S288C riboflavin kinase mutant and application thereof

By performing site-directed mutagenesis on S288C riboflavin kinase, a mutant with high activity and high alkali resistance was obtained, which solved the problems of low purity of sodium riboflavin phosphate and insufficient enzymatic reaction activity in the existing technology, and achieved the effect of efficient preparation of high-purity FMN.

CN121628875AActive Publication Date: 2026-03-10SHENZHEN HYGIEIA BIOTECHNOLOGY CO LTD
View PDF 2 Cites 0 Cited by

Patent Information

Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Filing Date
2026-02-05
Publication Date
2026-03-10

AI Technical Summary

Technical Problem

In existing technologies, the purity of riboflavin sodium phosphate produced by chemical synthesis is low, the yield of microbial fermentation is insufficient, and the enzymatic method has low reactivity and poor alkali resistance, which limits the application of FMN in the pharmaceutical and food fields.

Method used

By site-directed mutagenesis of S288C riboflavin kinase, a mutant of S288C riboflavin kinase with high activity, high alkali resistance and high selectivity was obtained, which was used to catalyze the reaction of riboflavin with adenosine triphosphate to prepare FMN.

Benefits of technology

The mutated S288C riboflavin kinase exhibits significantly enhanced activity, improved alkali resistance, high catalytic efficiency, and high product purity, thereby reducing production costs and shortening the purification cycle.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN121628875A_ABST
    Figure CN121628875A_ABST
Patent Text Reader

Abstract

The invention discloses an S288C riboflavin kinase mutant and application thereof, and belongs to the technical field of riboflavin kinase. The amino acid sequence of the S288C riboflavin kinase mutant disclosed by the invention is as shown in SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO: 6. The original riboflavin kinase is subjected to site-directed mutagenesis and screening to obtain the S288C riboflavin kinase mutant which has high activity, high alkali resistance and high selectivity and is suitable for industrial application, and the S288C riboflavin kinase mutant has a wide application prospect when being used for preparing FMN.
Need to check novelty before this filing date? Find Prior Art

Description

TECHNICAL FIELD

[0001] The application belongs to the technical field of riboflavin kinase, and particularly relates to a S288C riboflavin kinase mutant and application thereof. BACKGROUND

[0002] Commercial riboflavin mononucleotide (CAS No. 146-17-8) usually exists in the form of sodium salt (CAS No. 130-40-5), i.e. riboflavin 5'-phosphate sodium or riboflavin phosphate sodium. The main methods for industrial production of FMN (riboflavin mononucleotide) at home and abroad are chemical method, whole cell / microbial fermentation method and enzyme method.

[0003] There are mainly two synthesis routes for the chemical synthesis method: one is to make riboflavin react with partially hydrolyzed phosphorus oxychloride (POCl3) in an organic solvent to generate FMN, then hydrolyze excessive POCl3, and then neutralize with NaOH solution to obtain riboflavin 5'-phosphate sodium after filtration; the other is to make riboflavin react with POCl3 in an organic solvent to generate cyclic riboflavin 4', 5'-phosphochloridate, then hydrolyze phosphochloridate and excessive POCl3, and then neutralize with NaOH solution to obtain riboflavin 5'-phosphate sodium after filtration. The process steps of chemical synthesis are simple, but the produced riboflavin phosphate sodium product is composed of 3'-riboflavin phosphate sodium, 4'-riboflavin phosphate sodium, 5'-riboflavin phosphate sodium (common name: riboflavin phosphate sodium), riboflavin diphosphate (3'4'-riboflavin phosphate sodium, 3'5'-riboflavin phosphate sodium, 4'5'-riboflavin phosphate sodium), free riboflavin and other impurities. Among them, especially the related substances riboflavin diphosphate and free riboflavin have high content and many impurities, which seriously affect the purity of riboflavin 5'-phosphate sodium.

[0004] The microbial fermentation method synthesizes riboflavin and FMN from scratch through direct metabolism of cheap raw materials such as glucose by microorganisms. The highest yield (fermentation) of the high-yield riboflavin mononucleotide Escherichia coli strain reported in the public report is 1537.2 mg / L. Due to the complexity of the synthesis pathway of riboflavin and FMN, the yield of FMN produced by the microbial fermentation method still cannot meet the demand of commercial production, which limits the application and market scale of FMN in the fields of medicine, food and the like.

