Gene for regulating brassica napus branching angle, regulating method and application

Abstract

The invention provides a gene for regulating and controlling the branching angle of rape, a regulating and controlling method and application, and belongs to the technical field of functional genes. The invention provides a gene BnTAC1-1 and / or BnTAC1-2 for regulating and controlling the branching angle of rape, and by creating a gene editing mutant, it is found that the average branching angle of double-gene edited rape is smaller than the average branching angle of single-gene edited rape and is smaller than the average branching angle of wild type rape. It is proved that the genes BnTAC1-1 and BnTAC1-2 can jointly control the branching angle of the brassica napus and have additive effects, so that the plant type compactness of the brassica napus is regulated and controlled, the agronomic characters such as the flowering phase, the number of branches, the number of siliques and the number of silique grains of the brassica napus are not affected, and the genes BnTAC1-1 and BnTAC1-2 can be applied to germplasm improvement of the brassica napus and creation of the brassica napus suitable for high-density planting. The rape yield per unit area is improved.

Description

Technical Field

[0001] The invention belongs to the technical field of functional genes, and in particular relates to genes for regulating the branching angle of rapeseed, a regulation method and an application thereof. Background Art

[0002] Brassica napus is an important oil crop and an important source of plant protein for feed. It has a large planting area in the world. In recent years, the rapeseed planting area in my country has reached nearly 7 million hectares, accounting for about one-third of the total rapeseed planting area in the world. Although the rapeseed planting area in my country has increased year by year in recent years, the traditional rapeseed main producing area in the Yangtze River Basin has the problem of vacant farmland in winter due to income issues. Therefore, it is urgently needed to increase the yield per unit area of ​​rapeseed to improve the benefits of rapeseed planting and promote further increase in rapeseed planting area.

[0003] Ultra-high density and ultra-high yield are the main directions for increasing the production and income of rapeseed. Rapeseed breeders generally believe that compact rapeseed is the "ideal plant type" for achieving high yield of dense planting of rapeseed. Cabbage-type rapeseed plants are tall, branched, and have many siliques, forming a unique silique layer to store yield. After the end of the flowering period of rapeseed, the dense silique layer will affect the photosynthesis of the leaves and the air exchange of the entire group. The weakening of photosynthesis and the insufficient concentration of carbon dioxide will affect the yield of rapeseed. The angle of the branch directly affects the degree of interlacing of the silique layer in the rapeseed field. A reasonable branch angle can reduce the interlacing of branches between different plants, thereby reducing the degree of interlacing of the silique layer, increasing the ventilation performance and light transmission performance of the entire group, and is conducive to increasing yield. In addition, a properly compact plant type can be reasonably densely planted, and increasing the density of the group is also conducive to increasing yield; and the reduction of criss-crossing branches between plants can reduce the damage to the plants caused by human activities during field management, and is also conducive to reducing the harvest loss caused by the bursting of siliques due to the entanglement of branches during mechanical harvesting, which is conducive to ensuring the harvest yield. In summary, exploring rapeseed branch angle genes is of great practical significance for breeding rapeseed varieties that are resistant to dense planting and suitable for mechanical harvesting, increasing rapeseed yields, and ensuring the safety of edible oil in my country. Summary of the invention

[0004] The present invention provides genes for regulating the branching angle of rapeseed, a regulation method and an application thereof. The gene BnTAC1-1 and / or BnTAC1-2 can regulate the branching angle of rapeseed, thereby facilitating the realization of ultra-high density and ultra-high yield rapeseed cultivation.

[0005] The present invention provides genes for regulating the branch angle of rapeseed, including BnTAC1-1 and / or BnTAC1-2, wherein the amino acid sequence encoded by BnTAC1-1 includes SEQ ID No.1 or a sequence having more than 85% homology with the sequence described in SEQ ID No.1;

[0006] The amino acid sequence encoded by the BnTAC1-2 includes SEQ ID No. 2 or a sequence having more than 85% homology with the sequence of SEQ ID No. 2.

