in that: The nucleotide sequence of NU1-H is shown in SEQ ID NO.

1.

5. Use of NU1-H or a vector comprising NU1-H in increasing the yield per rice plant, characterized in that: The nucleotide sequence of NU1-H is shown in SEQ ID NO.

1.

6. Use of NU1-H or a vector comprising NU1-H in improving nitrogen utilization efficiency of rice, characterized in that: The nucleotide sequence of NU1-H is shown in SEQ ID NO.

1.

7. Use of NU1-H or a vector comprising NU1-H in increasing the protein content of rice seeds, characterized in that: The nucleotide sequence of NU1-H is shown in SEQ ID NO.1.

Images