[0005] The enzyme method obtains FMN through the catalysis of riboflavin kinase on the reaction of riboflavin and adenosine triphosphate. Compared with the chemical method and the whole cell / microbial fermentation method, the enzyme method has mild reaction conditions and strong selectivity, but has the disadvantages of low reaction activity and poor alkali resistance of protease, and the selectivity needs to be further improved. SUMMARY

[0006] To overcome the shortcomings of existing technologies, this invention provides an S288C riboflavin kinase mutant and its applications. This invention obtains an S288C riboflavin kinase mutant with high activity, high alkali resistance, high selectivity, and suitability for industrial applications through site-directed mutagenesis and screening of the original riboflavin kinase. This mutant has broad application prospects in the preparation of FMN.

[0007] The technical solution adopted by this invention to solve its technical problem is: The present invention provides an S288C riboflavin kinase mutant, the amino acid sequence of which is shown in SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO: 6.

[0008] This invention provides a nucleotide sequence of an S288C riboflavin kinase mutant, obtained by mutating SEQ ID NO: 1 to N21A / Q43E / C59S / E105K / N144D / D165A / A207I / Q212E, N21A / C59S / E105K / N144D / D165A / A207I / Q212E, N21A / Q43E / C59S / D88R / E105K / N144D / A207I, or N21A / C59S / D88R / E105K / R111L / N144D / A207I; used to express the above-mentioned S288C riboflavin kinase mutant. Specifically, N21A indicates that the nucleotide corresponding to amino acid N at position 21 of the template has been mutated to the nucleotide corresponding to amino acid A.

[0009] The present invention provides an S288C riboflavin kinase mutant plasmid, wherein the S288C riboflavin kinase mutant plasmid contains the above-mentioned S288C riboflavin kinase mutant nucleotide sequence.

[0010] This invention provides an S288C riboflavin kinase mutant bacterium, wherein the S288C riboflavin kinase mutant bacterium contains the aforementioned S288C riboflavin kinase mutant nucleotide sequence or the aforementioned S288C riboflavin kinase mutant plasmid. It is used for expressing the S288C riboflavin kinase mutant.

[0011] Preferably, the bacteria are Escherichia coli Rosetta strain, Escherichia coli DH5α strain, or Escherichia coli Top10 strain.

[0012] The present invention provides an immobilized enzyme of S288C riboflavin kinase mutant, wherein the immobilized enzyme of S288C riboflavin kinase mutant includes the above-mentioned S288C riboflavin kinase mutant.

[0013] Preferably, the S288C riboflavin kinase mutant immobilized enzyme further includes a solid-phase carrier.

[0014] More preferably, the S288C riboflavin kinase mutant and the solid-phase vector are covalently linked.

[0015] This invention provides a method for preparing flavin mononucleotide, comprising the following steps: The above-mentioned S288C riboflavin kinase mutant or the above-mentioned S288C riboflavin kinase mutant immobilized enzyme is added to a mixture containing at least one of adenosine triphosphate and adenosine triphosphate salt and riboflavin, and the reaction yields flavin mononucleotide.

[0016] Preferably, the S288C riboflavin kinase mutant is obtained by expression of the above-mentioned S288C riboflavin kinase mutant bacteria; the S288C riboflavin kinase mutant immobilized enzyme is obtained by covalently linking the S288C riboflavin kinase mutant to a solid-phase carrier.

[0017] Preferably, the amount of the S288C riboflavin kinase mutant added is 1-5 g / L, and the amount of the S288C riboflavin kinase mutant immobilized enzyme added is 2-10 g / L.

[0018] More preferably, the amount of the S288C riboflavin kinase mutant added is 1.5 g / L, and the amount of the S288C riboflavin kinase mutant immobilized enzyme added is 4.0 g / L.

[0019] Preferably, the concentration of riboflavin in the mixture containing at least one of adenosine triphosphate and adenosine triphosphate salt and riboflavin is 5-50 g / L, the total concentration of adenosine triphosphate and adenosine triphosphate salt is 50-200 mM, and the pH is 7.0-10.0.

[0020] Preferably, the reaction temperature is 35-40℃ and the reaction time is 10 min-9 h.

[0021] Preferably, after the reaction is completed, the S288C riboflavin kinase mutant immobilized enzyme is recovered and reused.