[0007] In a preferred embodiment of the present invention, the genomic nucleotide sequences of BnTAC1-1 and BnTAC1-2 are shown as SEQ ID No.3 and SEQ ID No.4.

[0008] In a preferred embodiment of the present invention, the CDS sequences of BnTAC1-1 and BnTAC1-2 are shown as SEQ ID No.5 and SEQ ID No.6.

[0009] The present invention also provides the application of the above gene in regulating rapeseed plant type.

[0010] In a preferred embodiment of the present invention, the regulation of rapeseed plant type includes knocking out one gene, thereby reducing the branching angle of rapeseed and making the rapeseed plant type compact; after knocking out two genes, the branching angle of rapeseed is smaller and the rapeseed plant type is more compact.

[0011] In a preferred embodiment of the present invention, the rapeseed includes Brassica napus.

[0012] The present invention also provides the use of the above gene in creating rapeseed germplasm suitable for high-density planting.

[0013] The present invention also provides a method for creating rapeseed germplasm suitable for high-density planting, which comprises knocking out the above gene in the rapeseed genome.

[0014] The present invention also provides sgRNA for knocking out the gene, including sgRNA1 and sgRNA2, wherein the nucleotide sequence of sgRNA1 is shown as SEQ ID No.7, and the nucleotide sequence of sgRNA2 is shown as SEQ ID No.8.

[0015] The present invention also provides a gene editing vector comprising the sgRNA.

[0016] The present invention also provides the use of the rapeseed germplasm suitable for high-density planting obtained by the above creation method in increasing the yield of rapeseed.

[0017] Beneficial effects: The present invention provides two homologous genes of TAC1 in rapeseed, BnTAC1-1 and BnTAC1-2. In the embodiment of the present invention, by constructing a CRISPR / Cas9 gene editing vector and genetically transforming Zhejiang rapeseed 51, a leading rapeseed variety in Zhejiang Province, gene-edited rapeseed in which both BnTAC1-1 and BnTAC1-2 genes were edited, and gene-edited rapeseed in which only BnTAC1-1 was edited, was finally obtained. Then phenotypic identification was performed, and it was found that the average branching angle of the wild-type Zhejiang rapeseed 51 was 36.2 degrees, the average branching angle of the single-gene edited rapeseed was 29.9 degrees, and the average branching angle of the double-gene edited rapeseed was 24.4 degrees. It is proved that the genes BnTAC1-1 and BnTAC1-2 described in the present invention can control the branch angle of rapeseed and have an additive effect, thereby regulating the plant type of Brassica napus. The flowering period, number of branches, number of siliques and number of siliques are no different from those of the wild type. More rapeseed can be planted per unit area, thereby increasing the yield per unit area. BRIEF DESCRIPTION OF THE DRAWINGS

[0018] Figure 1 This is a diagram showing the analysis of editing types of double-gene edited rapeseed;

[0019] Figure 2 This is a diagram showing the results of single gene editing in rapeseed.

[0020] Figure 3 Phenotypic comparison between gene-edited rapeseed and wild-type rapeseed (A), average vertical projection area of ​​rapeseed plants (B), and schematic diagram of branching angles between primary branches and main stem of rapeseed (C);

[0021] Figure 4 This is a diagram of the gene knockout strategy of the present invention. DETAILED DESCRIPTION

[0022] The present invention provides genes for regulating the branch angle of rapeseed, including BnTAC1-1 and / or BnTAC1-2, wherein the amino acid sequence encoded by BnTAC1-1 includes SEQ ID No.1 or a sequence having more than 85% homology with the sequence described in SEQ ID No.1;

[0023] The amino acid sequence encoded by the BnTAC1-2 includes SEQ ID No. 2 or a sequence having more than 85% homology with the sequence of SEQ ID No. 2.

