Amino acid water-soluble fertilizer containing plant immune induced resistance protein, preparation method and application

Abstract

The invention relates to an amino acid water-soluble fertilizer containing plant immune induced resistance protein, and a preparation method and application thereof, and belongs to the technical field of agriculture. The amino acid water-soluble fertilizer contains plant immune induced resistance protein, the amino acid sequence of the plant immune induced resistance protein is SEQ ID No.1, and the amino acid water-soluble fertilizer also contains serine. According to the amino acid water-soluble fertilizer containing the plant immune induced resistance protein, the plant immune protein and serine synergistically act on wheat seeds and wheat seedlings, the germination rate of the seeds can be remarkably increased, the seedling height and the tillering number of the wheat seedlings can be increased, and meanwhile the morbidity of root rot is reduced.

Description

Technical Field

[0001] The invention belongs to the technical field of agriculture, and in particular relates to an amino acid water-soluble fertilizer containing a plant immunity inducing protein, a preparation method and an application thereof. Background Art

[0002] Plant diseases and insect pests seriously affect the yield and quality of crops. Although chemical control has played a major role in promoting agricultural production, the excessive use of chemical pesticides has caused serious damage to the environment, biodiversity, and human health. With the development of agricultural planting patterns, pest control is mainly based on early prevention. Through the study of plant immune induction, "plant vaccines" - plant immune induction proteins have been developed. By pre-activating the plant's own immune system, the plant's induced resistance is improved, the pathogen infection during plant growth is resisted, multiple metabolic pathways in the plant are activated, metabolism is strengthened, and plant growth and development are promoted, achieving the effect of increasing production and resisting diseases.

[0003] As a plant nutrient fertilizer, amino acid water-soluble fertilizer contains a variety of amino acids and polypeptide nutrients required for plant growth. It can increase crop yields, improve crop quality, and increase the utilization rate of nutrients. It can be used for foliar spraying, drip irrigation, and root irrigation. It can be used as a special fertilizer for water-fertilizer integration. Domestic amino acid water-soluble fertilizers implement the NY / T standard. The quality standard requires free amino acids ≥100g / L, which is divided into medium and trace elements. In the early stage of pathogen infection, it has non-host resistance and resists pathogens through calcium ion influx, callose precipitation, active oxygen burst and the production of various plant hormones. Calcium ions play an important role in inducing allergic reactions, defense reactions and growth promotion in non-host plants.

[0004] Through the combination of plant immune-inducing proteins, active amino acids and trace element ion channels, complementary synergy can be achieved in improving crop nutrition, regulating plant allergic reactions, and providing trace elements, which can promote crop disease resistance, stress resistance, increased yield and improved quality. The applicant's prior authorized invention patent CN113862206B discloses a highly efficient plant immune protein, which consists of 408 amino acids and contains 4 domains, each of which contains a stable α-helix and a hydrophilic acidic unit rich in acidic amino acids connected to it; the domains are of the same origin, and each individual domain has the ability to cause plant allergic necrosis reactions; the ordered repetition of the domains is used to achieve a multiple increase in the ability of allergic necrosis reactions and effective prevention and control of plant fungal diseases.

[0005] Through further research on the above-mentioned immune protein, it was found that the above-mentioned immune protein, as the active ingredient of amino acid water-soluble fertilizer, can act synergistically with serine to induce physiological responses in crops, improve the crops' own resistance to stress, thereby increasing production and quality and reducing adverse disasters. Summary of the invention

[0006] The invention provides an amino acid water-soluble fertilizer containing plant immunity inducing protein, and a preparation method and application thereof.

[0007] The present invention adopts the following technical scheme.

[0008] One aspect of the present invention relates to an amino acid water-soluble fertilizer containing a plant immunity inducing protein, wherein the amino acid sequence of the plant immunity inducing protein is SEQ ID No. 1, and the amino acid water-soluble fertilizer further contains serine.