[0022] Further preferred, the S288C riboflavin kinase mutant immobilized enzyme was recovered more than 20 times. The S288C riboflavin kinase mutant immobilized enzyme retained more than 99% of its enzyme activity even after 20 recoveries.

[0023] The beneficial effects of this invention are: (1) The enzyme activity of the S288C riboflavin kinase mutant after mutation in this invention is significantly increased, with an increase of more than 50%; (2) The S288C riboflavin kinase mutant of the present invention has significantly improved alkali resistance and retains more than 92% of enzyme activity after 1 hour of alkaline heating treatment; (3) The S288C riboflavin kinase mutant of the present invention can catalyze the reaction of riboflavin at a concentration of 100 mM or higher to generate FMN, with a molar conversion rate of substrate riboflavin of over 94%. (4) The immobilized enzyme of the present invention can be recovered and re-reacted multiple times, reducing the production cost of the product, while reducing protein impurities in the product and shortening the purification cycle of FMN. (5) Compared with chemical synthesis, the method for preparing flavin mononucleotides in this invention does not require the addition of organic reagents, has high product specificity, and can generate high-purity FMN. Compared with microbial fermentation, the product concentration of enzyme-catalyzed reaction is high, which reduces the cost of product purification. Attached Figure Description

[0024] Figure 1 This is the liquid chromatogram before the reaction in Example 13; Figure 2 This is the liquid chromatogram of Example 13 at the end of the reaction. Detailed Implementation

[0025] The present invention will be further described below with reference to embodiments.

[0026] The following will clearly and completely describe the concept, specific solutions, and technical effects of the present invention with reference to embodiments, so as to fully understand the purpose, features, and effects of the present invention. Obviously, the described embodiments are only a part of the embodiments of the present invention, not all of them. Other embodiments obtained by those skilled in the art based on the embodiments of the present invention without creative effort are all within the scope of protection of the present invention. The various technical features in the present invention can be combined interactively without contradicting each other.

[0027] The specific implementation process of this invention mainly includes: PCR amplification of wild-type nucleotide sequence → sequencing verification → gene mutation → sequencing verification → enzyme activity determination → alkaline stability enzyme activity determination → enzyme catalysis experiment.

[0028] Example 1 Construction of wild-type riboflavin kinase plasmid and strain: The riboflavin kinase nucleotide sequence of Saccharomyces cerevisiae s288c was found on NCBI. The corresponding primers were designed using Primer Premier 6. NotI restriction sites were added to the C-terminal primer of the riboflavin kinase nucleotide sequence and EcoRI restriction sites were added to the N-terminal primer.

[0029] Nucleic acid extract from yeast strain S288C was used as a template for PCR amplification using designed primers. The amplified fragment was double-digested with restriction endonucleases NotI and EcoRI (purchased from New England Biolabs, NEB) at 37℃ for 2 h, separated by 1% agarose gel electrophoresis, and then recovered by gel extraction (gel recovery kit purchased from Tiangen Biotech (Beijing) Co., Ltd.). Subsequently, it was ligated with the expression vector pET-28a(+) (General Biotech), which had undergone the same double digestion, at 22℃ for 30 min using T4 DNA ligase (purchased from New England Biolabs, NEB). The ligation solution was transformed into competent cells of the Top 10 strains of Escherichia coli. Single clones were selected, and plasmids were extracted for PCR and sequencing verification. The obtained S288C-wild-type plasmid was sequenced, and its riboflavin kinase nucleotide sequence is shown in SEQ ID NO: 1. The S288C-wild-type plasmid was transformed into the expression host strain Rosetta to obtain the S288C-wild-type strain. The amino acid sequence of the expressed riboflavin kinase is shown in SEQ ID NO: 2.