[0024] In one embodiment of the present invention, the amino acid sequence encoded by BnTAC1-1 is shown in SEQ ID No. 1:

[0025] MYFHVVKEIDGVAKSEKKKRGEGTSEIEKNTKAIMDQVGLVDALDNWFDGVLTIGTFGFDTLKFQEEAEIDDGDERESVGLDYVVIDGSIIKNVNQESDPLISNENKVYDHHEDLEALCINHFESVKTVERAVVVAAAAAETEVEPEKKRTTLAELFMEDRVKDDDTKHDKKKPKNRNLDVDGQEIKYHKQNGSKLPSKLSFAKKMIITKSKDTEDSRPIKNEHDSRPIKKVHQMIKRMLKKKIHPDMDASKASKKDGPYKPALNCEALETLYLLNVPGSSF*;

[0026] The genomic sequence of BnTAC1-1 is shown in SEQ ID No. 3:

[0027]

[0028] The CDS sequence of BnTAC1-1 is shown in SEQ ID No. 5 as follows:

[0029] ATGTATTTTCATGTGGTGAAAGAAATAGATGGTGTGGCGAAAAGCGAGAAAAAGAAGAGAGGTGAAGGAACAAGTGAGATAGAGAAGAACACGAAAGCTATAATGGATCAGGTTGGGTTAGTGGATGCTCTTGATAACTGGTTCGATGGAGTTCTCACCATCGGCACATTTGGTTTTGACACTTTGAAATTTCAAGAAGAAGCCGAAATAGATGATGGTGATGAACGCGAGAGTGTGGGTTTGGACTATGTGGTAATCGATGGTAGCATCATCAAGAACGTCAACCAAGAGTCGGACCCTCTTATCTCCAACGAGAATAAGGTTTATGATCATCATGAGGATTTAGAGGCATTATGCATTAATCACTTTGAGTCGGTCAAAACGGTTGAAAGGGCGGTGGTCGTGGCCGCGGCCGCGGCGGAGACCGAGGTGGAGCCGGAGAAGAAGAGGACAACACTAGCCGAGCTTTTCATGGAAGACCGAGTAAAAGACGATGATACGAAGCATGACAAGAAGAAACCAAAGAACCGTAATCTTGATGTTGATGGCCAGGAGATTAAATATCATAAACAAAACGGGTCAAAGCTGCCTAGTAAGTTATCGTTTGCTAAGAAGATGATCATTACTAAGTCCAAAGATACAGAAGACTCGCGTCCAATCAAGAACGAGCATGACTCGCGTCCAATCAAGAAAGTGCATCAGATGATAAAGAGGATGTTAAAGAAGAAGATCCATCCAGATATGGATGCGAGTAAGGCGTCTAAAAAGGACGGTCCATACAAGCCAGCCCTGAATTGTGAAGCTCTCGAGACACTTTATCTTCTTAATGTTCCAGGTTCCTCTTTTTGA。

[0030] The present invention also provides amplification primer sequences of BnTAC1-1, including an upstream primer BnaTAC1-1-F having a nucleotide sequence as shown in SEQ ID No.9 and a downstream primer BnaTAC1-1-R as shown in SEQ ID No.10:

[0031] BnaTAC1-1-F:ACTGGGTGCAGAAGAAGCTG;

[0032] BnaTAC1-1-R: CGACGTCGTTCTGAGACTTC.

