Systems and methods for regulating target genes

A library of complexes with heterologous gene effectors and guide nucleic acids is used to specifically bind to target genes, addressing the limitations of current gene modulation strategies by achieving robust, persistent, and reversible gene expression regulation.

GB2626087BActive Publication Date: 2026-05-29EPICRISPR BIOTECHNOLOGIES INC

Patent Information

Authority / Receiving Office
GB · GB
Patent Type
Patents
Current Assignee / Owner
EPICRISPR BIOTECHNOLOGIES INC
Filing Date
2022-07-20
Publication Date
2026-05-29

AI Technical Summary

Technical Problem

Current strategies for modulating gene expression are often not robust, persistent, and/or reversible, and only a limited number of gene effectors are available to regulate a wide variety of target genes.

Method used

A method involving a library of complexes, each comprising a heterologous gene effector and a guide nucleic acid sequence, is used to specifically bind to a target endogenous gene, followed by sorting cells based on expression changes and identifying lead effectors that achieve desired modulation.

Benefits of technology

This approach allows for robust, persistent, and reversible modulation of gene expression, enabling effective regulation of specific target genes, including disease-associated and differentiation-associated genes.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 00000001_0000
    Figure 00000001_0000
  • Figure 00000002_0000
    Figure 00000002_0000
  • Figure 00000003_0000
    Figure 00000003_0000
Patent Text Reader

Abstract

The disclosure provides compositions, methods, and systems for modulating expression of target genes (e.g., target endogenous genes). Complexes of the disclosure can be useful for bringing one or more
Need to check novelty before this filing date? Find Prior Art

Description

CROSS REFERENCE [1] This application claims priority to and the benefit of United States Provisional Patent Application No. 63 / 223,842, filed July 20, 2021. SEQUENCE LISTING [2] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format. Said ASCII copy, created on July 17, 2022, is named 55176-715_601_SL.txt and is 41,277,379 bytes in size. BACKGROUND [3] Complex networks regulate gene expression, underpinning survival, growth, differentiation, and various physiological functions of cells. In some cases, one or more specific genes can be turned on or turned off to effect such regulation in the cells. In some cases, aberrant expression of particular genes contributes to many diseases and conditions. Aberrant expression of a gene of interest can be abnormally increased expression level of the gene, abnormally decreased expression level of the gene, abnormally prolonged duration of expression of the gene, or abnormally shortened duration of expression of the gene. SUMMARY [4] The invention is set out in the appended set of claims. References to methods of treatment by therapy of this description are to be interpreted as references to compounds, pharmaceutical compositions and medicaments of the present invention for use in those methods. Agents that are capable of modulating expression of specific genes in a desirable way can have therapeutic benefit, but many strategies that are currently employed fail to elicit effects that are robust, persistent, and / or reversible. In addition, only a selected few gene effectors have been explored and utilized to regulate a wide variety of target genes. Thus, various aspects of the present disclosure provide systems, methods, and compositions comprising one or more gene effectors that can be tailor-made for regulating a specific target gene (e.g., upregulating expression, downregulating expression, prolonging or shortening duration of expression, etc.). [5] Disclosed herein is a method, comprising: (a) contacting a population of cells with a library of complexes, wherein an individual complex of the library comprises: (i) a heterologous gene effector that is different from heterologous gene effectors in other complexes of the library; and (ii) a guide nucleic acid sequence that exhibits 100% sequence identity to guide nucleic acid sequences in the other complexes of the library, wherein the heterologous gene effector and the guide nucleic acid molecule form the individual complex that exhibits specific binding to a target endogenous gene in the population of cells, and wherein the library comprises at least 25 different complexes; (b) upon the contacting, sorting the population of cells based on a change in expression or activity level of the target endogenous gene in the population of cells; and (c) identifying one or more lead heterologous gene effectors of the library that effect the change. [6] Disclosed herein is a method, comprising: (a) contacting a population of cells with a library of complexes, wherein an individual complex of the library comprises: (i) a heterologous gene effector that is different from heterologous gene effectors in other complexes of the library; and (ii) a guide nucleic acid sequence that exhibits 100% sequence identity to guide nucleic acid sequences in the other complexes of the library, wherein the heterologous gene effector and the guide nucleic acid sequence form the individual complex that exhibits specific binding to a target endogenous gene in the population of cells, and wherein the heterologous gene effector comprises a viral gene effector; (b) upon the contacting, sorting the population of cells based on a change in expression or activity level of the target endogenous gene in the population of cells; and (c) identifying one or more lead heterologous gene effectors of the library that effect the change. [7] The viral gene effector may be derived from a human virus selected from the group consisting of Adenoviridae, Arenaviridae, Bornaviridae, Coronaviridae, Filoviridae, Flaviviridae, Hepadnaviridae, Herpesviridae, Orthomyxoviridae, Papillomaviridae, Paramyxoviridae, Parvoviridae, Peribunyaviridae, Phenuiviridae, Pneumoviridae, Polyomaviridae, Poxviridae, Retroviridae, and Rhabdoviridae. In some embodiments, the viral gene effector is derived from a human-bat shared virus selected from the group consisting of Flaviviridae, Lyssaviridae, Filoviridae, Paramyxoviridae, Orthomyxoviridae, Coronaviridae, Reoviridae, Togaviridae, Phenuviridae, and Hantaviridae. In some embodiments, the viral gene effector is derived from a virus selected from the group consisting of Archaea-tropic virus, Siphoviridae, podoviridae, Mimiviridae, Nimaviridae, Ligamenvirales, Globuloviridae, Fuselloviridae, Bicaudaviridae, Satellite virus, Iridoviridae, Turriviridae, Caudovirales, Phycodnaviridae and Myoviridae. In some disclosures, the library comprises at least 30, 50, 100, 200, 500, 1,000, 2,000, 5,000, or 10,000 different complexes. In some disclosures, the guide nucleic acid sequence comprises between about 10 and about 30 nucleotides, between about 15 and about 25 nucleotides, or about 15 nucleotides. In some embodiments, the individual complex further comprises a heterologous endonuclease. In some embodiments, the heterologous endonuclease of the individual complex exhibits 100% sequence identity to heterologous endonucleases of the other complexes. In some embodiments, the heterologous gene effector and the heterologous endonuclease are fused to each other. In some embodiments, the heterologous gene effector and the heterologous endonuclease are non-covalently coupled to each other. In some embodiments, the heterologous endonuclease is a Cas protein. In some embodiments, the Cas protein lacks nucleic acid cleavage activity. In some embodiments, the guide nucleic acid sequence is a part of a guide RNA molecule. In some embodiments, the heterologous gene effector comprises a heterologous transcriptional regulator. In some embodiments, the heterologous gene effector comprises a heterologous chromatin regulator. In some embodiments, the change is enhanced expression or activity level of the target endogenous gene. In some embodiments, the change is reduced expression or activity level of the target endogenous gene. In some embodiments, the heterologous gene effector exhibits at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or 100% sequence identity to any one of SEQ ID NOs: 1616154 or any one of SEQ ID NOs: 16-13605. In some embodiments, the heterologous gene effector exhibits at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or 100% sequence identity to any one of SEQ ID NOs: 16155-47350 or any one of SEQ ID NOs: 16155-43953. In some embodiments, the heterologous gene effector comprises a plurality of different heterologous gene effectors, wherein a combination of the plurality of different heterologous gene effectors of the individual complex is different from combinations of heterologous gene effectors within other complexes of the library. In some embodiments, the plurality of different heterologous gene effectors is not P300, TET1, TET2, TET3, and / or HSF1. In some embodiments, at least one of the plurality of different heterologous gene effectors is not VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A-TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta). In some embodiments, at least one of the plurality of different heterologous gene effectors is not KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A. In some embodiments, the heterologous gene effector is not P300, TET1, TET2, TET3, and / or HSF1. In some embodiments, the heterologous gene effector is not VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, -3- R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta). In some embodiments, the heterologous gene effector is not KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A. In some embodiments, the one or more lead heterologous gene effectors is at most 1 heterologous gene effector, at most 2 heterologous gene effectors, at most 5 heterologous gene effectors, at most 10 heterologous gene effectors, at most 15 heterologous gene effectors, at most 20 heterologous gene effectors, or at most 50 heterologous gene effectors. In some embodiments, a degree of the change in the expression or the activity level of the target endogenous gene effected by the one or more lead heterologous gene effectors is greater than that by a control by at least 2-fold. In some embodiments, the degree is greater than that by the control by at least 5-fold, 10-fold, 20-fold, 50-fold, or 100-fold. In some embodiments, the control is a population of cells without the library of complexes. In some embodiments, the control is a population of cells contacted by a control heterologous gene effector. In some embodiments, the control heterologous gene effector is P300, TET1, TET2, TET3, and / or HSF1. In some embodiments, the control heterologous gene effector is VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta). In some embodiments, the control heterologous gene effector is KRAB, SID, ERD, cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A. In some embodiments, the method further comprises performing (a)-(c) for an additional target endogenous gene in an additional population of cells, wherein (1) the one or more lead heterologous gene effectors of the library that effects the change in expression or activity level of the target endogenous gene is different from (2) one or more lead heterologous gene effectors of the library that effects a change in expression or activity level of the additional target endogenous gene. In some embodiments, the population of cells and the additional population of cells are of the same cell types. In some embodiments, the population of cells and the additional population of cells are of different cell -4- types. In some embodiments, the population of cells comprises mammalian cells. In some embodiments, the population of cells comprises human cells. In some embodiments, the population of cells comprises stem cells. In some embodiments, the population of cells comprises differentiated cells. In some embodiments, the target endogenous gene is a disease-associated gene. In some embodiments, the target endogenous gene is a differentiation-associated gene. In some embodiments, the target endogenous gene is an age-related gene. [8] Disclosed herein, , is a system comprising the library of complexes of the method of any one of preceding disclosures. [9] Disclosed herein, , is a kit comprising the library of complexes of the method of any one of preceding disclosures.

[10] Disclosed herein, is a nucleic acid library encoding the heterologous gene effectors of the library of complexes of the method of any one of preceding disclosures.

[11] Disclosed herein, is a nucleic acid library encoding the library of complexes of the method of any one of preceding disclosures.

[12] Disclosed herein, is a population of cells collectively expressing the heterologous gene effectors of the library of complexes of the method of any one of preceding disclosures.

[13] Disclosed herein, is a population of cells collectively expressing the library of complexes of the method of any one of preceding disclosures.

[14] Disclosed herein, is a complex comprising a guide moiety and a heterologous gene effector, wherein the heterologous gene effector comprises an amino acid sequence with at least about 70% sequence identity to any one of SEQ ID NOs: 23631, 1102, 2057, 5543, 9066, 11948, 15646, 17629, 19860, 21015, 21166, 22149, 22707, 23639, 25430, 25555, 32678, 33890, 34047, 35737, 38138, 38780, 40913, 40985, 40986, and 42623.

[15] In some disclosures, the amino acid sequence has at least 90% sequence identity to any one of SEQ ID NOs: 23631, 1102, 2057, 5543, 9066, 11948, 15646, 17629, 19860, 21015, 21166, 22149, 22707, 23639, 25430, 25555, 32678, 33890, 34047, 35737, 38138, 38780, 40913, 40985, 40986, and 42623. In some disclosures, the heterologous gene effector comprises the amino acid sequence of any one of SEQ ID NOs: 23631, 1102, 2057, 5543, 9066, 11948, 15646, 17629, 19860, 21015, 21166, 22149, 22707, 23639, 25430, 25555, 32678, 33890, 34047, 35737, 38138, 38780, 40913, 40985, 40986, and 42623. In all embodiments, the amino acid sequence has at least 90% sequence identity to SEQ ID NO: 23631. In some embodiments, the heterologous gene effector comprises the amino acid sequence of SEQ ID NO: 23631. In some disclosures, the amino acid sequence has at least 90% sequence identity to SEQ ID NO: 33890. In some disclosures, the heterologous gene effector comprises the amino acid sequence of SEQ ID NO: 33890. In some disclosures, the amino acid sequence has at least 90% sequence identity -5- to SEQ ID NO: 40985. In some disclosures, the heterologous gene effector comprises the amino acid sequence of SEQ ID NO: 40985. In some embodiments, the heterologous gene effector contains less than 500 amino acids. In some embodiments, the heterologous gene effector contains less than 100 amino acids. In some embodiments, the guide moiety specifically binds to a target gene or a target gene regulatory sequence. In some embodiments, the guide moiety comprises a guide nucleic acid sequence. In some disclosures, the guide nucleic acid sequence comprises or consists of between about 10 and about 30 nucleotides. In some embodiments, the guide nucleic acid sequence is a guide RNA. In some embodiments, the guide nucleic acid sequence is a single guide RNA (sgRNA). In some embodiments, the guide moiety comprises a nuclease or a part thereof. In some embodiments, the nuclease or part thereof is a modified nuclease that has reduced nuclease activity compared to a wild-type version of the nuclease. In some embodiments, the nuclease or part thereof substantially lacks nucleic acid cleavage activity. In some embodiments, the nuclease or part thereof is a Cas protein or part thereof. In some embodiments, the nuclease or part thereof is a nuclease deactivated Cas (dCas) protein or part thereof. In some embodiments, the guide moiety and the heterologous gene effector are fused to each other, optionally via a linker. In some embodiments, the guide moiety and the heterologous gene effector are non-covalently coupled to each other.

[16] Disclosed herein, in some aspects, is a vector comprising the heterologous gene effector of any one of the preceding embodiments. In some embodiments, the vector further comprises the guide moiety.

[17] Disclosed herein, in some aspects, is a vector comprising the complex of any one of the preceding embodiments.

[18] Disclosed herein, in some aspects, is a vector comprising a nucleic acid that encodes the heterologous gene effector of any one of the preceding embodiments.

[19] In some embodiments, the vector further comprises a nucleic acid that encodes the guide moiety or a component thereof. In some embodiments, the vector is a viral vector. In some embodiments, the vector is a non-viral vector.

[20] Disclosed herein, in some aspects, is a population of cells comprising the complex of any one of the preceding embodiments.

[21] Disclosed herein, in some aspects, is a method of modulating expression or activity of a target gene, the method comprising contacting a population of cells that comprise the target gene with the complex or the vector of any one of the preceding embodiments.

[22] In some embodiments, the population of cells comprises mammalian cells. In some embodiments, the population of cells comprises human cells. In some embodiments, the population of cells comprises stem cells. In some embodiments, the population of cells -6- comprises differentiated cells. In some embodiments, the contacting is in vitro or ex vivo. In some embodiments, the contacting is in vivo.

[23] Disclosed herein, in some aspects, is a method of treating a subject in need thereof, the method comprising administering to the subject the complex or vector of any one of the preceding embodiments, thereby modulating expression or activity of a target gene in a population of cells in the subject.

[24] In some embodiments, the target gene is a target endogenous gene. In some embodiments, the target gene is a disease-associated gene. In some embodiments, the target gene is a differentiation-associated gene. In some embodiments, the modulating expression or activity comprises increasing expression or activity level of the target gene. In some disclosures, the modulating expression or activity comprises reducing expression or activity level of the target gene. In some embodiments, expression or activity of the target gene is increased at least 2-fold compared to a control. In some disclosures, expression or activity of the target gene is reduced at least 2-fold compared to a control. In some embodiments, the expression or activity of the target gene is modulated for a period of time that is at least 10% longer than a control. In some embodiments, the expression or activity of the target gene is modulated for at least 12 hours. In some embodiments, the expression or activity of the target gene is modulated for at least 28 days. In some embodiments, the control is the population of cells prior to the contacting. In some embodiments, the control is a population of cells not contacted with the complex. In some embodiments, the control is a population of cells contacted with a control complex.

[25] Disclosed herein, in some aspects, is an expression vector comprising: a plurality of heterologous polynucleotide sequences, wherein each heterologous polynucleotide sequence of the plurality of heterologous polynucleotide sequences exhibits at least about 80% sequence identity to the polynucleotide sequence of any one or more of SEQ ID NOs: 50033-50049.

[26] In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50033. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50034. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50035. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50036. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50037. In some embodiments of any one of the expression vectors disclosed herein, each -7- heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50038. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50039. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50040. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50041. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50042. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50043. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50044. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50045. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50046. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50047. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50048. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50049.

[27] In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 90% sequence identity to the polynucleotide sequence of any one of SEQ ID NOs: 50033-50049. In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence exhibits at least about 95% sequence identity to the polynucleotide sequence of any one of SEQ ID NOs: 50033-50049.

[28] In some embodiments of any one of the expression vectors disclosed herein, each heterologous polynucleotide sequence comprises (i) a CRISPR target sequence and (ii) one or more CRISPR protospacer adjacent motif (PAM) sequences. In some embodiments of any one of the expression vectors disclosed herein, the CRISPR target sequence is flanked by two different CRISPR PAM sequences. In some embodiments of any one of the expression vectors -8- disclosed herein, the one or more CRISPR PAM sequences comprises a Cas12 PAM sequence. In some embodiments of any one of the expression vectors disclosed herein, the one or more CRISPR PAM sequences comprises a Cas9 PAM sequence.

[29] In some embodiments of any one of the expression vectors disclosed herein, the plurality comprises 4 or more heterologous polynucleotide sequences. In some embodiments of any one of the expression vectors disclosed herein, the plurality comprises 6 or more heterologous polynucleotide sequences.