[0030] SEQ ID NO: 1 ATGTTTACGTGGACTATTTATGTTTCGTTATTGCTAGTGTTAGCAGGTACTTTCTTAATGAACCGAAATACGAATACAGATATAATTGATACTTTTAAACGAGAAGTCGATTTGCCAATACCTGCGCAACCAGGTCCACCATTCCCGCTTGTTACTGACTATTGTGACATTGTATGTGGATTTGGCCGCGGATCCGCCGAATTGGGTATTCCCACTGCCAATGTACCTATAAATCAGTTACCTAAAGGTATCAACGATTTGGATTTAGGGGTTTACTTTGGGTTTGCTCACATTAAAACTGTTGATGGTCAAGAACTATCGGTGGAAACAAGGCGGGATGGAAGAACTGTGGTTTATAATTACGGTCAATATTTAAGTGAAGCGAACGATGATTTGTCCGTACTTCCTATGGTACTTTCAGTTGGGAAAAATCCATTCTACGGAAATGATTTCAAAACCATGGAATTACATATTATACATGATTTTAAAAATGATTTTTATGGGGCCAGGGTCAAGTTCAATATTTTAGGTCATATCAGACCCGAATTGAACTACACTACTAAGGAAGCTCTGATCGAAGACATCAATATCGATATTAGGACTGCGCAGACTGTCCTTGCCACTCCACCGTATCAAGTATTCAAACAACAATTA; SEQ ID NO: 2 MFTWTIYVSLLLVLAGTFLMNRNTNTDIIDTFKREVDLPIPAQPGPPFPLVTDYCDIVCGFGRGSAELGIPTANVPINQLPKGINDLDLGVYFGFAHIKTVDGQELSVETRRDGRTVVYNYGQYLSEANDDLSVLPMVLSVGKNPFYGNDFKTMELHIIHDFKNDFYGARVKFNILGHIRPELNYTTKEALIEDINIDIRTAQTVLATPPYQVFKQQL。

[0031] Example 2 Construction of mutant plasmids and strains: After reviewing literature and performing molecular docking through 3D modeling, the active pocket of riboflavin kinase was identified, and suitable mutation sites were screened to design corresponding primers for mutation.

[0032] (1) Selection of gene mutation sites: Direction: To improve alkali resistance and increase enzyme activity; The theoretical basis for screening mutation sites: S1. Surface residue basicization: Mutate surface Asp(D) and Glu(E) to Lys(K) and Arg(R) (positively charged residues) to reduce negative charge repulsion in an alkaline environment and enhance protein stability; preferentially select residues with an exposure of >50% (such as N-terminus, C-terminus and loop region, i.e. surface loop region) to avoid mutations in the α-helix / β-sheet of the core region; S2. Reduce unstable groups: Replace Cys(C) (easily oxidized and crosslinked) with Ser(S) / Ala(A), and replace Asn(N) / Gln(Q) (easily deamided) with Asp(D) / Glu(E) or Ala(A) to avoid covalent bond breakage under alkaline conditions; S3. Enhance hydrogen bonding and hydrophobic interactions: Introduce hydrophobic residues such as Leu (L) and Ile (I) by mutation in the core region of the protein (mutate only 1-2 sites), or add Arg (R)-Asp (D) and Lys (K)-Glu (E) salt bridges on the surface to maintain the rigidity of the three-dimensional structure.

[0033] (2) Mutation: KOD One™ PCR Master Mix from Toyobo was used.

[0034] S1. The PCR system is shown in Table 1; Table 1:

[0035] S2. The PCR procedure is shown in Table 2; Table 2:

[0036] (3) The S288C-wild-type plasmid was subjected to site-directed mutagenesis PCR using KOD One™ PCR Master Mix from Toyobo. The mutation sites were: N21D, N21A, E35R, D37R, Q43E, Q43A, C59S, C59A, D88R, D88K, D102R, Q104A, E105K, R111L, R111A, N120A, Q123E, E127K, E127R, N129D, N144D, N149D, D 161K, D161A, D165R, D165A, E182K, N184D, N184A, A207I, and Q212E (codons before and after mutation are shown in Table 3). A total of 2104 mutant plasmids were designed based on different combinations of mutation sites. The first round involved 31 single-site mutations, the second round involved 921 double-site mutations, and subsequent rounds of mutations selected 192 strains from the previous round for each round, for a total of 8 rounds. Each mutation targeted one site. The template of the plasmid to be mutated and the primers used for mutation were amplified by PCR. The PCR product was digested with DpnI to obtain the mutant plasmid after one mutation. This process was repeated multiple times according to the design to obtain the target mutant plasmid, which was then directly transformed into *E. coli* DH5a strain. Single clones were selected, plasmids were extracted, and sequenced. Plasmids that were successfully sequenced were transformed into the expression host strain *Rosetta* to obtain the S288C- mutant strain.