[0033] In one embodiment of the present invention, the protein sequence encoded by BnTAC1-2 is shown in SEQ ID No. 2: MSSEKHVYFHVVKEIDGVAKSEKKKRGEGTSEIEKNTKAILDQVGLVDALDNWFDGVLTIGTFGFDTLKFQEEAEIDDGDECESVGLDYVVVDGSIIKNVNQESDPLISNENKVYDHHEDLEALCINHFESVKTVERPVIVAAAEAEVEPEKKRTTLAELFLEDRVKDDDTKHDKKKPKNRNLDVDGQEVKYHKQNGSKLSSKFSFAKKMIISKPKDKEDSRPIKKEHDSRPIKKVHQMIKRMLKKKIHPDMDATKASKKDGPYKPALKCEALETLYLLNVPGSSF*;

[0034] Its genome sequence is shown in SEQ ID No.4:

[0035]

[0036] Its CDS sequence is shown in SEQ ID No. 6:

[0037] ATGTCATCAGAGAAACATGTGTATTTTCATGTGGTGAAAGAAATAGATGGTGTGGCGAAAAGCGAGAAAAAGAAGAGAGGTGAAGGAACAAGTGAGATAGAGAAGAACACGAAAGCTATACTGGATCAGGTTGGGTTAGTGGATGCTCTTGATAACTGGTTCGATGGAGTTCTCACCATCGGCACATTCGGTTTTGACACTTTGAAATTTCAAGAAGAAGCCGAAATAGATGATGGTGATGAATGCGAGAGTGTGGGTTTGGACTATGTCGTAGTCGATGGTAGCATCATCAAGAACGTCAACCAAGAGTCGGACCCTCTTATCTCCAATGAGAATAAGGTTTATGATCATCATGAGGATTTAGAGGCGTTATGCATTAATCACTTTGAGTCGGTCAAAACGGTTGAAAGGCCGGTGATCGTGGCCGCGGCGGAGGCCGAGGTGGAGCCGGAGAAGAAGAGGACAACACTAGCCGAGCTTTTCCTGGAAGACCGAGTAAAAGACGATGATACGAAGCATGACAAGAAGAAACCAAAGAACCGTAATCTTGATGTTGATGGCCAGGAGGTTAAATATCATAAACAAAACGGGTCAAAGCTGTCTAGTAAGTTCTCCTTTGCTAAGAAGATGATCATTTCAAAGCCCAAAGATAAAGAAGACTCGCGTCCAATCAAGAAAGAGCATGACTCGCGTCCAATCAAGAAAGTGCATCAGATGATAAAGAGGATGCTAAAGAAGAAGATTCATCCAGATATGGATGCGACTAAGGCTTCTAAAAAGGACGGTCCATACAAGCCAGCCCTGAAATGTGAAGCTCTCGAGACACTTTATCTTCTTAATGTTCCAGGTTCGTCTTTTTGA。

[0038] The present invention also provides amplification primer sequences of BnTAC1-2, including an upstream primer BnaTAC1-2-F having a nucleotide sequence as shown in SEQ ID No.11 and a downstream primer BnaTAC1-2-R as shown in SEQ ID No.12:

[0039] BnaTAC1-2-F: ACTGATTGGTATTGTCTCCC;

[0040] BnaTAC1-2-R:CACGTTGTCACAATAATAATAAAAT.

[0041] The present invention also provides the application of the above gene in regulating rapeseed plant type.

[0042] In a preferred embodiment of the present invention, the regulation of rapeseed plant type includes knocking out the gene, reducing the branching angle of rapeseed and making the rapeseed plant type compact. In one embodiment of the present invention, by constructing a CRISPR / Cas9 gene editing vector and genetically transforming Zhejiang Oil 51, gene-edited rapeseed in which both BnTAC1-1 and BnTAC1-2 were edited, and gene-edited rapeseed in which only BnTAC1-1 was edited were finally obtained. In the embodiment of the present invention, phenotypic identification showed that the average branching angle of wild-type Zhejiang Oil 51 was 36.2 degrees, the average branching angle of double-gene edited rapeseed was 24.4 degrees, and the average branching angle of single-gene edited rapeseed was 29.9 degrees. In summary, the present invention proves that the genes BnTAC1-1 and BnTAC1-2 can both control the size of the branching angle of rapeseed, and have an additive effect, which can achieve a better effect of controlling the branching angle of rapeseed.