[30] In another aspect, the present disclosure provides a nucleic acid molecule comprising: a heterologous polynucleotide sequence that is a chimeric sequence comprising (i) a CRISPR target sequence and (ii) a CRISPR protospacer adjacent motif (PAM) sequence and an additional CRISPR PAM sequence that are different, wherein the CRISPR target sequence is flanked by the CRISPR PAM sequence and the additional CRISPR PAM sequence.

[31] In some embodiments of any one of the nucleic acid molecules disclosed herein, the heterologous polynucleotide sequence is a single strand.

[32] In some embodiments of any one of the nucleic acid molecules disclosed herein, a distance between the CRISPR PAM sequence and the additional CRISPR PAM sequence is at most about 50 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 40 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 35 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 25 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 20 nucleobases.

[33] In some embodiments of any one of the nucleic acid molecule disclosed herein, a size of the CRISPR target sequence is at least about 10 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the size is at least about 15 nucleobases.

[34] In some embodiments of any one of the nucleic acid molecules disclosed herein, the CRISPR PAM sequence and the additional CRISPR PAM sequence are recognized by different CRISPR types. In some embodiments of any one of the nucleic acid molecules disclosed herein, one of the CRISPR PAM sequence and the additional CRISPR PAM sequence is recognized by Cas12 or a variant thereof. In some embodiments of any one of the nucleic acid molecules disclosed herein, one of the CRISPR PAM sequence and the additional CRISPR PAM sequence is recognized by Cas9 or a variant thereof.

[35] In some embodiments of any one of the nucleic acid molecule disclosed herein, the heterologous polynucleotide sequence is a non-coding sequence.

[36] In some embodiments of any one of the nucleic acid molecules disclosed herein, the CRISPR target sequence exhibits at least about 80% sequence identity to SEQ ID NO: 50033.

[37] In another aspect, the present disclosure provides a nucleic acid molecule comprising: a plurality of heterologous polynucleotide sequences, wherein: (i) each heterologous polynucleotide sequence of the plurality of heterologous polynucleotide sequences comprises a polynucleotide sequence and an additional polynucleotide sequence that are derived from different human chromosomes; and (ii) a size of each heterologous polynucleotide sequence is at most about 50 nucleobases.

[38] In some embodiments of any one of the nucleic acid molecules disclosed herein, the size is at most about 40 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the size is at most about 30 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the size is at most about 25 nucleobases.

[39] In some embodiments of any one of the nucleic acid molecules disclosed herein, a size of the polynucleotide sequence is at least about 5 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, a size of the additional polynucleotide sequence is at least about 5 nucleobases.

[40] In some embodiments of any one of the nucleic acid molecules disclosed herein, a distance between a heterologous polynucleotide sequence and an additional heterologous polynucleotide sequence of the plurality is at most about 100 nucleobases.

[41] In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 80 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 60 nucleobases. In some embodiments of any one of the nucleic acid molecules disclosed herein, the distance is at most about 50 nucleobases.

[42] In some embodiments of any one of the nucleic acid molecules disclosed herein, each of the heterologous polynucleotide sequences is a non-coding sequence.

[43] In some embodiments of any one of the nucleic acid molecules disclosed herein, at least one of the polynucleotide sequence and the additional polynucleotide sequence is derived from a Cluster of Differentiation (CD) protein.

[44] In some embodiments of any one of the nucleic acid molecules disclosed herein, the plurality comprises 4 or more heterologous polynucleotide sequences. In some embodiments of any one of the nucleic acid molecules disclosed herein, the plurality comprises 6 or more heterologous polynucleotide sequences.

[45] In another aspect, the present disclosure provides an expression vector comprising any one of the nucleic acid sequences disclosed herein. -10-

[46] In some embodiments of any one of the expression vectors or the nucleic acid molecules disclosed herein, the expression vector or the nucleic acid molecule further comprises an Upstream Activating Sequence (UAS) that is downstream of the heterologous polynucleotide sequence or the heterologous polynucleotide sequences. In some embodiments of any one of the expression vectors or the nucleic acid molecules disclosed herein, the UAS is a non-human UAS. In some embodiments of any one of the expression vector or the nucleic acid molecule disclosed herein, the UAS is derived from yeast GAL4 promoter.

[47] In some embodiments of any one of the expression vectors or the nucleic acid molecules disclosed herein, the expression vector or the nucleic acid molecule further comprises a promoter.

[48] In some embodiments of any one of the expression vectors or the nucleic acid molecules disclosed herein, at least one of the plurality of heterologous polynucleotide sequences is upstream of the promoter. In some embodiments of any one of the expression vectors or the nucleic acid molecules disclosed herein, the promoter is a strong constitutive human promoter. In some embodiments of any one of the nucleic acid molecules disclosed herein, the promoter is a weak minimal viral promoter. In some embodiments of any one of the nucleic acid molecules disclosed herein, the expression vector or the nucleic acid molecule further comprises a target gene under the control of the promoter.

[49] In another aspect, the present disclosure provides a cell comprising any one of the expression vectors or the nucleic acid sequences as disclosed herein. In some embodiments, the cell can be a mammalian cell.

[50] In another aspect, the present disclosure provides a method of regulating expression of a target gene in a cell, the method comprising: (a) providing a vector comprising (i) any one of the nucleic acid sequences as disclosed herein, (ii) a promoter, and (ii) the target gene; and contacting the nucleic acid sequence with an actuator moiety capable of interacting with the promoter to modulate expression level of the target gene.

[51] In some embodiments of any one of the methods disclosed herein, the actuator moiety is a complex comprising a CRISPR endonuclease and a gene effector. In some embodiments of any one of the methods disclosed herein, the gene effector is a gene activator. In some embodiments of any one of the methods disclosed herein, the gene effector is a gene repressor. In some embodiments of any one of the methods disclosed herein, the complex further comprises a guide nucleic acid molecule exhibiting specific binding to the heterologous polynucleotide sequence or the heterologous polynucleotide sequence. BRIEF DESCRIPTION OF THE DRAWINGS

[52] The novel features of the disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:

[53] FIG. 1 provides an overview of an illustrative effector screen design to identify human nuclear proteins that activate expression of CD45 or reduce expression of CD71.

[54] FIG. 2 illustrates a starting vector backbone that can be used for generating a vector of the disclosure.

[55] FIG. 3 illustrates a vector of the disclosure that encodes a dCas9 fused to a heterologous effector, with an IRES driving expression of a downstream reporter gene.

[56] FIG. 4 shows relative baseline expression of CD45 in illustrative cell lines.

[57] FIG. 5 shows relative baseline expression of CD71 in illustrative cell lines.

[58] FIG. 6 shows modulation of CD45 and CD71 by complexes of the disclosure, and cell sorting based on the resulting expression profiles of CD45 and CD71. Increased expression of CD45 can be observed in experimental conditions in the activator screen (top right panel), and reduced expression of CD71 can be observed in experimental conditions in the repressor screen (bottom right panel).

[59] FIG. 7 provides an illustrative schematic of an expression construct for a combinatorial screen of the disclosure.

[60] FIG. 8 provides an illustrative schematic of an expression construct for the generation of cell lines stably expressing GAI-dCas9-ABI. This reagent can be used in a combinatorial screen of the disclosure.

[61] FIG. 9 illustrates modulation of CD45 and CD71 expression by complexes of the disclosure that comprise combinations of a transcriptional regulator and a chromatin regulator associated with dCas9. The top images show an illustrative activator screen for CD45, and the bottom images show an illustrative repressor screen for CD71. The graphs on the right illustrate an increase in CD45 expression by a complex of the disclosure, and repression of CD71 expression by a complex of the disclosure.

[62] FIG. 10 schematically shows an example structure of an expression vector for an engineered synthetic reporter (ESR). FIG. 10 discloses SEQ ID NO: 50039 (full sequence shown), which includes SEQ ID NO: 50033 (“synthetic guide target”) SEQ ID NO: 50040 (“UAS”), SEQ ID NO: 50034 (Cas12a / MINI PAM + synthetic guide target), SEQ ID NO: 50035 (synthetic guide target + SpCas9 PAM), SEQ ID NO: 50036 (synthetic guide target+ SpCas9 PAM and SaCas9 PAM), SEQ ID NO: 50037 (Cas12a / mini PAM + synthetic guide target + SpCas9 PAM and SaCas9 PAM), and SEQ ID NO: 50038 (Cas12a / mini PAM + synthetic guide target + SpCas9 PAM).

[63] FIG. 11 schematically shows an example sequence of the ESR. FIG. 11 discloses SEQ ID NO: 50041 (single ESR repeat, which includes a Cas12a / mini PAM (TTTA), heterologous guide target (SEQ ID NO: 50033), Cas9 PAM (CGG), and UAS (SEQ ID NO: 50040)); SEQ ID NO: 50042 (7x copies of the ESR repeat); SEQ ID NO: 50043 (miniCMV promoter); and SEQ ID NO: 50044 (EF1a promoter).

[64] FIG. 12 schematically shows an example sequence of a control reporter vector. FIG. 12 discloses SEQ ID NO: 50045 (single TRE3G_repeat, which includes a Cas12a / mini PAM (TTTA), a Cas9 PAM (CCC), a Cas9 spacer (SEQ ID NO: 50046), and a CasMINI / Cas12a spacer (SEQ ID NO: 50047)); and a full TRE3GS_promoter (SEQ ID NO: 50048, which includes 7 copies of the TRE3G repeat and a modified miniCMV promoter (SEQ ID NO: 50049)).

[65] FIG. 13 shows flow cytometry data analysis of a reporter 293T cell line engineered with the ESR encoding miniCMV-GFP (ESR121).

[66] FIG. 14 shows flow cytometry data analysis of a reporter 293T cell line engineered with the ESR encoding EF1a-GFP (ESR221).

[67] FIG. 15 shows flow cytometry data analysis of a reporter K562 cell line engineered with the ESR encoding miniCMV-GFP (ESR111).

[68] FIG. 16 shows flow cytometry data analysis of a reporter K562 cell line engineered with the ESR encoding EF1a-GFP (ESR211).

[69] FIG. 17 shows a different flow cytometry data analysis of a reporter 293T cell line engineered with the ESR encoding miniCMV-GFP (ESR121).

[70] FIG. 18 shows a different flow cytometry data analysis of a reporter 293T cell line engineered with the ESR encoding EF1a-GFP (ESR221).

[71] FIG. 19 shows flow cytometry data analysis of a reporter 293T cell lines engineered with the ESR encoding green fluorescent protein (GFP) (clone 1), an additional reporter 293T cell lines engineered with the ESR encoding GFP (clone 2), a control reporter 293T cell line expressing a control expression vector encoding GFP (TRE3G-GFP), and an additional control reporter 293T cell line expressing a control expression vector encoding GFP (SV40-GFP), wherein ESR-EF1a 293T clonal cell lines show a narrower distribution of GFP expression than existing reporter cells.

[72] FIG. 20 provides an overview of an illustrative screen design to identify heterologous gene effectors that activate or reduce expression of target genes (e.g., CD45, CD71), or a GFP reporter gene.

[73] FIG. 21A provides representative flow cytometry histograms showing high dynamic range of ESR-GFP transcriptional activation or suppression from positive control constructs VPR or KRAB, respectively.

[74] FIG. 21B provides representative histograms showing transcriptional activation or repression of two endogenous human gene targets: lowly-expressed CD45 for activation or highly-expressed CD71 for suppression.

[75] FIG. 22A is a volcano plot showing hits in a screen for candidate activator heterologous gene effectors using an enhanced synthetic reporter system.

[76] FIG. 22B is a volcano plot showing hits in a screen for candidate repressor heterologous gene effectors using an enhanced synthetic reporter system.

[77] FIG. 23A is a volcano plot showing hits in a screen for candidate activator heterologous gene effectors using an endogenous gene (CD45) in wild type K562 cells.

[78] FIG. 23B is a volcano plot showing hits in a screen for candidate repressor heterologous gene effectors using an endogenous gene (CD71) in wild type K562 cells.

[79] FIG. 24A shows the geometric mean of CXCR4 expression 3 and 7 days after transfection with plasmids encoding complexes that comprise heterologous gene effectors disclosed herein targeted to CXCR4 by a sgRNA.

[80] FIG. 24B provides representative flow cytometry histograms of CXCR4-APC fluorescence at 3 d.p.t., showing relative performance of one novel activator (EPICXV.1) versus canonical activator (VPR), and one novel suppressor (EPICXV.71) versus canonical suppressor (KRAB). Modulators shown are fused to dCasMini.

[81] FIG. 24C illustrates relative sizes (bp) of sequences encoding dCas9, dCasMini, canonical activator VPR, and fusions thereof, as compared to the novel candidate effectors disclosed herein (EPICXV).

[82] FIG. 25A shows IFNg secretion as determined by ELISA 3 days after treatment of wildtype HEK293T cells with dCasMini-effector fusions and sgRNA targeting human IFNG.

[83] FIG. 25B shows CD45 surface expression as determined by flow cytometry 2 days after treatment of wildtype HEK293T cells with dCasMini-effector fusions and sgRNA targeting CD45.

[84] FIG. 25C shows CD2 surface expression as determined by flow cytometry 3 days after treatment of wildtype HEK293T cells with dCasMini-effector fusions and sgRNA targeting CD2.

[85] FIG. 25D shows CD2 surface expression as determined by flow cytometry 5 days after treatment of wildtype HEK293T cells with dCasMini-effector fusions and sgRNA targeting CD2.

[86] FIG. 26A shows GFP reporter expression of HEK293T cells bearing a stably integrated TRE3G promoter-driven GFP 2 days after treatment with dCasMini-effector fusions and sgRNA targeting the reporter, as determined by flow cytometry.

[87] FIG. 26B shows GFP reporter expression of HEK293T cells bearing a stably integrated GFP synthetic reporter driven by low-expression miniCMV promoter 2 days after treatment with dCasMini-effector fusions and sgRNA targeting the reporter, as determined by flow cytometry.

[88] FIG. 27A shows GFP reporter expression of HEK293T cells bearing a stably integrated GFP synthetic reporter driven by high-expression EFla promoter 5 days after treatment with dCasMini-effector fusions and sgRNA targeting the reporter, as determined by flow cytometry.

[89] FIG. 27B shows GFP reporter expression of HEK293T cells bearing a stably integrated GFP synthetic reporter driven by high-expression EF1a promoter 5 days after treatment with dCas9-effector fusions and sgRNA targeting the reporter, as determined by flow cytometry.

[90] FIG. 28A summarizes the effect of heterologous gene effectors on expression of the endogenous gene CXCR4 3, 7, 15, and 28 days after transfection with dCasMini-effector fusions and sgRNA targeting CXCR4, as determined by flow cytometry.

[91] FIG. 28B shows normalized CXCR4 expression values 3, 7, 15, and 28 days after transfection of HEK293T cells with plasmids encoding complexes that comprise heterologous gene effectors disclosed herein or controls targeted to CXCR4 by a sgRNA. Effectors are ranked by effect size at each time point.

[92] FIG. 29A shows the effect of candidate heterologous gene effectors disclosed herein compared to control effectors (dashed lines) on gene expression over time. The effectors shown are fused to dCasMini.

[93] FIG. 29B provides representative flow cytometry histograms for positive control dCas9-KAL, a construct for persistent repression comprising KRAB, DNMT3A, and DNMT3L domains fused to dCas9, showing increased repression of target gene expression over progressive time points.

[94] FIG. 29C provides representative flow cytometry histograms comparing effectors fused to dCasMini. Negative control (dCasMini without modulator) and positive control repressors are shown as compared to a novel suppressor (EPICXV.67).

[95] FIG. 29D shows measurements demonstrating expression of dCasMini-effector over time (as reflected by an mCherry reporter) following plasmid transfection in ESR-GFP HEK293T cells.

[96] FIG. 29E provides bar charts comparing relative sizes (bp) of a positive control fusion (KAL) and its constituent components, as compared to the novel compact modulators presently screened (prefixed EPICXV).

[97] FIG. 29F provides bar charts comparing relative sizes (bp) of a dCas9-KAL control for persistent suppression of gene expression, relative to the present dCasMini-EPICXV constructs tested herein.

[98] FIG. 29G shows normalized reporter GFP fluorescence values for each experimental replicate of positive controls and selected candidate heterologous gene effectors (EPICXVs) at 77 d.p.t. for ESR-GFP cells.

[99] FIG. 30 shows a correlation of normalized GFP fluorescence in ESR-GFP synthetic reporter cells (averaged across all time points from 3 to 77 d.p.t.; y-axis) and normalized CXCR4-APC fluorescence (averaged across all time points from 3 to 28 d.p.t.; x-axis). DETAILED DESCRIPTION

[100] Gene expression underpins various physiological and pathological effects in cells and tissues, contributing to many diseases and conditions, thus agents that modulate expression of specific genes in a desirable way could have therapeutic benefit.

[101] Developing agents that elicit, robust, persistent, and / or reversible changes in gene expression has proven challenging, however, as many candidate therapeutics achieve only modest or short lived effects, or conversely result in off-target effects. Additionally, many current approaches to gene editing and genome engineering can result in off-target effects that can be associated with undesirable toxicity profiles, and in some cases, undesirable effects can be permanent. There is thus a need for novel strategies to regulate gene expression that allow robust, persistent, and / or reversible modulation of target gene expression and activity, for example, expression of genes that impact human disease.