[0037] Table 3: Codon Changes Before and After Mutation

[0038] Example 3 Strain enzyme activity verification Expression was induced in the S288C wild-type strain and the S288C mutant strain: 10 μl of the corresponding strain's glycerol was inoculated into 200 mL of LB medium (containing a final concentration of 50 mg / L kanamycin) and cultured at 37 °C for 3 h. The temperature was then lowered to 25 °C, and IPTG was added to a final concentration of 1 mM for an additional 16 h of culture. The cells were then collected. The cells were resuspended in 100 mM PBS (pH 7.6) at a ratio of 1 g to 4 mL (cell weight: PBS solution = 1 g: 4 mL), sonicated (150 W, 2 s / 2 s, 20 min), and centrifuged at 10,000 rpm for 10 min at 4 °C. The supernatant enzyme solution was collected.

[0039] The enzyme solution was diluted to 15 g / L after the protein concentration was determined using NanoDrop 2000. 100 μl of the diluted enzyme solution was added to 900 μl of reaction solution (a mixture of 5 g / L riboflavin, 8.5 g / L ATP-2Na, and 100 mM sodium phosphate, pH 8.0) and placed in a 37°C water bath at 100 rpm for 10 min.

[0040] The amount of enzyme required to convert riboflavin into 1 μmol FMN within 1 minute is defined as 1 U, and the results of some enzyme activity assays are shown in Table 4.

[0041] Table 4: Results of enzyme activity assays for wild-type and mutant strains

[0042] According to the experimental results in Table 4, the enzyme activity of the enzyme solution of the S288C mutant strain varied compared with that of the wild-type S288C strain. Among them, the riboflavin kinase activity of S288C mutant strains 1-4 was significantly increased, by more than 50%, and the corresponding amino acid sequences are shown in SEQ ID NO: 3-6.

[0043] SEQ ID NO: 3 MFTWTIYVSLLLVLAGTFLMARNTNTDIIDTFKREVDLPIPAEPGPPFPLVTDYCDIVSGFGRGSAELGIPTANVPINQLPKGINDLDLGVYFGFAHIKTVDGQKLSVE TRRDGRTVVYNYGQYLSEANDDLSVLPMVLSVGKDPFYGNDFKTMELHIIHDFKNAFYGARVKFNILGHIRPELNYTTKEALIEDINIDIRTAQTVLITPPYEVFKQQL; SEQ ID NO: 4 MFTWTIYVSLLLVLAGTFLMARNTNTDIIDTFKREVDLPIPAQPGPPFPLVTDYCDIVSGFGRGSAELGIPTANVPINQLPKGINDLDLGVYFGFAHIKTVDGQKLSVE TRRDGRTVVYNYGQYLSEANDDLSVLPMVLSVGKDPFYGNDFKTMELHIIHDFKNAFYGARVKFNILGHIRPELNYTTKEALIEDINIDIRTAQTVLITPPYEVFKQQL; SEQ ID NO: 5 MFTWTIYVSLLLVLAGTFLMARNTNTDIIDTFKREVDLPIPAEPGPPFPLVTDYCDIVSGFGRGSAELGIPTANVPINQLPKGINDLRLGVYFGFAHIKTVDGQKLSVE TRRDGRTVVYNYGQYLSEANDDLSVLPMVLSVGKDPFYGNDFKTMELHIIHDFKNDFYGARVKFNILGHIRPELNYTTKEALIEDINIDIRTAQTVLITPPYQVFKQQL; SEQ ID NO: 6 MFTWTIYVSLLLVLAGTFLMARNTNTDIIDTFKREVDLPIPAQPGPPFPLVTDYCDIVSGFGRGSAELGIPTANVPINQLPKGINDLRLGVYFGFAHIKTVDGQKLSVE TLRDGRTVVYNYGQYLSEANDDLSVLPMVLSVGKDPFYGNDFKTMELHIIHDFKNDFYGARVKFNILGHIRPELNYTTKEALIEDINIDIRTAQTVLITPPYQVFKQQL.

[0044] Example 4 Alkali resistance verification Riboflavin has increased solubility under alkaline conditions. Increasing the substrate concentration can improve the catalytic efficiency of riboflavin kinase and promote the formation of FMN.

[0045] Alkaline treatment of enzyme solution: Take 1 mL of the undiluted supernatant enzyme solution obtained in Example 3, add 20 µL of sodium hydroxide (4 M), and place in a water bath at 37 °C for 1 h.