[0043] The present invention also provides sgRNA for knocking out the gene, including sgRNA1 and sgRNA2, wherein the nucleotide sequence of sgRNA1 is shown as SEQ ID No.7, and the nucleotide sequence of sgRNA2 is shown as SEQ ID No.8;

[0044] sgRNA1:GAGTGTGGGTTTGGACTATGTGG;

[0045] sgRNA2: AGATAAGAGGGTCCGACTCTTGG.

[0046] In the present invention, after overexpression of the gene, the rapeseed plant shape becomes loose and the branch angle of the rapeseed increases.

[0047] In a preferred embodiment of the present invention, the rapeseed includes Brassica napus. As verified in the embodiment, Zhejiang Oil 51 is a rapeseed variety bred by the Institute of Crop and Nuclear Technology Utilization of Zhejiang Academy of Agricultural Sciences using Shanghai Oil 15 / Zhe Shuang 6, and was approved by the Zhejiang Provincial National Crop Variety Approval Committee in 2009, with the approval number: Zhejiang Shenyou 2009001.

[0048] The branch angle referred to in the present invention refers to the angle formed between the primary branch of rapeseed and the main stem, which is an important determinant of the rapeseed plant type. According to observation and statistics, after the gene of the present invention is knocked out, there is no difference in the number of branches, the number of siliques, the number of siliques, the length of branches and the plant height compared with the wild-type Brassica napus, but there is a difference in the branch angle.

[0049] The present invention also provides a gene editing vector comprising the above-mentioned sgRNA.

[0050] The sgRNA1 of the present invention acts on BnTAC1-1, and sgRNA2 acts on BnTAC1-1 and BnTAC1-2 together. A sequence (SEQ ID No. 13) comprising sgRNA1 and sgRNA2 is synthesized: gagtgtgggtttggactatggttttagagctagaaatagcaagttaaaataaggctagtccgttatcaacttgaaaaagtggc accgagtcggtgcaacaaagcaccagtggtctagtggtagaatagtaccctgccacggtacagacccgggttcgattcccggctggtgcaagataagagggtccgactct, and the sequence shown in SEQ ID No. 13 is connected to the intermediate vector puc57, and then the primers SEQ ID No. 14 and SEQ ID No. 15 with CRISPR / cas9 vector linker are synthesized. IDNo.15 amplifies the sgRNA1 and sgRNA2 that have been connected in series, connects the amplified fragment to the CRISPR / cas9 vector, transforms the DH5α strain after the vector is successfully constructed, and confirms the sequencing with the first-generation Sanger sequencing, and finally obtains the Agrobacterium strain that can be used for rapeseed genetic transformation containing the above-mentioned CRISPR / cas9 vector. The CRISPR / cas9 vector of the present invention comes from the laboratory of Professor Qijun Chen of China Agricultural University, and has been disclosed in the article (Xing et al. A CRISPR / Cas9 toolkit for multiplex genome editing in plants. BMC Plant Biology. 2014, 14: 327).

[0051] Primer: F (SEQ ID No. 14): cagtggtctcatgcaGAGTGTGGGTTTGGACTATG;

[0052] R (SEQ ID No. 15): cagtggtctcaaaacAGAGTCGGACCCTCTTATCT.

[0053] The present invention also provides the use of the above gene in creating rapeseed germplasm suitable for high-density planting.