[102] Molecular tools that act in an epigenetic fashion have the potential to elicit efficient, durable, and low-risk therapeutic modulation of gene expression. The disclosure provides compositions and methods for identifying novel effector domains capable of efficient, effective, and persistent epigenetic modification of target gene expression. For example, provided are heterologous gene effector domains and complexes of the effector domains with guide moieties to modulate (e.g., upregulate or downregulate) expression or activity of particular target gene(s) (e.g., target endogenous gene(s)).

[103] Combinations of heterologous gene effectors also have the potential to achieve advantageous outcomes in regulating gene expression, for example, via synergistic effects. The disclosure provides compositions and methods comprising novel combinations of heterologous gene effectors, for example, combinations of effector domains that are chromatic regulators and / or transcriptional regulators from the human nuclear proteome, viral sources, and / or other types of heterologous gene effectors disclosed herein.

[104] Context-dependent effects present an additional challenge for therapeutic modulation of gene expression and activity. For example, a strategy or transcriptional modulator that achieves a desirable effect on expression of a particular target gene (e.g., a particular target endogenous gene), cell type, subject, etc. may not achieve the desired effect for a different target gene (e.g., a different target endogenous gene), cell type, or subject. In some cases, systems and methods of the disclosure are customized to or are applicable to or are particularly suited to a specific target gene (e.g., a specific target endogenous gene), a specific cell type, a specific target disease, a specific subject, etc.

[105] The disclosure provides compositions and methods for high throughput screens to identify heterologous gene effector domains and complexes of the effector domains with guide moieties to modulate expression of particular target gene(s) (e.g., particular target endogenous gene(s)). In some embodiments, the disclosure provides complexes identified by systems disclosed herein that can be employed for other purposes, such as research or as therapeutics. HETEROLOGOUS GENE EFFECTORS

[106] The disclosure provides compositions, systems, methods and methods (for example, complexes and libraries) that utilize heterologous gene effectors (e.g., gene effectors that are heterologous to a cell comprising the gene effectors and / or another component in a complex of the disclosure). Heterologous gene effectors comprise domains that are capable of, or are candidates for, modulating expression of a target gene (e.g., a target endogenous gene), for example, activating, repressing, upregulating, downregulating, or stabilizing an expression level or activity level of the gene. Heterologous gene effectors can be heterologous with respect to another component that is present in a complex, for example, a guide moiety (e.g., nuclease and / or guide nucleic acid, as disclosed herein). In some cases, heterologous gene effectors can be heterologous with respect to a host cell they are introduced to.

[107] A heterologous gene effector can be or can comprise a sequence from any suitable source, for example, an amino acid sequence from a human protein, viral protein, or other protein as disclosed herein. A heterologous gene effector can be or can comprise a sequence from a protein that primarily localized to the nucleus, for example, a member of the human nuclear proteome. A heterologous gene effector can be or can comprise one or more natural amino acid residues. A heterologous gene effector can be or can comprise one or more synthetic amino acid residues.

[108] A heterologous gene effector can be or can comprise a sequence from a mammalian protein. A heterologous gene effector can be or can comprise a sequence from a human protein. A heterologous gene effector can be or can comprise a sequence from a viral protein. A heterologous gene effector can be or can comprise a sequence from a non-human primate protein. A heterologous gene effector can be or can comprise a sequence from a non-human mammal protein. A heterologous gene effector can be or can comprise a sequence from a nonrodent mammal protein. A heterologous gene effector can be or can comprise a sequence from a plant protein. A heterologous gene effector can be or can comprise a sequence from a pig protein. A heterologous gene effector can be or can comprise a sequence from a lagomorph protein. A heterologous gene effector can be or can comprise a sequence from a canine protein. A heterologous gene effector can be or can comprise a sequence from an avian protein. A heterologous gene effector can be or can comprise a sequence from a reptilian protein. A heterologous gene effector can be or can comprise a sequence from a bacterial protein. A heterologous gene effector can be or can comprise a sequence from an archaeal protein.

[109] A heterologous gene effector can be or can comprise a sequence from a chromatin regulator (CR). Chromatin regulators include functional domains from various classes of histone and DNA modifying enzymes (e.g., DNMTs, HATs, HMTs, etc.).

[110] A heterologous gene effector can comprise two or more domains from chromatin regulators, e.g., located at a C-terminus, an N-terminus, or within a polypeptide sequence, in tandem or separate.

[111] In some disclosures, a heterologous gene effector is one that facilitates heterochromatin formation. Non-limiting examples of proteins that can facilitate heterochromatin formation include HP1a, HP10, KAP1, KRAB, SUV39H1, and G9a.

[112] In some disclosures, a heterologous gene effector modulates histones through methylation. In some disclosures, a heterologous gene effector modulates histones through acetylation. In some disclosures, a heterologous gene effector modulates histones through phosphorylation. In some disclosures, a heterologous gene effector modulates histones through ADP-ribosylation. In some disclosures, a heterologous gene effector modulates histones through glycosylation. In some disclosures, a heterologous gene effector modulates histones through SUMOylation. In some disclosures, a heterologous gene effector modulates histones through ubiquitination. In some disclosures, a heterologous gene effector modulates histones by remodeling histone structure, e.g., via an ATP hydrolysis-dependent process.

[113] In some disclosures, a heterologous gene effector facilitates spatial positioning of proteins on or near the target polynucleotide, e.g., transcriptional repressors, transcription factors, histones, etc. In some disclosures, a heterologous gene effector is useful for manipulating -18- the spatiotemporal organization of genomic DNA and RNA components in the nucleus and / or cytoplasm, e.g., for regulating diverse cellular functions.

[114] In some disclosures, a heterologous gene effector is from a family of related histone acetyltransferases. Non-limiting examples of histone acetyltransferases include GNAT subfamily, MYST subfamily, p300 / CBP subfamily, HAT1 subfamily, GCN5, PCAF, Tip60, MOZ, MORF, MOF, HBO1, p300, CBP, HAT1, ATF-2, SRC1, and TAFII250.

[115] In some disclosures, a heterologous gene effector is from a histone lysine methyltransferase. Non-limiting examples of histone lysine methyltransferases include EZH subfamily, Non-SET subfamily, Other SET subfamily, PRDM subfamily, SET1 subfamily, SET2 subfamily, SUV39 subfamily, SYMD subfamily, ASH1L, EHMT1, EHMT2, EZH1, EZH2, MLL, MLL2, MLL3, MLL4, MLL5, NSD1, NSD2, NSD3, PRDM1, PRDM10, PRDM11, PRDM12, PRDM13, PRDM14, PRDM15, PRDM16, PRDM2, PRDM4, PRDM5, PRDM6, PRDM7, PRDM8, PRDM9, SET1, SET1L, SET2L, SETD2, SETD3, SETD4, SETD5, SETD6, SETD7, SETD8, SETDB1, SETDB2, SETMAR, SUV39H1, SUV39H2, SUV420H1, SUV420H2, SYMD1, SYMD2, SYMD3, SYMD4, and SYMD5.

[116] In some disclosures, a heterologous gene effector is from a component of a chromatin remodeling complex. In some disclosures, a heterologous gene effector is a component of BAF, for example, Actin, ARIDA / B, BAF155, BAF170, BAF45 A / B / C / D, BAF53 A / B, BAF57, BAF60 A / B / C, BRG1 / BRM, INI1, or SS18.

[117] In some disclosures, a heterologous gene effector is from a component of PBAF, for example, Actin, ARID2, BAF155, BAF170, BAF180, BAF45 A / B / C / D, BAF53 A / B, BAF57, BAF60 A / B / C, BRD7, BRG1, or INI1.

[118] In some disclosures, a heterologous gene effector is from a component of an ISWI family chromatin remodeling complex, for example, ACF subfamily, RSF subfamily, CERF subfamily, CHRAC subfamily, NURF subfamily, NoRC subfamily, WICH subfamily, b-WICH subfamily, ACF1, ATPase, BPTF, CECR2, CHRAC15, CHRAC17, CSB, DEK, MYBBP1A, NM1, RBAP46 / 48, RHII / Gua, RSF1, SAP155, SNF2H, SNF2H / L, SNF2L, TIP5, or WSTF.

[119] In some disclosures, a heterologous gene effector is from a component of a CHD family complex, for example, a NuRD complex, NuRD-like complex, or CHD complex. In some disclosures, a heterologous gene effector is from CHD1 / 2 / 6 / 7 / 8 / 9, CHD3 / 4, CHD5, GATAD2 A / B, GATAD2 B, HDAC1, HDAC2, HDAC2, MBD2 / 3, MTA1 / 2 / 3, MTA3, or RBAP46, RBAP46 / 48.

[120] In some disclosures, a heterologous gene effector is from a component of an INO80 family complex, for example, from an INO80 complex, Tip60 / p400 complex, SRCAP complex, AMIDA, ARP6, BAF53, BAF53, BAF53A, BRD8, DMAP1, DMAP1, EPC1 / 2, FLJ11730, -19- GAS41, GAS41, IES2, IES6, ING3, INO80, INO80E, MCRS1, MRG15, MRGBP, MRGX, NFRKB, p400, RUVBL1 / 2, RUVBL1 / 2, RUVBL1 / 2, SRCAP, Tip60, TRRAP, UCH37, YL-1, YL-1, YY1, or ZnF-HIT1.

[121] A heterologous gene effector can be or can comprise a sequence from a transcriptional regulator (TR). TR gene effectors include transcriptional regulatory domains from various families of transcription factors (e.g. KRAB, p65, MED, GTFs, etc.).

[122] A heterologous gene effector can comprise a transcriptional activator domain. A heterologous gene effector can comprise can comprise two or more tandem transcriptional activation domains, e.g., located at a C-terminus, an N-terminus, or within a polypeptide sequence.

[123] Non-limiting examples of transcriptional activation domains include GAL4, herpes simplex activation domain VP16, VP64 (a tetramer of the herpes simplex activation domain VP16), NF-KB p65 subunit, Epstein-Barr virus R transactivator (Rta). Examples of transcriptional activation domains are described in Chavez et al., Nat Methods, 2015, 12(4):326-328 and U.S. Patent App. Publ. No. 20140068797. In some embodiments, such transcriptional activation domains are used as controls in methods of the disclosure. In some embodiments, such transcriptional activation domains are used as one heterologous gene effector in a complex that comprises at least one additional heterologous gene effector (e.g., a different effector).

[124] A heterologous gene effector can comprise a transcriptional repressor domain. A heterologous gene effector can comprise two or more transcriptional repressor domains, e.g., located at a C-terminus, an N-terminus, or within a polypeptide sequence, in tandem or separate.

[125] Non-limiting examples of transcriptional repressor domains include the KRAB (Kruppel-associated box) domain of Koxl, the Mad mSIN3 interaction domain (SID), and ERF repressor domain (ERD). Examples of transcriptional repressor domains are described in in Chavez et al., Nat Methods, 2015, 12(4):326-328 and U.S. Patent App. Publ. No. 20140068797. In some embodiments, such transcriptional repressor domains are used as controls in methods of the disclosure. In some embodiments, such transcriptional repressor domains are used as one heterologous gene effector in a complex that comprises at least one additional heterologous gene effector (e.g., a different effector).

[126] In some disclosures, a heterologous gene effector is from a gene product that is a transcription factor.

[127] In some disclosures, a heterologous gene effector is from a gene product that is a hematopoietic stem cell transcription factor. Non-limiting examples of hematopoietic stem cell transcription factors include AHR, Aiolos / IKZF3, CDX4, CREB, DNMT3A, DNMT3B, EGR1, FoxO3, GATA-1, GATA-2, GATA-3, Helios, HES-1, HHEX, HIF-1 alpha / HIF1A, -20- HMGB1 / HMG-1, HMGB3, Ikaros, c-Jun, LMO2, LMO4, c-Maf, MafB, MEF2C, MYB, c-Myc, NFATC2, NFIL3 / E4BP4, Nrf2, p53, PITX2, PRDM16 / MEL1, Prox1, PU.1 / Spi-1, RUNX1 / CBFA2, SALL4, SCL / Tal1, Smad2, Smad2 / 3, Smad4, Smad7, Spi-B, STAT Activators, STAT Inhibitors, STAT3, STAT4, STAT5a, STAT6, and TSC22.

[128] In some disclosures, a heterologous gene effector is from a gene product that is a mesenchymal stem cell transcription factor. Non-limiting examples of mesenchymal stem cell transcription factors include DUX4, DUX4 / DUX4c, DUX4c, EBF-1, EBF-2, EBF-3, ETV5, FoxC2, FoxF1, GATA-4, GATA-6, HMGA2, c-Jun, MYF-5, Myocardin, MyoD, Myogenin, NFATC2, p53, Pax3, PDX-1 / IPF1, PLZF, PRDM16 / MEL1, RUNX2 / CBFA1, Smad1, Smad3, Smad4, Smad5, Smad8, Smad9, Snail, SOX2, SOX9, SOX11, STAT Activators, STAT Inhibitors, STAT1, STAT3, TBX18, Twist-1, and Twist-2.

[129] In some disclosures, a heterologous gene effector is from a gene product that is an embryonic stem cell transcription factor. Non-limiting examples of embryonic stem cell transcription factors include Brachyury, EOMES, FoxC2, FoxD3, FoxF1, FoxH1, FoxO1 / FKHR, GATA-2, GATA-3, GBX2, Goosecoid, HES-1, HNF-3 alpha / FoxA1, c-Jun, KLF2, KLF4, KLF5, c-Maf, Max, MEF2C, MIXL1, MTF2, c-Myc, Nanog, NFkB / IkB Activators, NFkB / IkB Inhibitors, NFkB1, NFkB2, Oct-3 / 4, Otx2, p53, Pax2, Pax6, PRDM14, Rex-1 / ZFP42, SALL1, SALL4, Smad1, Smad2, Smad2 / 3, Smad3, Smad4, Smad5, Smad8, Snail, SOX2, SOX7, SOX15, SOX17, STAT Activators, STAT Inhibitors, STAT3, SUZ12, TBX6, TCF-3 / E2A, THAP11, UTF1, WDR5, WT1, ZNF206, and ZNF281.

[130] In some disclosures, a heterologous gene effector is from a gene product that is an induced pluripotent stem cell (iPSC) transcription factor. Non-limiting examples of iPSC transcription factors include KLF2, KLF4, c-Maf, c-Myc, Nanog, Oct-3 / 4, p53, SOX1, SOX2, SOX3, SOX15, SOX18, and TBX18.

[131] In some disclosures, a heterologous gene effector is from a gene product that is an epithelial stem cell transcription factor. Non-limiting examples of epithelial stem cell transcription factors include ASCL2 / Mash2, CDX2, DNMT1, ELF3, Ets-1, FoxM1, FoxN1, GATA-6, Hairless, HNF-4 alpha / NR2A1, IRF6, c-Maf, MITF, Miz-1 / ZBTB17, MSX1, MSX2, MYB, c-Myc, Neurogenin-3, NFATC1, NKX3.1, Nrf2, p53, p63 / TP73L, Pax2, Pax3, RUNX1 / CBFA2, RUNX2 / CBFA1, RUNX3 / CBFA3, Smad1, Smad2, Smad2 / 3, Smad4, Smad5, Smad7, Smad8, Snail, SOX2, SOX9, STAT Activators, STAT Inhibitors, STAT3, SUZ12, TCF-3 / E2A, and TCF7 / TCF1.

[132] In some disclosures, a heterologous gene effector is from a gene product that is a cancer stem cell transcription factor. Non-limiting examples of cancer stem cell transcription factors include Androgen R / NR3C4, AP-2 gamma, beta-Catenin, beta-Catenin Inhibitors, Brachyury, -21- CREB, ER alpha / NR3A1, ER beta / NR3A2, FoxM1, FoxO3, FRA-1, GLI-1, GLI-2, GLI-3, HIF-1 alpha / HIF1A, HIF-2 alpha / EPAS1, HMGA1B, c-Jun, JunB, KLF4, c-Maf, MCM2, MCM7, MITF, c-Myc, Nanog, NFkB / IkB Activators, NFkB / IkB Inhibitors, NFkB1, NKX3.1, Oct-3 / 4, p53, PRDM14, Snail, SOX2, SOX9, STAT Activators, STAT Inhibitors, STAT3, TAZ / WWTR1, TBX3, Twist-1, Twist-2, WT1, and ZEB1.

[133] In some disclosures, a heterologous gene effector is from a gene product that is a cancer-related transcription factor. Non-limiting examples of cancer-related transcription factors include ASCL1 / Mash1, ASCL2 / Mash2, ATF1, ATF2, ATF4, BLIMP1 / PRDM1, CDX2, CDX4, DLX5, DNMT1, E2F-1, EGR1, ELF3, Ets-1, FosB / G0S3, FoxC1, FoxC2, FoxF1, GADD153, GATA-2, HMGA2, HMGB1 / HMG-1, HNF-3 alpha / FoxA1, HNF-6 / ONECUT1, HSF1, ID1, ID2, JunD, KLF10, KLF12, KLF17, LMO2, MEF2C, MYCL1 / L-Myc, NFkB2, Oct-1, p63 / TP73L, Pax3, PITX2, Prox1, RAP80, Rex-1 / ZFP42, RUNX1 / CBFA2, RUNX3 / CBFA3, SALL4, SCL / Tal1, Sirtuin 2 / SIRT2, Smad3, Smad4, Smad5, SOX11, STAT5a / b, STAT5a, STAT5b, TCF7 / TCF1, TORC1, TORC2, TRIM32, TRPS1, and TSC22.