[0046] The treated enzyme solution was diluted to 15 g / L after the protein concentration was determined using a NanoDrop 2000. 100 μL of the diluted enzyme solution was added to 900 μL of reaction solution (a mixture of 5 g / L riboflavin, 8.5 g / L ATP-2Na, and 100 mM sodium phosphate, pH 8.0) and placed in a 37°C water bath at 100 rpm for 10 min.

[0047] The amount of enzyme required to convert 1 μmol of riboflavin to 1 μmol of FMN within 1 minute is defined as 1 U. The enzyme activity assay results are shown in Table 5.

[0048] Table 5: Enzyme activity assay results of wild-type and mutant strains after alkaline heating treatment

[0049] According to the experimental results in Table 5, the riboflavin kinase of S288C- mutant strains 1-4 can still retain more than 92% of the enzyme activity after 1 hour of alkaline heating treatment, among which S288C- mutant strains 1, 2 and 4 have better alkali resistance.

[0050] Example 5 Enzymatic reaction of S288C wild-type strain under pH 8.0 conditions The enzyme solution of the S288C-wild-type strain obtained in Example 3 was diluted to 15 g / L after the protein concentration was determined using NanoDrop 2000. 5 g of riboflavin (132.8 mM) and 8.5 g of ATP-2Na (154.3 mM) were dissolved in 90 mL of 100 mM pH 8.0 sodium phosphate buffer. After the substrate dissolved, its auxiliary ions (60 mM magnesium chloride, 30 mM ammonium sulfate) and 10 mL of enzyme solution were added. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 8.0 ± 0.5, and mechanically stirred at 200 rpm for 6 h. The reaction was then terminated. High-performance liquid chromatography (HPLC) showed that the riboflavin substrate was completely consumed, and the molar concentration of FMN was 122.71 mM, indicating a molar yield of 92.40%.

[0051] Example 6 Enzymatic reaction of S288C- mutant strain 4 under pH 8.0 conditions The enzyme solution of S288C- mutant strain 4 prepared in Example 3 was diluted to 15 g / L after the protein concentration was determined by NanoDrop 2000. 5 g of riboflavin and 8.5 g of ATP-2Na were dissolved in 90 mL of 100 mM pH 8.0 sodium phosphate buffer. After the substrate dissolved, its auxiliary ions (60 mM magnesium chloride, 30 mM ammonium sulfate) and 10 mL of enzyme solution were added. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 8.0 ± 0.5, and mechanically stirred at 200 rpm for 5 h. The reaction was then terminated. High-performance liquid chromatography (HPLC) showed that the riboflavin substrate was completely consumed, and the molar concentration of FMN was 125.15 mM, i.e., a molar yield of 94.24%.

[0052] Example 7 Enzymatic reaction of S288C wild-type strain under pH 10.0 conditions The enzyme solution of the S288C-wild-type strain obtained in Example 3 was diluted to 15 g / L after the protein concentration was determined using NanoDrop 2000. 5 g of riboflavin (132.8 mM) and 8.5 g of ATP-2Na (154.3 mM) were dissolved in 90 mL of 100 mM pH 10.0 sodium phosphate buffer. After the substrate dissolved, its auxiliary ions (60 mM magnesium chloride, 30 mM ammonium sulfate) and 10 mL of enzyme solution were added. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 10.0 ± 0.5, and mechanically stirred at 200 rpm for 8 h. The reaction was then terminated. High-performance liquid chromatography (HPLC) analysis showed that the riboflavin substrate was not completely consumed, and the molar concentration of FMN was 109.68 mM, indicating a molar yield of 82.59%.

[0053] Example 8 Enzymatic reaction of S288C- mutant strain 4 under pH 10.0 conditions The enzyme solution of S288C- mutant strain 4 obtained in Example 3 was diluted to 15 g / L after the protein concentration was determined by NanoDrop 2000. 5 g of riboflavin (132.8 mM) and 8.5 g of ATP-2Na (154.3 mM) were dissolved in 90 mL of 100 mM pH 10.0 sodium phosphate buffer. After the substrate dissolved, its auxiliary ions (60 mM magnesium chloride, 30 mM ammonium sulfate) and 10 mL of enzyme solution were added. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 10.0 ± 0.5, and mechanically stirred at 200 rpm for 3 h. The reaction was then terminated. High-performance liquid chromatography (HPLC) showed that the riboflavin substrate was completely consumed, and the molar concentration of FMN was 129.45 mM, indicating a molar yield of 97.48%.