[0009] In a preferred embodiment of the present invention, the weight ratio of the plant immunity inducing protein to serine is 1:3-6; preferably 1:4.

[0010] In a preferred embodiment of the present invention, the amino acid water-soluble fertilizer is a powder or a liquid preparation.

[0011] In a preferred embodiment of the present invention, the amino acid water-soluble fertilizer further contains other amino acids; the other amino acids are selected from at least one of glycine, lysine, histidine, aspartic acid and the like.

[0012] In a preferred embodiment of the present invention, the amino acid water-soluble fertilizer further contains trace element calcium, and the trace element calcium comes from at least one of calcium sulfate, sugar alcohol calcium, and calcium chloride.

[0013] Another aspect of the present invention relates to a method for preparing the amino acid water-soluble fertilizer, which comprises mixing plant immunity inducing protein and serine, and spray drying the mixture so that the air flow pulverization fineness reaches 150 mesh or more.

[0014] Another aspect of the present invention also relates to the application of the above amino acid water-soluble fertilizer, which is used to improve the germination rate of wheat seeds and / or reduce the incidence of root rot.

[0015] Another aspect of the present invention also relates to the application of the above amino acid water-soluble fertilizer, which is used to increase the seedling height and tillering number of wheat seedlings.

[0016] Beneficial effects: The amino acid water-soluble fertilizer containing plant immunity inducing protein of the present invention can significantly improve the seed germination rate, and increase the seedling height and tillering number of wheat seedlings through the synergistic effect of plant immunity protein and serine on wheat seeds and wheat seedlings. DETAILED DESCRIPTION

[0017] In order to further understand the present invention, the technical scheme of the present invention will be clearly and completely described below in conjunction with the embodiments. Obviously, the described embodiments are only part of the embodiments of the present invention, rather than all the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by ordinary technicians in this field without making creative work are within the scope of protection of the present invention.

[0018] Unless otherwise specified, all reagents involved in the embodiments of the present invention are commercially available products and can be purchased through commercial channels.

[0019] Example 1 Referring to the method disclosed in the authorized invention patent CN113862206B, a plant immune protein was prepared, and its amino acid sequence is SEQ ID No.1: MPGMSLNTSGLGASTMQISIGGAGGNNGLLGTSRQNAGLGGNSALGLGGGNQNDTVNQLAGLLTGMMMMMSMMGGGGLMGGGLGGGLGNGLGGSGGLGGEGLSNALNDMLGGSLNTLGSKGGNNTTSTTNSPLDQALGINSTSQNDDSTSGTDSTSDSSDPMQQLLKMFSEIMQSLFGDGQDGTQGSSSGGKQPTEGEQNAYKKG AGMSLNTSGLGASTMQISIGGAGGNNGLLGTSRQNAGLGGNSALGLGGGNQNDTVNQLAGLLTGMMMMMSMMGGGGLMGGGLGGGLGNGLGGSGGLGGEGLSNALNDMLGGSLNTLGSKGGNNTTSTTNSPLDQALGINSTSQNDDSTSGTDSTSDSSDPMQQLLKMFSEIMQSLFGDGQDGTQGSSSGGKQPTEGEQNAYKKGA.

[0020] Experimental group 1: The plant immune protein and serine were mixed evenly in a weight ratio of 1:5, and 300 times of water was added to prepare an amino acid water-soluble fertilizer containing plant immune-inducing protein.

[0021] Experimental group 2: The plant immune protein and serine were mixed evenly in a weight ratio of 1:4, and 300 times of water was added to prepare an amino acid water-soluble fertilizer containing plant immune-inducing protein.

[0022] Control group 1: The above plant immune protein was added into 300 times of water to prepare a water-soluble fertilizer containing plant immune inducing protein.

[0023] Control group 2: Add serine to 50 times the amount of water to make an amino acid water-soluble fertilizer.