[134] In some disclosures, a heterologous gene effector is from a gene product that is an immune cell transcription factor. Non-limiting examples of immune cell transcription factors include AP-1, Bcl6, E2A, EBF, Eomes, FoxP3, GATA3, Id2, Ikaros, IRF, IRF1, IRF2, IRF3, IRF3, IRF7, NFAT, NFkB, Pax5, PLZF, PU.1, ROR-gamma-T, STAT, STAT1, STAT2, STAT3, STAT4, STAT5, STAT5A, STAT5B, STAT6, T-bet, TCF7, and ThPOK.

[135] In some disclosures, a heterologous gene effector is from a gene product that is a RNA polymerase related protein. In some disclosures, a heterologous gene effector is from a transcription factor with a basic domain. In some disclosures, a heterologous gene effector is from a transcription factor with a zinc-coordinated DNA binding domain. In some disclosures, a heterologous gene effector is from a transcription factor with a helix-turn-helix domain. In some disclosures, a heterologous gene effector is from a transcription factor with an alpha helical DNA binding domain. In some disclosures, a heterologous gene effector is from a transcription factor with an alpha helix exposed by beta structures. In some disclosures, a heterologous gene effector is from a transcription factor with an immunoglobulin fold. In some disclosures, a heterologous gene effector is from a transcription factor with a with a beta-Hairpin exposed by an alpha / beta-scaffold. In some disclosures, a heterologous gene effector is from a transcription factor with a beta sheet binding to DNA. In some disclosures, a heterologous gene effector is from a transcription factor with a beta barrel DNA binding domain.

[136] In some disclosures, a heterologous gene effector is from a gene product that is a nuclear receptor, for example, a nuclear hormone receptor. Non-limiting examples of nuclear hormone receptors include those encoded by NR0B1, NR0B2, NR1A1, NR1A2, NR1B1, NR1B2, -22- NR1B3, NR1C1, NR1C2, NR1C3, NR1D1, NR1D2, NR1F1, NR1F2, NR1F3, NR1H4, NR1H5, NR1H3, NR1H2, NR1I1, NR1I2, NR1I3, NR2A1, NR2A2, NR2B1, NR2B2, NR2B3, NR2C1, NR2C2, NR2E1, NR2E3, NR2F1, NR2F2, NR2F6, NR3A1, NR3A2, NR3B1, NR3B2, NR3B3, NR3C4, NR3C1, NR3C2, NR3C3, NR4A1, NR4A2, NR4A3, NR5A1, NR5A2, and NR6A1.

[137] In some disclosures, a heterologous gene effector is from a gene product that is involved in nucleosome assembly. In some disclosures, a heterologous gene effector is from a gene product that is involved in DNA metabolism. In some disclosures, a heterologous gene effector is from a gene product that is involved in nucleotide metabolism. In some disclosures, a heterologous gene effector is from a gene product that is involved in ribosome biogenesis. In some disclosures, a heterologous gene effector is from a gene product that is involved in protein folding. In some disclosures, a heterologous gene effector is from a gene product that is involved in translation. In some disclosures, a heterologous gene effector is from a gene product that is involved in signaling. In some disclosures, a heterologous gene effector is from a gene product that is involved in proteolysis. In some disclosures, a heterologous gene effector is from a gene product that is involved in negative regulation of endopeptidase activity.

[138] In some disclosures, a list of candidate heterologous gene effectors can be stratified by factors such as activation versus repression, target cellular pathway, evolutionary sequence constraint, binding of DNA / RNA / both, protein folding pattern, host / cell tropism, direct / indirect activity, binding promiscuity, nuclear / cytoplasmic action, and other criteria. In some disclosures, such stratifications allow design of a screen library of the disclosure that encompasses a broad spectrum of potential molecular functions, thereby increasing the likelihood for discovery of heterologous gene effectors that are suitable for purposes disclosed herein.

[139] In some disclosures, predictive filtering techniques are applied to candidate heterologous gene effector sequences, e.g., in silico. Predictive filtering techniques can comprise, for example, identification of suitable biophysical properties for core activator domains (e.g., down to 13 bp) through experiments in yeast; the presence of acidic, bulky hydrophobic, alpha helix, and / or negative charge; the presence of motif repeats that may influence duration of effect; and PADDLE-like convolutional neural network / transformer algorithms or similar predictive techniques.

[140] In some embodiments, a heterologous gene effector can regulate expression of a target gene that is exogenous to a host subject, for example, a pathogen target gene or an exogenous gene expressed as a result of a therapeutic intervention.

[141] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, -23- at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 95.5%, at least about 96%, at least about 96.5%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.1%, at least about 99.1%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, at least about 99.9%, at least about 99.95%, at least about 99.99%, or about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 4935350032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032, e.g., over the entire length.

[142] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at most about 70%, at most about 71%, at most about 72%, at most about 73%, at most about 74%, at most about 75%, at most about 76%, at most about 77%, at most about 78%, at most about 79%, at most about 80%, at most about 81%, at most about 82%, at most about 83%, at most about 84%, at most about 85%, at most about 86%, at most about 87%, at most about 88%, at most about 89%, at most about 90%, at most about 91%, at most about 92%, at most about 93%, at most about 94%, at most about 95%, at most about 95.5%, at most about 96%, at most about 96.5%, at most about 97%, at most about 97.5%, at most about 98%, at most about 98.5%, at most about 99%, at most about 99.1%, at most about 99.1%, at most about 99.3%, at most about 99.4%, at most about 99.5%, at most about 99.6%, at most about 99.7%, at most about 99.8%, at most about 99.9%, at most about 99.95%, at most about 99.99%, or at most about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 1615547350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032, e.g., over the entire length.

[143] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 95.5%, about 96%, about 96.5%, about 97%, about 97.5%, about 98%, about 98.5%, about 99%, about 99.1%, about -24- 99.1%, about 99.3%, about 99.4%, about 99.5%, about 99.6%, about 99.7%, about 99.8%, about 99.9%, about 99.95%, about 99.99%, or about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 4735149333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032, e.g., over the entire length.

[144] In some disclosures, a heterologous gene effector comprises a peptide sequence with one or more amino acid insertions, deletions, or substitutions compared to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[145] For example, a heterologous gene effector can comprise an amino acid sequence with at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, or at least 50 amino acid insertions relative to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 1613605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[146] In some disclosures, a heterologous gene effector comprises an amino acid sequence with at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10, at most 11, at most 12, at most 13, at most 14, at most 15, at most 16, at most 17, at most 18, at most 19, at most 20, at most 25, at most 30, at most 35, at most 40, at most 45, or at most 50 amino acid insertions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 4735149333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[147] In some disclosures, a heterologous gene effector comprises an amino acid sequence with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, or 50 amino acid insertions relative to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 1613605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[148] The one or more insertions can be at the N-terminus, C-terminus, within the amino acid sequence, or a combination thereof. The one or more insertions can be contiguous, noncontiguous, or a combination thereof.

[149] In some disclosures, a heterologous gene effector comprises an amino acid sequence with at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, or at least 50 amino acid deletions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 1615547350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[150] In some disclosures, a heterologous gene effector comprises an amino acid sequence with at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10, at most 11, at most 12, at most 13, at most 14, at most 15, at most 16, at most 17, at most 18, at most 19, at most 20, at most 25, at most 30, at most 35, at most 40, at most 45, or at most 50 amino acid deletions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 4735149333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[151] In some disclosures, a heterologous gene effector comprises an amino acid sequence with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, or 50 amino acid deletions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[152] The one or more deletions can be at the N-terminus, C-terminus, within the amino acid sequence, or a combination thereof. The one or more deletions can be contiguous, noncontiguous, or a combination thereof.

[153] In some disclosures, a heterologous gene effector comprises an amino acid sequence with at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, or at least 50 amino acid substitutions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: -26- 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[154] In some disclosures, a heterologous gene effector comprises an amino acid sequence with at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10, at most 11, at most 12, at most 13, at most 14, at most 15, at most 16, at most 17, at most 18, at most 19, at most 20, at most 25, at most 30, at most 35, at most 40, at most 45, or at most 50 amino acid substitutions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 1649333 and 49353-50032.

[155] In some disclosures, a heterologous gene effector comprises an amino acid sequence with 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, or 50 amino acid substitutions relative to any amino acid sequence disclosed herein, for example, any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 1615547350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032.

[156] The one or more substitutions can be at the N-terminus, C-terminus, within the amino acid sequence, or a combination thereof. The one or more substitutions can be contiguous, noncontiguous, or a combination thereof. The one or more substitutions can comprise a substitution of an N-terminal methionine for a different residue, for example, Leucine.

[157] In some disclosures a heterologous gene effector does not contain an N-terminal methionine. In some disclosures, an N-terminal methionine found in any one of SEQ ID NOs: 16-16154, 16-13605, 16155-47350, 16155-43953, 47351-49333, or 16-49333 is deleted, absent, or substituted for a different residue. For example, SEQ ID NOs: 49353-50032 provide illustrative examples of sequences in which an N-terminal methionine has been substituted for an N-terminal leucine. In some embodiments a heterologous gene effector comprises an N-terminal methionine.

[158] The one or more substitutions can be conservative, non-conservative, or a combination thereof. A conservative amino acid substitution can be a substitution of one amino acid for another amino acid of similar biochemical properties (e.g., charge, size, and / or hydrophobicity). A non-conservative amino acid substitution can be a substitution of one amino acid for another amino acid with different biochemical properties (e.g., charge, size, and / or hydrophobicity). A conservative amino acid change can be, for example, a substitution that has minimal effect on the secondary or tertiary structure of a polypeptide.

[159] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 1102, 2057, 5543, 9066, 11948, 15646, 17629, 19860, 21015, 21166, 22149, 22707, 23631, 23639, 25430, 25555, 32678, 33890, 34047, 35737, 38138, 38780, 40913, 40985, 40986, and 42623.

[160] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 1102.

[161] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 2057.

[162] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 5543.

[163] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 9066.

[164] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 11948.

[165] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 15646.

[166] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 17629.

[167] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 19860.

[168] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 21015.

[169] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 21166.

[170] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 22149.

[171] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, -30- at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 22707.

[172] In some embodiments, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 23631.

[173] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 23639.

[174] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 25430.

[175] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 25555. -31-

[176] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 32678.

[177] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 33890.

[178] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 34047.

[179] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 35737.

[180] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, -32- at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 38138.

[181] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 38780.

[182] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 40913.

[183] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 40985.

[184] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at -33- least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 40986.

[185] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to SEQ ID NO: 42623.