[0054] Example 9 Small-scale fermentation of riboflavin kinase 10 μl of the S288C- mutant strain 4 glycerol strain constructed in Example 2 was inoculated into 200 mL of LB medium (containing 50 mg / L kanamycin) and cultured at 37 °C for 16 h. Then, 200 mL / 2 L (1.0%) of the medium was inoculated into the fermentation medium and cultured at 37 °C. The pH of the fermentation culture was maintained at around 6.8. Feeding was started after 2 h of fermentation, and dissolved oxygen was maintained at around 20%. When the OD600 reached 10, the temperature was lowered to the induction temperature of 20 °C, and 0.1 mM IPTG was added. After induction, fermentation continued for 15 h. The cells were collected by centrifugation at 6000 rpm and then suspended in 100 mM pH 6.0 sodium phosphate buffer. The cells were sonicated (150 W, 2 s / 2 s, 20 min) and centrifuged at 4 °C and 12000 rpm for 20 min. The supernatant enzyme solution was collected.

[0055] Example 10 His-tagged purification and immobilization of riboflavin kinase The enzyme solution prepared in Example 9 was adjusted to pH 7.5 with 1M sodium hydroxide solution, and NiSeplife FF affinity chromatography medium was added at a ratio of 1g / 30mg riboflavin kinase. The mixture was stirred at 200rpm for 8 hours at room temperature, and the NiSeplife FF medium adsorbed with riboflavin kinase was collected. 200mM imidazole solution (pH 8.3) was added at a mass-to-volume ratio of 1g:2ml, and the mixture was stirred at 200rpm for 3 hours at room temperature, and the eluent was collected. Dipotassium hydrogen phosphate was added to the eluent to a concentration of 0.2M, and LX-1000EP solid-phase carrier was added at a ratio of 1g / 50mg riboflavin kinase. The mixture was stirred at 200rpm for 16 hours at room temperature. The immobilized enzyme was collected by centrifugation at 500rpm using a plate centrifuge and washed with pure water.

[0056] Example 11 Enzyme activity verification of immobilized enzymes 5 g of riboflavin, 8.5 g of ATP-2Na, and their auxiliary ions (60 mM magnesium chloride and 30 mM ammonium sulfate) were dissolved in 100 mL of 100 mM pH 10.0 sodium phosphate buffer. After the substrate dissolved, the immobilized enzyme prepared in Example 10 was added at a protein concentration of 4 g / L. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 10.0 ± 0.5, and mechanically stirred at 200 rpm for 3 h. After the reaction, the riboflavin substrate was completely consumed, and the molar concentration of FMN was 126.51 mM, i.e., the molar yield was 95.26%. The immobilized enzyme was recovered by filtration through a 500-mesh filter cloth.

[0057] Example 12 Application experiment of immobilized riboflavin kinase 5 g of riboflavin, 8.5 g of ATP-2Na, and their auxiliary ions (60 mM magnesium chloride and 30 mM ammonium sulfate) were dissolved in 100 mL of 100 mM pH 10.0 sodium phosphate buffer. After the substrate dissolved, the immobilized enzyme recovered in Example 11 was added. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 10.0 ± 0.5. The mixture was mechanically stirred at 200 rpm for 3 h, and the immobilized enzyme was recovered for the next reuse. The molar concentration of FMN was determined by high performance liquid chromatography (HPLC), and the enzyme activity retention rate was calculated by comparing it with the FMN concentration at the end of the reaction in Example 11.

[0058] The above experiment was repeated 20 times, and the results are shown in Table 6.

[0059] Table 6:

[0060] According to the experimental results in Table 6, the immobilized riboflavin kinase retained 99% of its enzyme activity after 20 applications.

[0061] Example 13 Scale-up experiment 500 g of riboflavin, 850 g of ATP-2Na, and its auxiliary ions (60 mM magnesium chloride and 30 mM ammonium sulfate) were dissolved in 10 L of 100 mM pH 10.0 sodium phosphate buffer. After the substrate dissolved, the immobilized enzyme prepared in Example 10 was added at a protein concentration of 4 g / L. The reaction was carried out in a 37°C water bath, with the pH controlled within the range of 10.0 ± 0.5, and mechanically stirred at 200 rpm for 2.5 h. After the reaction, the molar concentration of FMN was detected by high performance liquid chromatography (HPLC), which was 129.19 mM, i.e., a molar yield of 97.28%. The immobilized enzyme was recovered by filtration. After purification processes such as column purification, membrane filtration, and crystallization, 505.04 g of riboflavin mononucleotide with a purity of 96.46% was obtained.