[0024] Example 2 The method for raising wheat seeds comprises the following steps: a. Preparation of wheat seeds: Select naturally mature and strong wheat seeds for seedling cultivation; b. Wheat seed treatment: wheat seeds and the water-soluble fertilizer prepared in Example 1 were uniformly mixed in a mass ratio of 1:1, heated to 35°C, kept warm for 1 hour, the wheat seeds were taken out, and naturally drained at 25°C; c. Germination of wheat seeds: Place the wheat seeds in an environment with a temperature of 30°C for germination until 88% of the wheat seeds turn white. d. Wheat seed sowing: Sow the white wheat seeds, cover the surface of the wheat seeds with 0.3 cm of surface soil, and spray water-soluble fertilizer on the leaves twice every 15 days during the growing season; e 50 days after wheat sowing, the incidence of wheat root rot was investigated.

[0025] The germination rate test was conducted in accordance with the national standard GB / T3543-1995 Crop Seed Inspection Procedure. 100 seeds treated with water-soluble fertilizer were placed in a culture dish with two layers of saturated water filter paper at the bottom, with the ventral groove facing down and the embryo facing up. This was repeated 5 times. Distilled water was added to the culture dish that needed to be waterlogged until the wheat seeds were submerged. The seeds of each treatment were placed in an artificial climate chamber for germination, and the germination rate was calculated using the number of seeds that germinated in 7 days (each group of experiments was repeated 3 times, and the average value was taken).

[0026] Germination rate (%) = (number of seeds germinated in 7 days / total number of seeds tested) * 100% Table 1 Wheat seedling results of each experimental group

[0027] As shown in Table 1, the germination rate of wheat seeds in the experimental group was significantly higher than that in the control group, and the seedling height and tiller number of wheat seedlings were also significantly higher than those in the control group (p < 0.05). This shows that the plant immune protein and serine of the present invention can synergistically act on wheat seeds and wheat seedlings, significantly improve the seed germination rate, increase the seedling height and tiller number of wheat seedlings, and reduce the incidence of root rot. In particular, experimental group 2 can further improve the seed germination rate, further increase the seedling height and tiller number of wheat seedlings, and further reduce the incidence of root rot by adjusting the weight ratio of plant immune protein and serine.

Claims

1. An amino acid water-soluble fertilizer containing plant immune-inducing protein, characterized in that: The amino acid sequence of the plant immunity inducing protein is SEQ ID No. 1, and the amino acid water-soluble fertilizer further contains serine.

2. The amino acid water-soluble fertilizer according to claim 1, characterized in that The weight ratio of the plant immunity inducing protein to serine is 1:3-6.

3. The amino acid water-soluble fertilizer according to claim 1, characterized in that The weight ratio of the plant immunity inducing protein to serine is 1:

4.

4. The amino acid water-soluble fertilizer according to claim 1, characterized in that The amino acid water-soluble fertilizer is in the form of a powder or a liquid preparation.

5. The amino acid water-soluble fertilizer according to claim 1, characterized in that The amino acid water-soluble fertilizer further contains other amino acids; the other amino acids are selected from at least one of glycine, lysine, histidine and aspartic acid.

6. The amino acid water-soluble fertilizer according to claim 1, characterized in that The amino acid water-soluble fertilizer also contains trace element calcium, and the trace element calcium comes from at least one of calcium sulfate, sugar alcohol calcium, and calcium chloride.

7. A method for preparing the amino acid water-soluble fertilizer according to any one of claims 1 to 6, characterized in that: The method comprises mixing the plant immunity inducing protein and serine, and spray drying the mixture so that the air flow pulverization fineness reaches above 150 meshes.

8. An application of the amino acid water-soluble fertilizer according to any one of claims 1 to 6, characterized in that: The amino acid water-soluble fertilizer is used for improving the germination rate of wheat seeds and / or reducing the incidence of root rot.

9. An application of the amino acid water-soluble fertilizer according to any one of claims 1 to 6, characterized in that: The amino acid water-soluble fertilizer is used for increasing the seedling height and tillering number of wheat seedlings.

Images