[186] In some disclosures, a heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 16, 17, 23, 26, 35, 66, 67, 71, 74, 126, 148, 159, 160, 166, 171, 172, 174, 176, 178, 185, 188, 189, 210, 225, 237, 240, 245, 253, 259, 298, 302, 308, 316, 334, 335, 360, 362, 375, 377, 394, 398, 415, 426, 460, 476, 480, 486, 515, 527, 539, 548, 565, 571, 604, 630, 643, 676, 720, 734, 746, 774, 797, 812, 833, 835, 841, 852, 871, 874, 879, 881, 927, 934, 947, 952, 967, 986, 993, 1009, 1033, 1042, 1044, 1054, 1075, 1076, 1077, 1079, 1084, 1094, 1102, 1111, 1113, 1120, 1129, 1131, 1149, 1156, 1161, 1186, 1190, 1225, 1253, 1258, 1261, 1262, 1265, 1289, 1295, 1299, 1303, 1308, 1311, 1313, 1315, 1328, 1350, 1355, 1368, 1374, 1375, 1380, 1388, 1395, 1400, 1406, 1424, 1427, 1430, 1437, 1440, 1493, 1498, 1502, 1510, 1511, 1519, 1522, 1581, 1591, 1597, 1615, 1630, 1644, 1662, 1675, 1714, 1718, 1720, 1730, 1735, 1745, 1778, 1785, 1791, 1803, 1812, 1820, 1828, 1835, 1869, 1870, 1888, 1889, 1908, 1911, 1912, 1940, 1980, 1981, 2011, 2046, 2057, 2086, 2109, 2119, 2192, 2204, 2233, 2247, 2257, 2276, 2285, 2296, 2304, 2309, 2316, 2335, 2338, 2339, 2347, 2352, 2378, 2382, 2394, 2397, 2429, 2493, 2507, 2519, 2534, 2557, 2572, 2595, 2642, 2650, 2681, 2707, 2725, 2767, 2768, 2804, 2807, 2825, 2837, 2865, 2878, 2888, 2889, 2899, 2966, 2980, 3069, 3073, 3078, 3081, 3093, 3116, 3130, 3175, 3191, 3217, 3222, 3225, 3244, 3254, 3255, 3256, 3261, 3287, 3292, 3299, 3309, 3330, 3353, 3361, 3363, 3379, 3383, 3389, 3392, 3402, 3407, 3416, 3424, 3425, 3444, 3445, 3457, 3462, 3486, 3508, 3528, 3531, 3535, 3541, 3550, 3561, 3563, 3572, 3586, 3590, 3597, 3608, 3630, 3714, 3718, 3723, 3726, -34- 3730, 3735, 3764, 3771, 3786, 3803, 3804, 3851, 3869, 3873, 3907, 3911, 3914, 3918, 3926, 3946, 3965, 4010, 4016, 4025, 4032, 4047, 4063, 4065, 4072, 4082, 4131, 4143, 4150, 4161, 4201, 4225, 4231, 4239, 4261, 4274, 4284, 4289, 4295, 4298, 4325, 4327, 4346, 4358, 4362, 4368, 4444, 4459, 4516, 4547, 4549, 4562, 4571, 4598, 4610, 4618, 4640, 4653, 4669, 4684, 4706, 4721, 4751, 4753, 4763, 4770, 4776, 4807, 4812, 4820, 4826, 4852, 4857, 4867, 4880, 4886, 4892, 4899, 4958, 4961, 4972, 4991, 4998, 5002, 5005, 5006, 5009, 5025, 5027, 5028, 5038, 5045, 5055, 5062, 5081, 5093, 5095, 5129, 5169, 5172, 5189, 5211, 5219, 5245, 5250, 5272, 5273, 5274, 5285, 5294, 5306, 5307, 5351, 5359, 5395, 5402, 5405, 5412, 5444, 5448, 5497, 5502, 5524, 5543, 5559, 5570, 5577, 5604, 5612, 5646, 5649, 5655, 5667, 5697, 5699, 5724, 5734, 5735, 5743, 5747, 5758, 5764, 5782, 5783, 5849, 5856, 5858, 5875, 5898, 5901, 5913, 5921, 5928, 5954, 5959, 5963, 5969, 5980, 5985, 5998, 6003, 6021, 6033, 6036, 6050, 6052, 6073, 6075, 6102, 6107, 6121, 6134, 6158, 6173, 6179, 6182, 6198, 6205, 6236, 6272, 6276, 6298, 6310, 6332, 6335, 6356, 6384, 6386, 6389, 6414, 6431, 6446, 6447, 6470, 6502, 6508, 6522, 6533, 6545, 6558, 6580, 6588, 6604, 6608, 6610, 6628, 6632, 6648, 6651, 6652, 6659, 6673, 6681, 6682, 6698, 6699, 6752, 6757, 6761, 6795, 6813, 6818, 6819, 6828, 6838, 6842, 6848, 6868, 6873, 6874, 6882, 6893, 6895, 6900, 6902, 6903, 6928, 6931, 6941, 6952, 6953, 6955, 6984, 7027, 7029, 7030, 7034, 7070, 7076, 7106, 7115, 7128, 7140, 7143, 7166, 7171, 7187, 7226, 7259, 7279, 7281, 7286, 7291, 7296, 7304, 7320, 7325, 7336, 7375, 7391, 7405, 7414, 7432, 7433, 7443, 7462, 7489, 7500, 7501, 7508, 7520, 7551, 7570, 7576, 7590, 7596, 7608, 7611, 7613, 7621, 7625, 7637, 7643, 7651, 7661, 7696, 7701, 7703, 7705, 7711, 7717, 7722, 7728, 7736, 7770, 7781, 7803, 7807, 7809, 7831, 7833, 7834, 7856, 7888, 7890, 7894, 7926, 7927, 7943, 7949, 7965, 7984, 8010, 8018, 8027, 8028, 8041, 8068, 8089, 8097, 8102, 8105, 8111, 8129, 8149, 8186, 8189, 8219, 8223, 8227, 8236, 8243, 8249, 8255, 8256, 8258, 8259, 8272, 8278, 8280, 8283, 8297, 8301, 8308, 8314, 8324, 8328, 8347, 8357, 8363, 8371, 8386, 8394, 8408, 8420, 8421, 8429, 8432, 8436, 8437, 8439, 8468, 8485, 8488, 8489, 8505, 8538, 8551, 8563, 8564, 8574, 8579, 8628, 8629, 8631, 8634, 8636, 8637, 8641, 8670, 8692, 8699, 8729, 8730, 8752, 8779, 8805, 8841, 8854, 8865, 8886, 8893, 8931, 8933, 8973, 8981, 8985, 8998, 9000, 9003, 9017, 9021, 9024, 9026, 9027, 9040, 9050, 9053, 9055, 9066, 9069, 9072, 9078, 9094, 9095, 9100, 9110, 9119, 9130, 9152, 9153, 9189, 9194, 9222, 9223, 9225, 9231, 9262, 9264, 9267, 9273, 9283, 9297, 9304, 9307, 9314, 9320, 9324, 9328, 9338, 9380, 9386, 9397, 9403, 9413, 9442, 9472, 9516, 9528, 9534, 9542, 9552, 9568, 9602, 9611, 9626, 9632, 9648, 9649, 9663, 9667, 9669, 9670, 9672, 9673, 9675, 9678, 9682, 9700, 9741, 9750, 9761, 9771, 9829, 9845, 9853, 9854, 9879, 9880, 9891, 9893, 9894, 9899, 9901, 9903, 9922, 9933, 9937, 9940, 9943, 9948, 9962, 9965, 9971, 9988, 9990, 10007, 10014, 10016, 10025, 10040, 10058, 10069, 10072, 10095, 10097, 10113, 10123, 10160, 10230, 10234, 10235, -35- 10236, 10238, 10250, 10252, 10279, 10289, 10292, 10309, 10313, 10314, 10315, 10316, 10329, 10348, 10357, 10364, 10383, 10394, 10405, 10407, 10414, 10420, 10421, 10423, 10427, 10428, 10436, 10437, 10439, 10446, 10451, 10459, 10463, 10466, 10489, 10490, 10491, 10512, 10516, 10555, 10566, 10570, 10584, 10587, 10588, 10607, 10615, 10624, 10637, 10648, 10663, 10701, 10732, 10759, 10778, 10788, 10796, 10813, 10853, 10865, 10878, 10919, 10943, 10945, 10950, 10955, 10957, 10969, 10984, 10991, 10998, 10999, 11018, 11019, 11027, 11035, 11036, 11042, 11045, 11079, 11090, 11095, 11106, 11129, 11187, 11207, 11218, 11223, 11233, 11260, 11265, 11272, 11290, 11297, 11306, 11326, 11374, 11386, 11396, 11411, 11432, 11437, 11455, 11459, 11471, 11481, 11485, 11486, 11506, 11511, 11550, 11555, 11557, 11577, 11601, 11621, 11642, 11652, 11670, 11673, 11705, 11709, 11712, 11713, 11715, 11716, 11723, 11730, 11737, 11741, 11749, 11750, 11778, 11784, 11785, 11794, 11797, 11799, 11804, 11810, 11835, 11888, 11893, 11895, 11904, 11931, 11932, 11948, 11969, 11982, 11985, 12020, 12024, 12029, 12055, 12061, 12066, 12067, 12069, 12072, 12096, 12114, 12121, 12132, 12161, 12183, 12187, 12191, 12199, 12227, 12254, 12266, 12344, 12345, 12362, 12393, 12400, 12401, 12422, 12427, 12436, 12448, 12451, 12476, 12498, 12526, 12542, 12558, 12560, 12567, 12570, 12590, 12591, 12609, 12613, 12626, 12632, 12660, 12669, 12671, 12681, 12692, 12706, 12716, 12722, 12723, 12738, 12753, 12757, 12771, 12775, 12783, 12786, 12806, 12809, 12822, 12838, 12843, 12846, 12847, 12892, 12904, 12925, 12928, 12932, 12945, 12947, 12958, 12960, 12965, 12982, 13022, 13027, 13031, 13032, 13038, 13046, 13083, 13092, 13124, 13149, 13174, 13190, 13195, 13198, 13211, 13219, 13226, 13229, 13233, 13273, 13283, 13288, 13327, 13345, 13363, 13364, 13385, 13394, 13395, 13403, 13420, 13452, 13497, 13509, 13517, 13528, 13553, 13569, 16179, 16218, 16224, 16251, 16278, 16313, 16319, 16335, 16364, 16381, 16414, 16440, 16472, 16482, 16501, 16505, 16506, 16514, 16515, 16516, 16524, 16535, 16541, 16578, 16618, 16667, 16677, 16699, 16702, 16705, 16769, 16771, 16786, 16807, 16856, 16867, 16916, 16935, 17012, 17029, 17032, 17054, 17067, 17084, 17087, 17107, 17115, 17121, 17127, 17142, 17146, 17193, 17196, 17209, 17231, 17247, 17256, 17264, 17268, 17273, 17275, 17298, 17314, 17326, 17332, 17349, 17354, 17377, 17385, 17434, 17444, 17447, 17469, 17475, 17491, 17494, 17511, 17528, 17538, 17546, 17556, 17563, 17565, 17570, 17608, 17613, 17629, 17633, 17639, 17666, 17674, 17691, 17697, 17735, 17793, 17816, 17817, 17821, 17842, 17843, 17883, 17901, 17928, 17950, 17956, 17961, 17965, 17983, 18026, 18092, 18106, 18113, 18125, 18144, 18162, 18221, 18237, 18340, 18351, 18355, 18388, 18439, 18444, 18468, 18499, 18504, 18555, 18561, 18579, 18587, 18588, 18599, 18618, 18642, 18664, 18696, 18725, 18736, 18741, 18787, 18809, 18827, 18854, 18864, 18872, 18888, 18936, 19013, 19034, 19048, 19063, 19075, 19078, 19079, 19092, 19123, 19126, 19156, 19188, 19211, 19212, 19235, 19237, 19239, 19248, 19261, 19289, 19292, 19320, 19325, 19387, 19389, 19424, 19435, 19445, 19490, 19512, 19542, 19556, 19559, 19568, 19571, 19581, 19583, 19591, 19599, -36- 19621, 19624, 19633, 19642, 19671, 19684, 19711, 19731, 19738, 19745, 19761, 19771, 19781, 19809, 19815, 19858, 19860, 19877, 19888, 19916, 19973, 19989, 19998, 20006, 20028, 20055, 20100, 20101, 20116, 20144, 20169, 20207, 20266, 20273, 20285, 20316, 20317, 20321, 20342, 20352, 20365, 20375, 20383, 20387, 20390, 20415, 20416, 20429, 20484, 20506, 20521, 20526, 20541, 20556, 20578, 20637, 20657, 20668, 20703, 20746, 20767, 20818, 20839, 20857, 20871, 20876, 20877, 20878, 20881, 20887, 20939, 20946, 20993, 20998, 21001, 21004, 21015, 21024, 21042, 21054, 21057, 21091, 21123, 21126, 21134, 21139, 21149, 21166, 21211, 21229, 21238, 21291, 21294, 21295, 21306, 21312, 21339, 21455, 21488, 21492, 21507, 21518, 21557, 21610, 21616, 21623, 21633, 21644, 21646, 21661, 21709, 21755, 21767, 21768, 21788, 21792, 21804, 21806, 21882, 21932, 21974, 21985, 22046, 22059, 22096, 22123, 22149, 22164, 22193, 22206, 22221, 22232, 22240, 22241, 22275, 22284, 22302, 22344, 22358, 22359, 22392, 22410, 22433, 22437, 22449, 22459, 22462, 22469, 22510, 22536, 22540, 22542, 22563, 22592, 22613, 22639, 22655, 22693, 22695, 22707, 22710, 22711, 22723, 22726, 22742, 22745, 22753, 22838, 22889, 22899, 22912, 22916, 23003, 23014, 23039, 23060, 23112, 23131, 23136, 23157, 23160, 23168, 23171, 23199, 23214, 23216, 23244, 23257, 23260, 23261, 23269, 23278, 23280, 23305, 23316, 23326, 23351, 23370, 23383, 23404, 23415, 23442, 23443, 23449, 23451, 23501, 23515, 23521, 23526, 23534, 23557, 23562, 23567, 23568, 23579, 23585, 23626, 23631, 23632, 23639, 23644, 23814, 23832, 23895, 23926, 23929, 23987, 23990, 24041, 24071, 24077, 24119, 24122, 24136, 24179, 24214, 24218, 24242, 24245, 24292, 24303, 24304, 24316, 24391, 24393, 24422, 24424, 24429, 24433, 24493, 24501, 24525, 24535, 24578, 24587, 24631, 24645, 24649, 24652, 24656, 24667, 24668, 24679, 24682, 24727, 24742, 24815, 24831, 24838, 24871, 24881, 24914, 24921, 24972, 24973, 24988, 25001, 25022, 25040, 25050, 25051, 25062, 25091, 25108, 25164, 25168, 25171, 25190, 25191, 25192, 25198, 25210, 25242, 25252, 25281, 25400, 25430, 25442, 25444, 25470, 25515, 25530, 25543, 25547, 25555, 25565, 25567, 25569, 25598, 25663, 25669, 25675, 25677, 25681, 25692, 25695, 25707, 25712, 25714, 25747, 25762, 25778, 25815, 25834, 25842, 25856, 25858, 25859, 25874, 25878, 25897, 25911, 25925, 25939, 25956, 25966, 25976, 26006, 26060, 26081, 26097, 26101, 26119, 26146, 26161, 26191, 26218, 26221, 26239, 26249, 26324, 26335, 26337, 26379, 26391, 26392, 26411, 26424, 26456, 26460, 26481, 26528, 26575, 26578, 26588, 26589, 26600, 26606, 26633, 26634, 26651, 26672, 26679, 26706, 26728, 26729, 26734, 26750, 26806, 26808, 26818, 26831, 26893, 26896, 26898, 26991, 26999, 27024, 27026, 27033, 27087, 27088, 27119, 27122, 27191, 27229, 27257, 27284, 27322, 27337, 27384, 27446, 27450, 27482, 27486, 27499, 27511, 27520, 27541, 27584, 27612, 27673, 27681, 27766, 27795, 27807, 27814, 27833, 27835, 27851, 27856, 27874, 27876, 27917, 27953, 27995, 28039, 28046, 28083, 28084, 28089, 28094, 28099, 28100, 28104, 28160, 28161, 28165, 28166, 28171, 28172, 28173, 28176, 28177, 28197, 28251, 28276, 28302, 28308, 28312, 28354, 28394, 28440, 28445, 28462, -37- 28464, 28477, 28490, 28555, 28564, 28572, 28576, 28598, 28621, 28630, 28648, 28652, 28691, 28692, 28725, 28728, 28732, 28744, 28746, 28751, 28774, 28806, 28816, 28817, 28826, 28848, 28849, 28854, 28864, 28899, 28904, 28914, 28925, 28966, 28968, 29015, 29039, 29055, 29075, 29121, 29127, 29137, 29140, 29144, 29175, 29219, 29226, 29241, 29249, 29273, 29295, 29300, 29317, 29353, 29368, 29393, 29404, 29448, 29460, 29506, 29511, 29530, 29531, 29558, 29573, 29609, 29628, 29781, 29794, 29816, 29864, 29869, 29889, 29915, 29917, 29931, 29951, 29985, 30005, 30015, 30032, 30037, 30039, 30095, 30110, 30112, 30117, 30121, 30142, 30148, 30159, 30176, 30207, 30217, 30238, 30294, 30324, 30371, 30387, 30452, 30465, 30477, 30482, 30492, 30494, 30514, 30520, 30532, 30547, 30580, 30586, 30621, 30627, 30634, 30650, 30655, 30672, 30676, 30702, 30709, 30724, 30728, 30777, 30781, 30793, 30802, 30815, 30818, 30861, 30874, 30883, 30892, 30898, 31020, 31041, 31044, 31054, 31058, 31059, 31060, 31112, 31131, 31153, 31160, 31211, 31213, 31234, 31240, 31253, 31257, 31316, 31339, 31347, 31372, 31413, 31430, 31484, 31488, 31527, 31550, 31583, 31608, 31623, 31628, 31641, 31654, 31663, 31697, 31701, 31703, 31721, 31750, 31755, 31784, 31786, 31797, 31832, 31846, 31878, 31889, 31954, 31969, 31975, 31993, 32009, 32014, 32034, 32055, 32057, 32076, 32077, 32127, 32133, 32205, 32236, 32293, 32301, 32360, 32365, 32379, 32386, 32419, 32453, 32454, 32455, 32464, 32466, 32489, 32514, 32520, 32534, 32538, 32542, 32573, 32592, 32634, 32642, 32653, 32659, 32678, 32679, 32725, 32758, 32767, 32771, 32788, 32816, 32829, 32851, 32874, 32875, 32881, 32883, 32885, 32887, 32891, 32892, 32900, 32905, 32912, 32913, 32922, 32932, 32940, 32961, 33008, 33021, 33048, 33059, 33108, 33110, 33115, 33151, 33166, 33207, 33210, 33220, 33223, 33230, 33261, 33314, 33326, 33349, 33351, 33359, 33365, 33368, 33379, 33391, 33423, 33438, 33473, 33497, 33527, 33538, 33555, 33576, 33582, 33607, 33613, 33619, 33625, 33630, 33641, 33670, 33671, 33689, 33696, 33730, 33733, 33777, 33799, 33830, 33869, 33882, 33886, 33890, 33915, 33974, 34043, 34047, 34048, 34059, 34074, 34079, 34134, 34149, 34163, 34182, 34234, 34244, 34260, 34291, 34365, 34373, 34384, 34415, 34421, 34423, 34445, 34452, 34462, 34481, 34483, 34487, 34501, 34507, 34509, 34524, 34560, 34563, 34584, 34642, 34660, 34672, 34685, 34689, 34723, 34754, 34755, 34778, 34794, 34801, 34816, 34818, 34819, 34824, 34826, 34856, 34883, 34886, 34888, 34902, 34933, 34945, 34949, 35017, 35106, 35138, 35158, 35183, 35216, 35226, 35274, 35275, 35293, 35297, 35329, 35368, 35371, 35382, 35440, 35470, 35503, 35517, 35530, 35543, 35557, 35571, 35597, 35605, 35617, 35654, 35676, 35730, 35737, 35755, 35762, 35763, 35781, 35787, 35833, 35863, 35871, 35907, 35928, 35953, 35973, 36062, 36067, 36071, 36122, 36159, 36160, 36165, 36179, 36180, 36190, 36238, 36241, 36270, 36271, 36275, 36276, 36312, 36329, 36388, 36450, 36453, 36460, 36464, 36480, 36512, 36513, 36525, 36541, 36547, 36550, 36566, 36593, 36602, 36652, 36656, 36716, 36754, 36760, 36763, 36777, 36790, 36792, 36793, 36808, 36813, 36818, 36839, 36862, 36887, 36900, 36977, 36987, 37000, 37014, 37039, 37041, 37067, -38- 37076, 37101, 37114, 37116, 37125, 37175, 37195, 37197, 37199, 37200, 37203, 37204, 37320, 37321, 37324, 37379, 37394, 37397, 37422, 37426, 37436, 37456, 37481, 37485, 37486, 37495, 37540, 37560, 37564, 37584, 37593, 37595, 37617, 37619, 37663, 37687, 37734, 37736, 37738, 37739, 37749, 37782, 37783, 37792, 37832, 37839, 37841, 37856, 37871, 37876, 37900, 37931, 37932, 37946, 37971, 38002, 38014, 38025, 38059, 38064, 38080, 38099, 38100, 38102, 38103, 38110, 38116, 38131, 38134, 38135, 38138, 38146, 38147, 38167, 38170, 38214, 38220, 38250, 38255, 38264, 38291, 38303, 38308, 38325, 38331, 38347, 38352, 38368, 38382, 38397, 38399, 38448, 38456, 38457, 38504, 38515, 38520, 38524, 38536, 38540, 38560, 38567, 38601, 38610, 38632, 38637, 38641, 38687, 38690, 38704, 38765, 38780, 38789, 38803, 38847, 38850, 38853, 38855, 38860, 38879, 38882, 38896, 38905, 38937, 39020, 39049, 39109, 39110, 39117, 39132, 39137, 39161, 39165, 39166, 39171, 39180, 39231, 39239, 39243, 39249, 39266, 39298, 39329, 39332, 39385, 39389, 39409, 39413, 39419, 39435, 39457, 39463, 39511, 39512, 39525, 39527, 39551, 39559, 39576, 39606, 39646, 39670, 39675, 39695, 39702, 39772, 39783, 39785, 39802, 39804, 39818, 39875, 39879, 39890, 39891, 39924, 39997, 40000, 40027, 40033, 40048, 40067, 40119, 40132, 40170, 40226, 40261, 40268, 40284, 40292, 40314, 40321, 40324, 40338, 40341, 40345, 40357, 40385, 40395, 40411, 40462, 40476, 40477, 40479, 40486, 40489, 40511, 40524, 40531, 40561, 40562, 40577, 40614, 40632, 40648, 40651, 40661, 40673, 40677, 40680, 40686, 40690, 40691, 40704, 40710, 40711, 40733, 40747, 40763, 40764, 40788, 40830, 40900, 40909, 40913, 40918, 40925, 40932, 40935, 40966, 40970, 40973, 40985, 40986, 41006, 41008, 41032, 41040, 41041, 41061, 41069, 41081, 41119, 41173, 41175, 41176, 41179, 41180, 41227, 41230, 41234, 41272, 41299, 41314, 41318, 41382, 41385, 41417, 41424, 41435, 41481, 41513, 41522, 41524, 41536, 41567, 41578, 41654, 41701, 41702, 41707, 41709, 41752, 41762, 41765, 41768, 41771, 41781, 41795, 41804, 41805, 41824, 41876, 41900, 41902, 41922, 41926, 41968, 42008, 42021, 42081, 42103, 42115, 42139, 42147, 42174, 42185, 42186, 42262, 42270, 42277, 42279, 42299, 42301, 42302, 42303, 42310, 42327, 42339, 42343, 42348, 42350, 42354, 42373, 42406, 42450, 42462, 42472, 42486, 42507, 42540, 42571, 42581, 42582, 42587, 42592, 42623, 42656, 42667, 42673, 42689, 42718, 42723, 42772, 42781, 42800, 42805, 42835, 42838, 42872, 42963, 42964, 42966, 42977, 43010, 43039, 43040, 43043, 43053, 43080, 43122, 43126, 43148, 43156, 43224, 43228, 43236, 43237, 43260, 43292, 43314, 43394, 43434, 43446, 43451, 43465, 43477, 43481, 43492, 43523, 43531, 43571, 43612, 43615, 43640, 43656, 43725, 43737, 43751, 43769, 43803, 43810, 43819, 43881, 43885, 43902, 43903, 43911, 43941, 43946, 43952, 49354, 49374, 49390, 49498, 49518, 49520, 49532, 49547, 49559, 49588, 49594, 49595, 49606, 49619, 49622, 49625, 49646, 49649, 49662, 49675, 49680, 49687, 49691, 49695, 49712, 49720, 49728, 49737, 49738, 49747, 49760, 49772, 49779, 49780, 49788, 49832, 49850, 49874, 49894, 49904, 49955, 49969, 49971, and 49974.