[0054] In one embodiment of the present invention, a compact rapeseed can be constructed by gene knockout to increase the planting amount per unit area. For example, in the embodiment of the present invention, the gene-edited plants and wild-type plants are compared by the average vertical projection area, where the average vertical projection area s = πa 2 , a is the vertical projection length of the branch on the ground corresponding to different angles, that is, the radius of the circle formed by the vertical projection of the plant; Figure 3 In the triangle shown in C, the main stem and branch length c and branch angle A are known. According to the sine function sinA=a / c, the vertical projection length a of the branch corresponding to different angles can be calculated, which is theoretically the radius length of the vertical projection circle of the rapeseed plant on the ground. After comparison, there is no difference in the branch length of the three different genotypes of rapeseed Zheyou 51. The calculation found that the average vertical projection area of ​​the rapeseed plant with double gene function loss is 0.1859m 2 The average vertical projection area of ​​rapeseed plants with single gene functional loss was 0.2702m 2 The average vertical projection area of ​​wild-type Zheyou 51 is 0.3780 m 2 Compared with the wild-type Zheyou 51, the vertical projection area of ​​the double-gene functionally deficient rapeseed plants is reduced by more than 50%, that is, the theoretical area occupied is less than half of the wild-type Zheyou 51, and it has a strong potential for tolerance to dense planting and increased yield.

[0055] The present invention also provides a method for creating rapeseed germplasm suitable for high-density planting, which comprises knocking out the above gene in the rapeseed genome.

[0056] The present invention does not specifically limit the method for causing the loss of gene function. The gene function can be lost using conventional technical methods in the art. For example, the gene knockout method mentioned above is used to perform gene knockout in the embodiment.

[0057] The present invention also provides the use of the rapeseed germplasm suitable for high-density planting obtained by the above creation method in increasing the yield of rapeseed.

[0058] The rapeseed germplasm suitable for high-density planting constructed by the method of the present invention can increase the planting amount per unit area without affecting the yield per plant, thereby significantly improving the rapeseed yield.

[0059] To further illustrate the present invention, the genes, regulation methods and applications for regulating the branching angle of rapeseed provided by the present invention are described in detail below in conjunction with the embodiments, but they should not be construed as limiting the scope of protection of the present invention.

[0060] Example 1 Amplification of BnTAC1-1 and BnTAC1-2

[0061] 1. Synthesize primer pairs

[0062] SEQ ID No.9: BnaTAC1-1-FACTGGGTGCAGAAGAAGCTG;

[0063] SEQ ID No.10: BnaTAC1-1-R CGACGTCGTTCTGAGACTTC;

[0064] SEQ ID No.11: BnaTAC1-2-FACTGATTGGTATTGTCTCCC;

[0065] SEQ ID No. 12: BnaTAC1-2-R CACGTTGTCACATAATAATAAAAT.

[0066] 2. Use KOD Plus high-fidelity enzyme to amplify the gene sequence, 50μL amplification system: 10×PCRBuffer 5μL, 2mMdNTPs 5μL, 2mM MgSO42μL, KOD plus ploymerase 1μL, cDNA 2μL, 10pmol / μL upstream and downstream primers 1.5μL each and 32μLddH2O.

[0067] 3. Use agarose gel (1%) electrophoresis to detect the band size of the PCR product, cut the corresponding gel block according to the target band size, and use a DNA gel recovery kit to purify and recover the PCR fragment, and use Ex taq enzyme for tailing.

[0068] Since KOD plus-enzyme is a high-fidelity enzyme and the product has blunt ends, a tailing experiment is required. The tailing reaction system (10 μL) is as follows: 4 μL Ex Taq and 6 μL PCR product. 72°C, 30 min.

[0069] 4. Connect to the cloning vector pMDTM19-T, transform the ligation product into DH5α competent cells, culture at 37°C overnight, perform colony PCR detection on the next day, and send the qualified colonies to the company for Sanger sequencing.