[0062] The liquid chromatogram before the reaction is shown below. Figure 1 Riboflavin corresponds to the peak at 16.0 min, and ATP corresponds to the peak at 3.6 min. The liquid chromatogram at the end of the reaction is shown in the figure. Figure 2 ATP corresponds to the peak at 3.6 min, ADP corresponds to the peak at 4.1 min, AMP corresponds to the peak at 6.5 min, FMN corresponds to the peak at 15.1 min, and riboflavin corresponds to the peak at 16.0 min.

[0063] The above is a detailed description of the preferred embodiments of the present invention. However, the present invention is not limited to the embodiments described. Those skilled in the art can make various equivalent modifications or substitutions without departing from the spirit of the present invention. All such equivalent modifications or substitutions are included within the scope defined by the claims of the present invention.

Claims

1. A S288C riboflavin kinase mutant, characterized in that, The amino acid sequence of the S288C riboflavin kinase mutant is shown in SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO:

6.

2. A S288C riboflavin kinase mutant nucleotide sequence, characterized in that, The S288C riboflavin kinase mutant nucleotide sequence is mutated based on SEQ ID NO: 1 as a template to obtain N21A / Q43E / C59S / E105K / N144D / D165A / A207I / Q212E, N21A / C59S / E105K / N144D / D165A / A207I / Q212E, N21A / Q43E / C59S / D88R / E105K / N144D / A207I or N21A / C59S / D88R / E105K / R111L / N144D / A207I.

3. A S288C riboflavin kinase mutant plasmid, characterized in that, The S288C riboflavin kinase mutant plasmid contains the S288C riboflavin kinase mutant nucleotide sequence of claim 2.

4. A S288C riboflavin kinase mutant bacterium, characterized in that, The S288C riboflavin kinase mutant bacteria contain the S288C riboflavin kinase mutant nucleotide sequence of claim 2 or the S288C riboflavin kinase mutant plasmid of claim 3.

5. The S288C riboflavin kinase mutant bacterium of claim 4, wherein the bacterium is a strain of Escherichia coli. The bacteria are Escherichia coli Rosetta strain, Escherichia coli DH5α strain or Escherichia coli Top10 strain.

6. A S288C riboflavin kinase mutant immobilized enzyme, characterized in that, The S288C riboflavin kinase mutant immobilized enzyme comprises the S288C riboflavin kinase mutant of claim 1.

7. The S288C riboflavin kinase mutant immobilized enzyme according to claim 6, characterized in that, The S288C riboflavin kinase mutant immobilized enzyme further comprises a solid carrier. The S288C riboflavin kinase mutant and the solid carrier are covalently linked.

8. A method for preparing a flavin mononucleotide, characterized by, The method comprises the following steps: The S288C riboflavin kinase mutant of claim 1 or the S288C riboflavin kinase mutant immobilized enzyme of any one of claims 6-7 is added to a mixture containing at least one of adenosine triphosphate and adenosine triphosphate salt and riboflavin, and a flavin mononucleotide is obtained by reaction.

9. The method for preparing a flavin mononucleotide according to claim 8, wherein The S288C riboflavin kinase mutant is added in an amount of 1-5 g / L, and the S288C riboflavin kinase mutant immobilized enzyme is added in an amount of 2-10 g / L. The mixture containing at least one of adenosine triphosphate and adenosine triphosphate salt and riboflavin has a riboflavin concentration of 5-50 g / L, a total concentration of adenosine triphosphate and adenosine triphosphate salt of 50-200 mM, and a pH of 7.0-10.

0. The reaction temperature is 35-40℃, and the reaction time is 10 min-9 h.

10. The method for preparing a flavin mononucleotide according to claim 8, wherein After the reaction is completed, the S288C riboflavin kinase mutant immobilized enzyme is recovered and reused; the S288C riboflavin kinase mutant immobilized enzyme retains more than 99% of the enzyme activity after being recovered for 20 times.

Citation Information

Patent Citations

  • Method for constructing engineering strain for producing flavin mononucleotide, and applications of engineering strain

    CN108330136A

  • FAD synthetase mutant and application thereof in preparation of FMN

    CN118240796A