[187] In some embodiments, a heterologous gene effector comprises, consists essentially of, or consists of an amino acid sequence that is at most about 500, at most about 450, at most about 400, at most about 350, at most about 300, at most about 250, at most about 200, at most about 190, at most about 180, at most about 170, at most about 160, at most about 150, at most about 140, at most about 130, at most about 120, at most about 110, at most about 100, at most about 90, at most about 85, at most about 80 amino acids in length.

[188] In some embodiments, a heterologous gene effector comprises, consists essentially of, or consists of an amino acid sequence that is at least about 75, at least about 80, or at least about 85 amino acids in length.

[189] In some embodiments, a heterologous gene effector comprises, consists essentially of, or consists of an amino acid sequence that is about 80-500, about 80-400, about 80-300, about 80250, about 80-200, about 80-150, about 80-125, about 80-100, or about 80-90 amino acids in length. In some embodiments, a heterologous gene effector comprises, consists essentially of, or consists of an amino acid sequence that is about 85 amino acids in length.

[190] The degree of sequence identity between two sequences can be determined, for example, by comparing the two sequences using computer programs commonly employed for this purpose, such as global or local alignment algorithms. Non-limiting examples include BLASTp, BLASTn, Clustal W, MAFFT, Clustal Omega, AlignMe, Praline, GAP, BESTFIT, or another suitable method or algorithm. A Needleman and Wunsch global alignment algorithm can be used to align two sequences over their entire length, maximizing the number of matches and minimizes the number of gaps. Default settings can be used.

[191] In some disclosures, a heterologous gene effector comprises two or more sequences disclosed herein, for example, two, three, four, five, six, seven, eight, nine, ten, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more of SEQ ID NOs: 16-49333 and 49353-50032. In some disclosures, the two or more sequences originate from or are encoded by the same DNA sequence, e.g., are encoded by adjacent stretches of nucleotides from the same source gene or genome, such as before and after a putative or predicted stop codon. In some disclosures, the two or more sequences originate from or are encoded by different DNA sequences, e.g., different genes.

[192] In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, a chromatin regulator that has been previously identified. In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, a chromatin regulator that has previously been targeted to regulate expression of a gene using a guide moiety as disclosed herein. In some embodiments, a heterologous gene effector is not P300, TET1, TET2, TET3, and / or HSF1, or does not contain a sequence from P300, TET1, TET2, TET3, and / or HSF1. -40-

[193] In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, a transcriptional activator that has been previously identified. In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, a transcriptional activator that has previously been targeted to regulate expression of a gene using a guide moiety as disclosed herein. In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta).

[194] In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, a transcriptional repressor that has been previously identified. In some embodiments, a heterologous gene effector is not, or does not contain a sequence from, a transcriptional repressor that has previously been targeted to regulate expression of a gene using a guide moiety as disclosed herein. In some embodiments, a heterologous gene effector is not, or does not contain a sequence from KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A.

[195] Heterologous gene effectors can be drawn from literature and database sources and can be targeted to include diverse protein families. Viral heterologous gene effectors

[196] Disclosed herein, in some embodiments, are compositions and methods that utilize heterologous gene effectors from viral sources, e.g., viral gene effectors.

[197] Hundreds of species of virus infect humans. Gene effector domains can be encoded by viral genomes to modulate expression of host and / or viral genes. A census of viral transcriptional regulators from 20 virus families identified 419 transcriptional regulators, of which 171 were DNA-binding (Liu, Xing, et al. "Human virus transcriptional regulators." Cell 182.1 (2020): 2437). Further, the majority of the vast number of viral particles estimated to exist have not been characterized, but may harbor heterologous gene effectors that could be useful when incorporated into compositions and methods of the disclosure. For example, such viral heterologous gene effectors from viral sources may comprise novel effector activity, genome organization control, and / or nucleic acid packaging functions. Viruses lacking human tropism -41- may nonetheless produce desirable activity when employed in compositions and methods of the disclosure (for example, used in engineered complexes disclosed herein). Epidemiological studies have identified zoonotic infectious viral species with verified human-tropic activity that emerge from rich evolutionary processes in key viral reservoirs, such as bats, supporting the idea that gene effector activity can be present even in viruses that lack human tropism. Thus, the disclosure includes sequence data collected from metagenomic surveys.

[198] Transcriptional regulatory activity of viral heterologous gene effectors can comprise or affect, for example, chromatin remodeling, RNA polymerase recruitment (e.g., RNA Pol II), transcription imitation, transcription elongation, DNA replication, viral transcription, nucleic acid transport, or a combination thereof. Transcriptional regulatory activity of viral heterologous gene effectors can involve, for example, direct binding to nucleic acids (e.g., E2, ICP4, Zta, IRFs), indirect binding to nucleic acids (e.g., EBNA2, E1A), regulation of transcriptional machinery or components thereof (e.g., Tat, E1A, IE2), modification of chromatin (e.g., E1A, Hbx, Tat), or a combination thereof.

[199] Compared to human transcriptional regulators, viral transcriptional regulators can show little sequence conservation of DNA-binding domains, exhibit higher mutation rates, and be poorly structurally defined (<12%). Defining discrete viral transcriptional regulators can require reliance on species ortholog homology, and limited DNA motif knowledge can mean that defining viral transcriptional regulator binding targets requires experimental data (ChIP, EMSA, DNase footprinting, etc).

[200] In some disclosures, a list of candidate viral heterologous gene effectors can be stratified by factors such as activation versus repression, target cellular pathway, evolutionary sequence constraint, binding of DNA / RNA / both, protein folding pattern, host / cell tropism, direct / indirect activity, binding promiscuity, nuclear / cytoplasmic action, and other criteria. In some disclosures, such stratifications allow design of a screen library of the disclosure that encompasses a broad spectrum of potential molecular functions, thereby increasing the likelihood for novel effector discovery.

[201] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from validated human virus transcriptional regulators. Such transcriptional regulators can be validated by, for example, ChIP / ChIP-seq, EMSA, SELEX, reporter assays, binding assays, or crystal structures. Non limiting examples of viral families that can have validated human virus transcriptional regulators include Adenoviridae, Arenaviridae, Bornaviridae, Coronaviridae, Filoviridae, Flaviviridae, Hepadnaviridae, Herpesviridae, Orthomyxoviridae, Papillomaviridae, Paramyxoviridae, Parvoviridae, Peribunyaviridae, Phenuiviridae, Pneumoviridae, Polyomaviridae, Poxviridae, Retroviridae, and Rhabdoviridae.

[202] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from viruses or virus families that have been shown to be capable of zoonotic transmission to humans. The viruses can be capable of infecting, for example, mammals, birds, swine, non-human primates, rodents, ungulates, reptiles, or amphibians. Non limiting examples of viral families that have been shown to be capable of zoonotic transmission to humans include Flaviviridae, Lyssaviridae, Filoviridae, Paramyxoviridae, Orthomyxoviridae, Coronaviridae, Reoviridae, Togaviridae, Phenuviridae, Hantaviridae, Bunyaviridae, and Rhabdoviridae.

[203] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from viruses or virus families that can infect humans and bats. In some disclosures, sequence data for the candidate heterologous gene effectors from viruses or virus families that can infect humans and bats are obtained from a database, such as dBatVir. Non limiting examples of viral families that can infect humans and bats include Flaviviridae, Lyssaviridae, Filoviridae, Paramyxoviridae, Orthomyxoviridae, Coronaviridae, Reoviridae, Togaviridae, Phenuviridae, Hantaviridae, Bunyaviridae, and Rhabdoviridae.

[204] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from metagenomic virus sequences. Non-limiting examples of sources of viral metagenomic data include the human gut virome, extreme environments (e.g., high-temperature and / or high-acid ecosystems which may be enriched for optimal effector qualities, including e.g. archaea-tropic viruses (e.g., sulfolobus), oceans, geothermal vents, viruses that infect non-human species and / or are from virus families that exhibit zoonotic transmission to humans, and sources that utilize structural data (e.g., X-ray, NMR) from public databases. In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from viruses that infect archaea, bacteria, cyanobacterial, algae, plants, etc., Non-limiting examples of virus species with sequence data obtained from metagenomic sources include sulfolobus, Siphoviridae, podoviridae, myoviridae, Mimiviridae, Nimaviridae, Ligamenvirales, Globuloviridae, Fuselloviridae, Bicaudaviridae, Satellite virus, Iridoviridae, Turriviridae, Caudovirales, and Phycodnaviridae.

[205] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from one or more viruses from the families Abyssoviridae, Ackermannviridae, Adenoviridae, Adintoviridae, Aliusviridae, Alloherpesviridae, Alphaflexiviridae, Alphasatellitidae, Alphatetraviridae, Alvernaviridae, Amalgaviridae, Amnoonviridae, Ampullaviridae, Anelloviridae, Arenaviridae, Arteriviridae, Artoviridae, Ascoviridae, Asfarviridae, Aspiviridae, Astroviridae, Atkinsviridae, Autographiviridae, Avsunviroidae, Bacilladnaviridae, Baculoviridae, Barnaviridae, Belpaoviridae, Benyviridae, -43- Betaflexiviridae, Bicaudaviridae, Bidnaviridae, Birnaviridae, Blumeviridae, Bornaviridae, Botourmiaviridae, Bromoviridae, Caliciviridae, Carmotetraviridae, Caulimoviridae, Chaseviridae, Chrysoviridae, Chuviridae, Circoviridae, Clavaviridae, Closteroviridae, Coronaviridae, Corticoviridae, Cremegaviridae, Crepuscuviridae, Cruliviridae, Curvulaviridae, Cystoviridae, Deltaflexiviridae, Demerecviridae, Dicistroviridae, Drexlerviridae, Duinviridae, Endornaviridae, Euroniviridae, Fiersviridae, Filoviridae, Fimoviridae, Finnlakeviridae, Flaviviridae, Fuselloviridae, Gammaflexiviridae, Geminiviridae, Genomoviridae, Globuloviridae, Gresnaviridae, Guelinviridae, Guttaviridae, Halspiviridae, Hantaviridae, Hepadnaviridae, Hepeviridae, Herelleviridae, Herpesviridae, Hypoviridae, Hytrosaviridae, Iflaviridae, Inoviridae, Iridoviridae, Kitaviridae, Kolmioviridae, Lavidaviridae, Leishbuviridae, Lipothrixviridae, Lispiviridae, Malacoherpesviridae, Marnaviridae, Marseilleviridae, Matonaviridae, Matshushitaviridae, Mayoviridae, Medioniviridae, Megabirnaviridae, Mesoniviridae, Metaviridae, Metaxyviridae, Microviridae, Mimiviridae, Mitoviridae, Mononiviridae, Mymonaviridae, Myoviridae, Mypoviridae, Myriaviridae, Nairoviridae, Nanghoshaviridae, Nanhypoviridae, Nanoviridae, Narnaviridae, Natareviridae, Nimaviridae, Nodaviridae, Nudiviridae, Nyamiviridae, Olifoviridae, Orthomyxoviridae, Ovaliviridae, Papillomaviridae, Paramyxoviridae, Partitiviridae, Parvoviridae, Paulinoviridae, Peribunyaviridae, Permutotetraviridae, Phasmaviridae, Phenuiviridae, Phycodnaviridae, Picobirnaviridae, Picornaviridae, Plasmaviridae, Plectroviridae, Pleolipoviridae, Pneumoviridae, Podoviridae, Polycipiviridae, Polydnaviridae, Polymycoviridae, Polyomaviridae, Portogloboviridae, Pospiviroidae, Potyviridae, Poxviridae, Pseudoviridae, Qinviridae, Quadriviridae, Redondoviridae, Reoviridae, Retroviridae, Rhabdoviridae, Roniviridae, Rountreeviridae, Rudiviridae, Salasmaviridae, Sarthroviridae, Schitoviridae, Secoviridae, Simuloviridae, Sinhaliviridae, Siphoviridae, Smacoviridae, Solemoviridae, Solinviviridae, Solspiviridae, Sphaerolipoviridae, Spiraviridae, Steitzviridae, Sunviridae, Tectiviridae, Thaspiviridae, Tobaniviridae, Togaviridae, Tolecusatellitidae, Tombusviridae, Tospoviridae, Totiviridae, Tristromaviridae, Turriviridae, Tymoviridae, Virgaviridae, Wupedeviridae, Xinmoviridae, Yueviridae, Zobellviridae, or any combination thereof.

[206] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from one or more viruses from the subfamilies Actantavirinae, Agantavirinae, Aglimvirinae, Alphaherpesvirinae, Alphairidovirinae, Alpharhabdovirinae, Arquatrovirinae, Avulavirinae, Azeredovirinae, Bastillevirinae, Bclasvirinae, Beephvirinae, Beijerinckvirinae, Betaherpesvirinae, Betairidovirinae, Betarhabdovirinae, Braunvirinae, Brockvirinae, Bronfenbrennervirinae, Bullavirinae, Calvusvirinae, Ceronivirinae, Chebruvirinae, Chimanivirinae, Chordopoxvirinae, Cleopatravirinae, Cobavirinae, Colwellvirinae, Comovirinae, -44- Corkvirinae, Crocarterivirinae, Crustonivirinae, Cvivirinae, Dclasvirinae, Deejayvirinae, Denniswatsonvirinae, Densovirinae, Dolichocephalovirinae, Eekayvirinae, Emmerichvirinae, Enquatrovirinae, Entomopoxvirinae, Equarterivirinae, Ermolyevavirinae, Erskinevirinae, Eucampyvirinae, Firstpapillomavirinae, Fuhrmanvirinae, Gammaherpesvirinae, Gammarhabdovirinae, Geminialphasatellitinae, Gochnauervirinae, Gofosavirinae, Gokushovirinae, Gorgonvirinae, Guernseyvirinae, Gutmannvirinae, Hamaparvovirinae, Hendrixvirinae, Heroarterivirinae, Hexponivirinae, Humphriesvirinae, Hyporhamsavirinae, Jasinkavirinae, Krylovirinae, Langleyhallvirinae, Letovirinae, Mammantavirinae, Markadamsvirinae, Mccleskeyvirinae, Mccorquodalevirinae, Mclasvirinae, Medionivirinae, Melnykvirinae, Metaparamyxovirinae, Migulavirinae, Molineuxvirinae, Mononivirinae, Nanoalphasatellitinae, Nclasvirinae, Nefertitivirinae, Northropvirinae, Nymbaxtervirinae, Okabevirinae, Okanivirinae, Orthocoronavirinae, Orthoparamyxovirinae, Orthoretrovirinae, Ounavirinae, Parvovirinae, Pclasvirinae, Peduovirinae, Petromoalphasatellitinae, Picovirinae, Piscanivirinae, Pontosvirinae, Procedovirinae, Queuovirinae, Quinvirinae, Rakietenvirinae, Regressovirinae, Remotovirinae, Repantavirinae, Reternivirinae, Rhodovirinae, Rodepovirinae, Rogunavirinae, Rothmandenesvirinae, Rubulavirinae, Sarlesvirinae, Secondpapillomavirinae, Sedoreovirinae, Sepvirinae, Serpentovirinae, Simarterivirinae, Skryabinvirinae, Slopekvirinae, Spinareovirinae, Spounavirinae, Spumaretrovirinae, Studiervirinae, Tatarstanvirinae, Tempevirinae, Tevenvirinae, Tiamatvirinae, Torovirinae, Trabyvirinae, Trivirinae, Tunavirinae, Tunicanivirinae, Twarogvirinae, Twortvirinae, Tybeckvirinae, Variarterivirinae, Vequintavirinae, Zealarterivirinae, or any combination thereof.

[207] In some disclosures, compositions and methods of the disclosure utilize candidate heterologous gene effectors from viruses with a high degree of documented transcriptional regulator modularity, such as, for example, the poxviridae, Herpesviridae, or Adenoviridae families. In some disclosures, heterologous gene effectors from viruses with a high degree of documented transcriptional regulator modularity can be useful in combination with other gene effectors, for example, can be more likely to facilitate combinatorial or synergistic effects on gene transcription.

[208] Without wishing to be bound by any particular theory, viral effectors may confer advantages of compact size and novel functional properties compared to gene effectors from alternate sources. GUIDE MOIETIES

[209] Compositions and methods of the disclosure can utilize guide moieties to direct a heterologous gene effector to a target gene (e.g., target endogenous gene) or a target gene regulatory sequence. A guide moiety can confer an ability to recognize and specifically bind to the target gene or the target gene regulatory sequence.