[0070] Example 2 Regulation of rapeseed branch angle by BnTAC1-1 and BnTAC1-2

[0071] exist Figure 4 The gene position is used to design the sgRNA of the gene editing target, wherein sgRNA1: GAGTGTGGGTTTGGACTATGTGG acts on BnTAC1-1, sgRNA2: AGATAAGAGGGTCCGACTCTTGG acts on BnTAC1-1 and BnTAC1-2, and according to the sequences of sgRNA1 and sgRNA2, a vector sequence containing sgRNA1 and sgRNA2 is synthesized: gagtgtgggtttggactatggttttagagctagaaatagcaagttaaaataaggctagtccgttatcaacttgaaaaagtggc accgagtcggtgcaacaaagcaccagtggtctagtggtagaatagtaccctgccacggtacagacccgggttcgattccc ggctggtgcaagataagagggtccgactct, and connect the sequence to the intermediate vector puc57, then synthesize primers with CRISPR / cas9 vector connectors to amplify the sgRNA1 and sgRNA2 that have been connected in series, and connect the amplified fragments to the CRISPR / cas9 vector. After the vector is successfully constructed, the DH5α strain is transformed and sequenced and confirmed by the first-generation Sanger sequencing, and finally the Agrobacterium strain containing the above-mentioned CRISPR / cas9 vector that can be used for rapeseed genetic transformation is obtained.

[0072] By constructing a CRISPR / Cas9 gene editing vector, the genetic transformation of Zhejiang Oil 51 was finally obtained. Figure 1 Gene-edited rapeseed in which both BnTAC1-1 and BnTAC1-2 genes are edited, and Figure 2 The gene-edited rapeseed in which only BnTAC1-1 was edited is shown. The phenotypic identification results of the main stem and branches are shown in Tables 1 and Figure 3 As shown, the average branching angle of wild-type Zheyou 51 is 36.2 degrees, the average branching angle of double-gene edited rapeseed is 24.4 degrees, and the average branching angle of single-gene edited rapeseed is 29.9 degrees. In summary, the two genes BnTAC1-1 and BnTAC1-2 in rapeseed jointly control the branching angle of rapeseed, and have an additive effect.

[0073] Table 1 Plant type of gene-edited rapeseed

[0074]

[0075] Although the above embodiment describes the present invention in detail, it is only a part of the embodiments of the present invention, not all of the embodiments. People can also obtain other embodiments based on this embodiment without creativity, and these embodiments all fall within the protection scope of the present invention.

Claims

1. A gene for regulating the branching angle of rapeseed, characterized in that: Comprising BnTAC1-1 and / or BnTAC1-2, wherein the amino acid sequence encoded by BnTAC1-1 comprises SEQ ID No.1 or a sequence having more than 85% homology with the sequence described in SEQ ID No.1; The amino acid sequence encoded by the BnTAC1-2 includes SEQ ID No. 2 or a sequence having more than 85% homology with the sequence of SEQ ID No.

2.

2. The gene according to claim 1, characterized in that The genomic nucleotide sequences of BnTAC1-1 and BnTAC1-2 are shown in SEQ ID No.3 and SEQ ID No.

4.

3. Use of the gene according to claim 1 or 2 in regulating rapeseed plant type.

4. The use according to claim 3, characterized in that: The method for regulating the rapeseed plant type includes knocking out one gene, whereby the rapeseed branching angle is reduced and the rapeseed plant type is compact; and knocking out two genes, whereby the rapeseed branching angle is smaller and the rapeseed plant type is more compact.

5. The use according to claim 3 or 4, characterized in that: The rapeseed includes Brassica napus.

6. Use of the gene according to claim 1 or 2 in creating rapeseed germplasm suitable for high-density planting.

7. A method for creating rapeseed germplasm suitable for high-density planting, characterized in that: The method comprises knocking out the gene according to claim 1 or 2 in the rapeseed genome.

8. An sgRNA for knocking out the gene according to claim 1 or 2, characterized in that: It includes sgRNA1 and sgRNA2, wherein the nucleotide sequence of sgRNA1 is shown as SEQ ID No.7, and the nucleotide sequence of sgRNA2 is shown as SEQ ID No.

8.

9. A gene editing vector comprising the sgRNA according to claim 8.

10. Use of the rapeseed germplasm suitable for high-density planting obtained by the creation method of claim 7 in increasing rapeseed yield.

Images