[210] A guide moiety can comprise a guide nucleic acid. A guide moiety can comprise a nuclease and a guide nucleic acid as disclosed herein. A guide moiety can comprise a nuclease or a part thereof, for example, an endonuclease, such as a heterologous endonuclease. The nuclease can be, e.g., a DNA nuclease and / or RNA nuclease, a modified nuclease that is nuclease-deficient or has reduced nuclease activity compared to a wild-type nuclease, a derivative thereof, a variant thereof, or a fragment thereof. In some embodiments, the guide moiety has minimal nuclease activity.

[211] Any suitable nuclease, fragment or derivative thereof can be used in a guide moiety. Suitable nucleases include, but are not limited to, CRISPR-associated (Cas) proteins or Cas nucleases including type I CRISPR-associated (Cas) polypeptides, type II CRISPR-associated (Cas) polypeptides, type III CRISPR-associated (Cas) polypeptides, type IV CRISPR-associated (Cas) polypeptides, type V CRISPR-associated (Cas) polypeptides, and type VI CRISPR-associated (Cas) polypeptides; zinc finger nucleases (ZFN); transcription activator-like effector nucleases (TALEN); meganucleases; RNA-binding proteins (RBP); CRISPR-associated RNA binding proteins; recombinases; flippases; transposases; Argonaute (Ago) proteins (e.g., prokaryotic Argonaute (pAgo), archaeal Argonaute (aAgo), and eukaryotic Argonaute (eAgo)); any derivative thereof; any variant thereof and any fragment thereof.

[212] In some embodiments, the guide moiety comprises a DNA nuclease such as an engineered (e.g., programmable or targetable) DNA nuclease that is nuclease-deficient. In some embodiments, the guide moiety comprises a nuclease-null DNA binding protein derived from a DNA nuclease that does not induce transcriptional activation or repression of a target DNA sequence unless it is present in a complex with one or more heterologous gene effectors of the disclosure. In some embodiments, the guide moiety comprises a nuclease-null DNA binding protein derived from a DNA nuclease that can induce transcriptional activation or repression of a target DNA sequence (e.g., which can be altered or augmented by the presence of a heterologous gene effector of the disclosure).

[213] In some embodiments, the guide moiety comprises an RNA nuclease such as an engineered (e.g., programmable or targetable) RNA nuclease. In some embodiments, the guide moiety comprises a nuclease-null RNA binding protein derived from an RNA nuclease that does not induce transcriptional activation or repression of a target RNA sequence unless it is present in a complex with one or more heterologous gene effectors of the disclosure. In some embodiments, the guide moiety comprises a nuclease-null RNA binding protein derived from a RNA nuclease that can induce transcriptional activation or repression of a target RNA sequence -46- (e.g., which can be altered or augmented by the presence of a heterologous gene effector of the disclosure).

[214] In some embodiments, the guide moiety comprises a nucleic acid-guided targeting system. In some embodiments, the guide moiety comprises a DNA-guided targeting system. In some embodiments, the guide moiety comprises an RNA-guided targeting system. A guide moiety can comprise and utilize, for example, a guide nucleic acid sequence that facilitates specific binding of a CRISPR-Cas system (e.g., a nuclease deficient form thereof, such as dCas9) to a target gene (e.g., target endogenous gene) or target gene regulatory sequence. Binding specificity can be determined by use of a guide nucleic acid, such as a single guide RNA (sgRNA) or a part thereof. In some embodiments, the use of different sgRNAs allows the compositions and methods of the disclosure to be used with (e.g., targeted to) different target genes (e.g., target endogenous genes) or target gene regulatory sequences.

[215] Prokaryotic CRISPR-Cas (Clustered regularly interspaced short palindromic repeats-CRISPR associated) systems, for example, Class II CRISPR-Cas systems such as Cas9 and Cpfl, can be repurposed as a tool for regulation of gene expression, epigenome editing, and chromatin looping in compositions and methods of the disclosure. Nuclease-deactivated Cas (dCas) proteins complexed with heterologous gene effectors can allow for regulation of expression of target genes (e.g., target endogenous genes) adjacent to a site bound by the dCas.

[216] In some embodiments, the guide moiety comprises a CRISPR-associated (Cas) protein or a Cas nuclease that functions in a non-naturally occurring CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) / Cas (CRISPR-associated) system. In bacteria, this system can provide adaptive immunity against foreign DNA.

[217] In a wide variety of organisms including diverse mammals, animals, plants, microbes, and yeast, a CRISPR / Cas system (e.g., modified and / or unmodified) can be utilized as a genome engineering tool, or can be modified to direct specific binding of engineered proteins to target loci as disclosed herein. A CRISPR / Cas system can comprise a guide nucleic acid such as a guide RNA (gRNA) complexed with a Cas protein for targeted regulation of gene expression and / or activity or nucleic acid binding. An RNA-guided Cas protein (e.g., a Cas nuclease such as a Cas9 nuclease) can specifically bind a target polynucleotide (e.g., DNA) in a sequencedependent manner. The Cas protein, if possessing nuclease activity, can cleave the DNA.

[218] In some cases, the Cas protein is mutated and / or modified to yield a nuclease deficient protein or a protein with decreased nuclease activity relative to a wild-type Cas protein. A nuclease deficient protein can retain the ability to bind DNA, but may lack or have reduced nucleic acid cleavage activity.

[219] In some embodiments, the guide moiety comprises a Cas protein that forms a complex with a guide nucleic acid, such as a guide RNA or a part thereof. In some embodiments, the guide moiety comprises a Cas protein that forms a complex with a single guide nucleic acid, such as a single guide RNA (sgRNA). In some embodiments, the guide moiety comprises a RNA-binding protein (RBP) optionally complexed with a guide nucleic acid, such as a guide RNA (e.g., sgRNA), which is able to form a complex with a Cas protein. In some embodiments, the guide moiety comprises a nuclease-null DNA binding protein derived from a DNA nuclease that can induce transcriptional activation or repression of a target DNA sequence. In some embodiments, the guide moiety comprises a nuclease-null RNA binding protein derived from a RNA.

[220] A guide nucleic acid used in compositions and methods of the disclosure can be, for example, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, or at least 40 nucleotides.

[221] In some embodiments, a guide nucleic acid used in compositions and methods of the disclosure is at most at most 10, at most 11, at most 12, at most 13, at most 14, at most 15, at most 16, at most 17, at most 18, at most 19, at most 20, at most 21, at most 22, at most 23, at most 24, at most 25, at most 26, at most 27, at most 28, at most 29, at most 30, at most 31, at most 32, at most 33, at most 34, at most 35, at most 36, at most 37, at most 38, at most 39, or at most 40 nucleotides.

[222] In some embodiments, a guide nucleic acid used in compositions and methods of the disclosure is between about 8 and about 40 nucleotides, between about 10 and about 40 nucleotides, between about 11 and about 40 nucleotides, between about 12 and about 40 nucleotides, between about 13 and about 40 nucleotides, between about 14 and about 40 nucleotides, between about 15 and about 40 nucleotides, between about 16 and about 40 nucleotides, between about 17 and about 40 nucleotides, between about 18 and about 40 nucleotides, between about 19 and about 40 nucleotides, between about 20 and about 40 nucleotides, between about 22 and about 40 nucleotides, between about 24 and about 40 nucleotides, between about 26 and about 40 nucleotides, between about 28 and about 40 nucleotides, between about 30 and about 40 nucleotides, between about 8 and about 30 nucleotides, between about 10 and about 30 nucleotides, between about 11 and about 30 nucleotides, between about 12 and about 30 nucleotides, between about 13 and about 30 nucleotides, between about 14 and about 30 nucleotides, between about 15 and about 30 -48- nucleotides, between about 16 and about 30 nucleotides, between about 17 and about 30 nucleotides, between about 18 and about 30 nucleotides, between about 19 and about 30 nucleotides, between about 20 and about 30 nucleotides, between about 22 and about 30 nucleotides, between about 24 and about 30 nucleotides, between about 26 and about 30 nucleotides, between about 28 and about 30 nucleotides, between about 8 and about 25 nucleotides, between about 10 and about 25 nucleotides, between about 11 and about 25 nucleotides, between about 12 and about 25 nucleotides, between about 13 and about 25 nucleotides, between about 14 and about 25 nucleotides, between about 15 and about 25 nucleotides, between about 16 and about 25 nucleotides, between about 17 and about 25 nucleotides, between about 18 and about 25 nucleotides, between about 19 and about 25 nucleotides, between about 20 and about 25 nucleotides, between about 22 and about 25 nucleotides, between about 24 and about 25 nucleotides, between about 8 and about 20 nucleotides, between about 10 and about 20 nucleotides, between about 11 and about 20 nucleotides, between about 12 and about 20 nucleotides, between about 13 and about 20 nucleotides, between about 14 and about 20 nucleotides, between about 15 and about 20 nucleotides, between about 16 and about 20 nucleotides, between about 17 and about 20 nucleotides, between about 18 and about 20 nucleotides, between about 19 and about 20 nucleotides, between about 8 and about 18 nucleotides, between about 10 and about 18 nucleotides, between about 11 and about 18 nucleotides, between about 12 and about 18 nucleotides, between about 13 and about 18 nucleotides, between about 14 and about 18 nucleotides, between about 15 and about 18 nucleotides, between about 16 and about 18 nucleotides, between about 8 and about 16 nucleotides, between about 10 and about 16 nucleotides, between about 11 and about 16 nucleotides, between about 12 and about 16 nucleotides, between about 13 and about 16 nucleotides, between about 14 and about 16 nucleotides, or between about 15 and about 16 nucleotides.

[223] A guide nucleic acid can be a guide RNA or a part thereof.

[224] Any suitable CRISPR / Cas system can be used. A CRISPR / Cas system can be referred to using a variety of naming systems. A CRISPR / Cas system can be a type I, a type II, a type III, a type IV, a type V, a type VI system, or any other suitable CRISPR / Cas system. A CRISPR / Cas system as used herein can be a Class 1, Class 2, or any other suitably classified CRISPR / Cas system. Class 1 or Class 2 determination can be based upon the genes encoding the effector module. Class 1 systems generally have a multi-subunit crRNA-effector complex, whereas Class 2 systems generally have a single protein, such as Cas9, Cpfl, C2c1, C2c2, C2c3 or a crRNA-effector complex. A Class 1 CRISPR / Cas system can use a complex of multiple Cas proteins to effect regulation. A Class 1 CRISPR / Cas system can comprise, for example, type I (e.g., I, IA, -49- IB, IC, ID, IE, IF, IU), type III (e.g., III, IIIA, IIIB, IIIC, IIID), and type IV (e.g., IV, IVA, IVB) CRISPR / Cas type. A Class 2 CRISPR / Cas system can use a single large Cas protein to effect regulation. A Class 2 CRISPR / Cas systems can comprise, for example, type II (e.g., II, IIA, IIB) and type V CRISPR / Cas type. CRISPR systems can be complementary to each other, and / or can lend functional units in trans to facilitate CRISPR locus targeting.

[225] A guide moiety disclosed herein can comprise a nuclease, for instance, a heterologous nuclease (e.g., a Cas protein that is operatively coupled to a heterologous gene effector). The nuclease can have a length that is less than a threshold length. The threshold length can be at most about 1,000 amino acids, at most about 950 amino acids, at most about 900 amino acids, at most about 850 amino acids, at most about 800 amino acids, at most about 750 amino acids, at most about 700 amino acids, at most about 650 amino acids, at most about 600 amino acids, at most about 550 amino acids, at most about 500 amino acids, at most about 450 amino acids, at most about 400 amino acids, at most about 350 amino acids, or at most about 300 amino acids. The threshold length can be at least about 300 amino acids, at least about 350 amino acids, at least about 400 amino acids, at least about 450 amino acids, at least about 500 amino acids, at least about 550 amino acids, at least about 600 amino acids, at least about 650 amino acids, at least about 700 amino acids, at least about 750 amino acids, at least about 800 amino acids, at least about 850 amino acids, at least about 900 amino acids, at least about 950 amino acids, or at least about 1,000 amino acids.

[226] When a guide moiety comprises a Cas protein or derivative thereof, the Cas protein or derivative thereof can be a Class 1 or a Class 2 Cas protein. A Cas protein can be a type I, type II, type III, type IV, type V Cas protein, or type VI Cas protein. A Cas protein can comprise one or more domains. Non-limiting examples of domains include, guide nucleic acid recognition and / or binding domain, nuclease domains (e.g., DNase or RNase domains, RuvC, HNH), DNA binding domain, RNA binding domain, helicase domains, protein-protein interaction domains, and dimerization domains. A guide nucleic acid recognition and / or binding domain can interact with a guide nucleic acid. A nuclease domain can comprise catalytic activity for nucleic acid cleavage. A nuclease domain can lack catalytic activity to prevent nucleic acid cleavage. A Cas protein can be a chimeric Cas protein or fragment thereof that is fused to other proteins or polypeptides. A Cas protein can be a chimera of various Cas proteins, for example, comprising domains from different Cas proteins.

[227] Non-limiting examples of Cas proteins include c2c1, C2c2, c2c3, Casl, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5e (CasD), Cash, Cas6e, Cas6f, Cas7, Cas8a, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9 (Csnl or Csx12), Cas10, CaslOd, Cas10, Cas12a, CaslOd, CasF, CasG, CasH, Cpfl, Csyl, Csy2, Csy3, Csel (CasA), Cse2 (CasB), Cse3 (CasE), Cse4 (CasC), Cscl, Csc2, Csa5, -50- Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csxl, Csx15, Csfl, Csf2, Csf3, Csf4, Cul966, Cas13a, Cas13b, Cas13c, Cas13d, Cas13X, Cas13Y, and homologs or modified versions thereof.

[228] In some cases, the Cas protein as disclosed herein may not and need not be Cas9 or Cas12a. The Cas protein as disclosed herein can have a smaller size as compared to Cas9 or Cas12a. The Cas protein as disclosed herein can be derived from Un1Cas12f1 (or Cas14a1). For example, the Cas protein as disclosed herein can comprise an amino acid sequence that is at least about 50%, at least about 60%, at least about 70%, at least about 75% at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or substantially about 100% identical to the polypeptide sequence of SEQ ID NO: 50050. In another example, the Cas protein as disclosed herein can comprise an amino acid sequence that is at least about 50%, at least about 60%, at least about 70%, at least about 75% at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or substantially about 100% identical to the polypeptide sequence of SEQ ID NO: 50051. As disclosed herein, SEQ ID NO: 50050 encodes the polypeptide sequence of Un1Cas12f1 (or Cas14a1). As disclosed herein, SEQ ID NO: 50051 encodes an engineered variant of Un1Cas12f1 with reduced nuclease activity. In some embodiments, Un1Cas12f1 or a derivative thereof, such as an engineered variant of Un1Cas12f1 with reduced nuclease activity, can be referred to as CasMini or dCasMini.

[229] TABLE 1: illustrative Cas sequences TABLE 1 SEQ ID NO: Description Sequence 50050 Un1Cas12f1 MAKNTITKTLKLRIVRPYNSAEVEKIVADEKNNREKIALEKNK DKVKEACSKHLKVAAYCTTQVERNACLFCKARKLDDKFYQK LRGQFPDAVFWQEISEIFRQLQKQAAEIYNQSLIELYYEIFIKGK GIANASSVEHYLSDVCYTRAAELFKNAAIASGLRSKIKSNFRLK ELKNMKSGLPTTKSDNFPIPLVKQKGGQYTGFEISNHNSDFIIKI PFGRWQVKKEIDKYRPWEKFDFEQVQKSPKPISLLLSTQRRKR NKGWSKDEGTEAEIKKVMNGDYQTSYIEVKRGSKIGEKSAW MLNLSIDVPKIDKGVDPSIIGGIDVGVKSPLVCAINNAFSRYSIS DNDLFHFNKKMFARRRILLKKNRHKRAGHGAKNKLKPITILTE KSERFRKKLIERWACEIADFFIKNKVGTVQMENLESMKRKEDS YFNIRLRGFWPYAEMQNKIEFKLKQYGIEIRKVAPNNTSKTCS KCGHLNNYFNFEYRKKNKFPHFKCEKCNFKENADYNAALNIS NPKLKSTKEEP 50051 deactivated nuclease variant of Un1Cas12f1 MAKNTITKTLKLRIVRPYNSAEVEKIVADEKNNREKIALEKNK DKVKEACSKHLKVAAYCTTQVERNACLFCKARKLDDKFYQK LRGQFPDAVFWQEISEIFRQLQKQAAEIYNQSLIELYYEIFIKGK GIANASSVEHYLSRVCYRRAAELFKNAAIASGLRSKIKSNFRLK ELKNMKSGLPTTKSDNFPIPLVKQKGGQYTGFEISNHNSDFIIKI PFGRWQVKKEIDKYRPWEKFDFEQVQKSPKPISLLLSTQRRKR NKGWSKDEGTEAEIKKVMNGDYQTSYIEVKRGSKICEKSAW MLNLSIDVPKIDKGVDPSIIGGIAVGVRSPLVCAINNAFSRYSIS DNDLFHFNKKMFARRRILLKKNRHKRAGHGAKNKLKPITILTE KSERFRKKLIERWACEIADFFIKNKVGTVQMENLESMKRKEDS YFNIRLRGFWPYAEMQNKIEFKLKQYGIEIRKVAPNNTSKTCS KCGHLNNYFNFEYRKKNKFPHFKCEKCNFKENAAYNAALNIS NPKLKSTKERP

[230] A Cas protein or fragment or derivative thereof can be from any suitable organism. Nonlimiting examples include Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Staphylococcus aureus, Nocardiopsis dassonvillei, Streptomyces pristinae spiralis, Streptomyces viridochromo genes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, AlicyclobacHlus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaromonas nap hthalenivorans, Polaromonas sp., Crocosphaera watsonii, Cyanothece sp., Microcystis aeruginosa, Pseudomonas aeruginosa, Synechococcus sp., Acetohalobium arabaticum, Ammonifex degensii, Caldicelulosiruptor becscii, Candidatus Desulforudis, Clostridium botulinum, Clostridium difficile, Finegoldia magna, Natranaerobius thermophilus, Pelotomaculum thermopropionicum, Acidithiobacillus caldus, Acidithiobacillus ferrooxidans, Allochromatium vinosum, Marinobacter sp., Nitrosococcus halophilus, Nitrosococcus watsoni, Pseudoalteromonas haloplanktis, Ktedonobacter racemifer, Methanohalobium evestigatum, Anabaena variabilis, Nodularia spumigena, Nostoc sp., Arthrospira maxima, Arthrospira platensis, Arthrospira sp., Lyngbya sp., Microcoleus chthonoplastes, Oscillatoria sp., Petrotoga mobilis, Thermosipho africanus, Acaryochloris marina, Leptotrichia shahii, and Francisella novicida. In some aspects, the organism is Streptococcus pyogenes (S. pyogenes). In some aspects, the organism is Staphylococcus aureus (S. aureus). In some aspects, the organism is Streptococcus thermophilus (S. thermophilus).

[231] A Cas protein can be derived from a variety of bacterial species including, but not limited to, Veillonella atypical, Fusobacterium nucleatum, Filifactor alocis, Solobacterium moorei, Coprococcus catus, Treponema denticola, Peptoniphilus duerdenii, Catenibacterium mitsuokai, Streptococcus mutans, Listeria innocua, Staphylococcus pseudintermedius, Acidaminococcus intestine, Olsenella uli, Oenococcus kitaharae, Bifidobacterium bifidum, Lactobacillus rhamnosus, Lactobacillus gasseri, Finegoldia magna, Mycoplasma mobile, Mycoplasma gallisepticum, Mycoplasma ovipneumoniae, Mycoplasma canis, Mycoplasma synoviae, Eubacterium rectale, Streptococcus thermophilus, Eubacterium dolichum, Lactobacillus coryniformis subsp. Torquens, Ilyobacter polytropus, Ruminococcus albus, Akkermansia muciniphila, Acidothermus cellulolyticus, Bifidobacterium longum, Bifidobacterium dentium, Corynebacterium diphtheria, Elusimicrobium minutum, Nitratifractorsalsuginis, Sphaerochaeta globus, Fibrobacter succinogenes subsp. Succinogenes, Bacteroides fragilis, Capnocytophaga ochracea, Rhodopseudomonas palustris, Prevotella micans, Prevotella ruminicola, Flavobacterium columnare, Aminomonas paucivorans, Rhodospirillum rubrum, Candidatus Puniceispirillum marinum, Verminephrobacter eiseniae, Ralstonia syzygii, Dinoroseobacter shibae, Azospirillum, Nitrobacter hamburgensis, Bradyrhizobium, Wolinellasuccinogenes, Campylobacter jejuni subsp. Jejuni, Helicobacter mustelae, Bacillus cereus, Acidovorax ebreus, Clostridium perfringens, Parvibaculum lavamentivorans, Roseburia intestinalis, Neisseria meningitidis, Pasteurella multocida subsp. Multocida, Sutterella wadsworthensis, proteobacterium, Legionella pneumophila, Parasutterella excrementihominis, Wolinella succinogenes, and Francisella novicida.

[232] A Cas protein as used herein can be a wildtype or a modified form of a Cas protein. A Cas protein can be an active variant, inactive variant, or fragment of a wild type or modified Cas protein. A Cas protein can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof relative to a wildtype version of the Cas protein. A Cas protein can be a polypeptide with at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity or sequence similarity to a wild type Cas protein. A Cas protein can be a polypeptide with at most about 5%, at most about 10%, at most about 20%, at most about 30%, at most about 40%, at most about 50%, at most about 60%, at most about 70%, at most about 80%, at most about 90%, or at most about 100% sequence identity and / or sequence similarity to a wild type exemplary Cas protein. Variants or fragments can comprise at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity or sequence similarity to a wild type or modified Cas protein or a portion thereof. Variants or fragments can be targeted to a nucleic acid locus in complex with a guide nucleic acid while lacking nucleic acid cleavage activity.

[233] A Cas protein can comprise one or more nuclease domains, such as DNase domains. For example, a Cas9 protein can comprise a RuvC-like nuclease domain and / or an HNH-like 20 nuclease domain. The in a nuclease active form of Cas9, RuvC and HNH domains can each cut a different strand of double-stranded DNA to make a double-stranded break in the DNA. A Cas protein can comprise only one nuclease domain (e.g., Cpfl comprises RuvC domain but lacks HNH domain). In some embodiments, nuclease domains are absent. In some embodiments, nuclease domains are present but inactive or have reduced or minimal activity. In some embodiments, nuclease domains are present and active.

[234] One or a plurality of the nuclease domains (e.g., RuvC, HNH) of a Cas protein can be deleted or mutated so that they are no longer functional or comprise reduced nuclease activity. For example, in a Cas protein comprising at least two nuclease domains (e.g., Cas9), if one of the nuclease domains is deleted or mutated, the resulting Cas protein, known as a nickase, can generate a single-strand break at a CRISPR RNA (crRNA) recognition sequence within a double- stranded DNA but not a double-strand break. Such a nickase can cleave the complementary strand or the non-complementary strand, but may not cleave both. If all of the nuclease domains of a Cas protein (e.g., both RuvC and HNH nuclease domains in a Cas9 protein; RuvC nuclease domain in a Cpfl protein) are deleted or mutated, the resulting Cas protein can have a reduced or no ability to cleave both strands of a double-stranded DNA. An example of a mutation that can convert a Cas9 protein into a nickase is a D10A (aspartate to alanine at position 10 of Cas9) mutation in the RuvC domain of Cas9 from S. pyogenes. H939A (histidine to alanine at amino acid position 839) or H840A (histidine to alanine at amino acid position 840) in the HNH domain of Cas9 from S. pyogenes can convert the Cas9 into a nickase. An example of a mutation that can convert a Cas9 protein into a dead Cas9 is a D10A (aspartate to alanine at position 10 of Cas9) mutation in the RuvC domain and H939A (histidine to alanine at amino acid position 839) or H840A (histidine to alanine at amino acid position 840) in the HNH domain of Cas9 from S. pyogenes.

[235] A nuclease dead Cas protein can comprise one or more mutations relative to a wild-type version of the protein. The mutation can result in no more than 90%, no more than 80%, no more than 70%, no more than 60%, no more than 50%, no more than 40%, no more than 30%, no more than 20%, no more than 10%, no more than 5%, or no more than 1% of the nucleic acidcleaving activity in one or more of the plurality of nucleic acid-cleaving domains of the wildtype Cas protein. The mutation can result in one or more of the plurality of nucleic acid-cleaving domains retaining the ability to cleave the complementary strand of the target nucleic acid but reducing its ability to cleave the non-complementary strand of the target nucleic acid. The mutation can result in one or more of the plurality of nucleic acid-cleaving domains retaining the -54- ability to cleave the non-complementary strand of the target nucleic acid but reducing its ability to cleave the complementary strand of the target nucleic acid. The mutation can result in one or more of the plurality of nucleic acid-cleaving domains lacking the ability to cleave the complementary strand and the non-complementary strand of the target nucleic acid. The residues to be mutated in a nuclease domain can correspond to one or more catalytic residues of the nuclease. For example, residues in the wild type exemplary S. pyogenes Cas9 polypeptide such as Asp10, His840, Asn854 and Asn856 can be mutated to inactivate one or more of the plurality of nucleic acid-cleaving domains (e.g., nuclease domains). The residues to be mutated in a nuclease domain of a Cas protein can correspond to residues Asp10, His840, Asn854 and Asn856 in the wild type S. pyogenes Cas9 polypeptide, for example, as determined by sequence and / or structural alignment.

[236] As non-limiting examples, residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and / or A987 (or the corresponding mutations of any of the Cas proteins) can be mutated. For example, e.g., D 10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and / or D986A. Mutations other than alanine substitutions can be suitable.

[237] A D10A mutation can be combined with one or more of H840A, N854A, or N856A mutations to produce a Cas9 protein substantially lacking DNA cleavage activity (e.g., a dead Cas9 protein). A H840A mutation can be combined with one or more of D10A, N854A, or N856A mutations to produce a site-directed polypeptide substantially lacking DNA cleavage activity. An N854A mutation can be combined with one or more of H840A, D1OA, or N856A mutations to produce a site-directed polypeptide substantially lacking DNA cleavage activity. A N856A mutation can be combined with one or more of H840A, N854A, or D10A mutations to produce a site-directed polypeptide substantially lacking DNA cleavage activity.

[238] In some embodiments, a Cas protein is a Class 2 Cas protein. In some embodiments, a Cas protein is a type II Cas protein. In some embodiments, the Cas protein is a Cas9 protein, a modified version of a Cas9 protein, or derived from a Cas9 protein. For example, a Cas9 protein lacking cleavage activity. In some embodiments, the Cas9 protein is a Cas9 protein from S. pyogenes (e.g., SwissProt accession number Q99ZW2). In some embodiments, the Cas9 protein is a Cas9 from S. aureus (e.g., SwissProt accession number J7RUA5). In some embodiments, the Cas9 protein is a modified version of a Cas9 protein from S. pyogenes or S. Aureus. In some embodiments, the Cas9 protein is derived from a Cas9 protein from S. pyogenes or S. Aureus. For example, a S. pyogenes or S. Aureus Cas9 protein lacking cleavage activity.

[239] In some embodiments, Cas9 can generally refer to a polypeptide with at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, or about -55- 100% sequence identity and / or sequence similarity to a wild type exemplary Cas9 polypeptide (e.g., Cas9 from S. pyogenes). In some embodiments, Cas9 can refer to a polypeptide with at most about 5%, at most about 10%, at most about 20%, at most about 30%, at most about 40%, at most about 50%, at most about 60%, at most about 70%, at most about 80%, at most about 90%, or about 100% sequence identity and / or sequence similarity to a wild type Cas9 polypeptide (e.g., from S. pyogenes). Cas9 can refer to the wildtype or a modified form of the Cas9 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.

[240] A Cas protein can comprise an amino acid sequence having at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% sequence identity or sequence similarity to a nuclease domain (e.g., RuvC domain, HNH domain) of a wild-type Cas protein.

[241] A Cas protein, variant or derivative thereof can be modified to enhance regulation of gene expression by compositions and methods of the disclosure, e.g., as part of a complex disclosed herein. A Cas protein can be modified to increase or decrease nucleic acid binding affinity, nucleic acid binding specificity, enzymatic activity, and / or binding to other factors, such as heterodimerization or oligomerization domains and induce ligands. Cas proteins can also be modified to change any other activity or property of the protein, such as stability. For example, one or more nuclease domains of the Cas protein can be modified, deleted, or inactivated, or a Cas protein can be truncated to remove domains that are not essential for the desired function of the protein or complex. A Cas protein can be modified to modulate (e.g., enhance or reduce) the activity of the Cas protein for regulating gene expression by a complex of the disclosure that comprises a heterologous gene effector.

[242] For example, a Cas protein can be coupled (e.g., fused, covalently coupled, or non-covalently coupled) to a heterologous gene effector (e.g., an epigenetic modification domain, a transcriptional activation domain, and / or a transcriptional repressor domain). A Cas protein can be coupled (e.g., fused, covalently coupled, or non-covalently coupled) to an oligomerization or dimerization domain as disclosed herein (e.g., a heterodimerization domain). A Cas protein can be coupled (e.g., fused, covalently coupled, or non-covalently coupled) to a heterologous polypeptide that provides increased or decreased stability. A Cas protein can be coupled (e.g., fused, covalently coupled, or non-covalently coupled) to a sequence that can facilitate degradation of the Cas protein or a complex containing the Cas protein, for example, a degron, such as an inducible degron (e.g., auxin inducible).

[243] A Cas protein can be coupled (e.g., fused, covalently coupled, or non-covalently coupled) to any suitable number of partners, for example, at least one, at least two, at least three, at least four, or at least five, at least six, at least seven, or at least 8 partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to at most two, at most three, at most four, at most five, at most six, at most seven, at most eight, or at most ten partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to 1 - 5, 1 - 4, 1 - 3, 1 - 2, 2 - 5, 2 - 4, 2 - 3, 3 - 5, 3 - 4, or 4 - 5 partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to one partner. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to two partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to three partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to four partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to five partners. In some embodiments, a Cas protein of the disclosure is coupled (e.g., fused, covalently coupled, or non-covalently coupled) to six partners.

[244] A Cas protein can be a fusion protein. The fused domain or heterologous polypeptide (e.g., heterologous gene effector) can be located at the N-terminus, the C-terminus, or internally within the Cas protein.

[245] A Cas protein can be provided in any form. For example, a Cas protein can be provided in the form of a protein, such as a Cas protein alone or complexed with a guide nucleic acid as a ribonucleoprotein. A Cas protein can be provided in a complex, for example, complexed with a guide nucleic acid and / or one or more heterologous gene effectors of the disclosure. A Cas protein can be provided in the form of a nucleic acid encoding the Cas protein, such as an RNA (e.g., messenger RNA (mRNA)), or DNA. The nucleic acid encoding the Cas protein can be codon optimized for efficient translation into protein in a particular cell or organism.

[246] Nucleic acids encoding Cas proteins, fragments, or derivatives thereof can be stably integrated in the genome of a cell. Nucleic acids encoding Cas proteins can be operably linked to a promoter, for example, a promoter that is constitutively or inducibly active in the cell. Nucleic acids encoding Cas proteins can be operably linked to a promoter in an expression construct. Expression constructs can include any nucleic acid constructs capable of directing expression of a gene or other nucleic acid sequence of interest (e.g., a Cas gene) and which can transfer such a nucleic acid sequence of interest to a target cell.

[247] In some embodiments, a Cas protein, variant or derivative thereof is a nuclease dead Cas (dCas) protein. A dead Cas protein can be a protein that lacks nucleic acid cleavage activity.

[248] A Cas protein can comprise a modified form of a wild type Cas protein. The modified form of the wild type Cas protein can comprise an amino acid change (e.g., deletion, insertion, or substitution) that reduces the nucleic acid-cleaving activity of the Cas protein. For example, the modified form of the Cas protein can have no more than 90%, no more than 80%, no more than 70%, no more than 60%, no more than 50%, no more than 40%, no more than 30%, no more than 20%, no more than 10%, no more than 5%, or no more than 1% of the nucleic acid-cleaving activity of the wild-type Cas protein (e.g., Cas9 from S. pyogenes). The modified form of Cas protein can have no substantial nucleic acid-cleaving activity. When a Cas protein is a modified form that has no substantial nucleic acid-cleaving activity, it can be referred to as enzymatically inactive, “deactivated” and / or “dead” (abbreviated by “d”). A dead Cas protein (e.g., dCas, dCas9) can bind to a target polynucleotide but may not cleave or minimally cleaves the target polynucleotide. In some aspects, a dead Cas protein is a dead Cas9 protein.

[249] A dCas9 polypeptide can associate with a single guide RNA (sgRNA) to activate or repress transcription of a target gene (e.g., target endogenous gene), for example, in combination with heterologous gene effector(s) disclosed herein. sgRNAs can be introduced into cells expressing the Cas or guide moiety component of the disclosure. In some cases, such cells can contain one or more different sgRNAs that target the same target gene (e.g., target endogenous gene) or target gene regulatory sequence. In other cases, the sgRNAs target different nucleic acids in the cell (e.g., different target genes, different target gene regulatory sequences, or different sequences within the same target gene or target gene regulatory sequence).

[250] Enzymatically inactive can refer to a nuclease that can bind to a nucleic acid sequence in a polynucleotide in a sequence-specific manner, but will not cleave a target polynucleotide or will cleave it at a substantially reduced frequency. An enzymatically inactive guide moiety can comprise an enzymatically inactive domain (e.g. nuclease domain). Enzymatically inactive can refer to no activity. Enzymatically inactive can refer to substantially no activity. Enzymatically inactive can refer to essentially no activity. Enzymatically inactive can refer to an activity no more than 1%, no more than 2%, no more than 3%, no more than 4%, no more than 5%, no more than 6%, no more than 7%, no more than 8%, no more than 9%, or no more than 10% activity compared to a comparable wild-type activity (e.g., nucleic acid cleaving activity, wild-type Cas9 activity).

[251] In some embodiments, the guide moiety does not contain a nucleic acid-guided targeting system. For example, guide moieties can include proteins that bind to a target gene (e.g., target endogenous gene) or target gene regulatory sequence based on protein structural features, such as certain nucleases disclosed herein.

[252] In some embodiments, a guide moiety comprises a zinc finger nuclease (ZFN) or a variant, fragment, or derivative thereof. ZFN can refer to a fusion between a cleavage domain, such as a cleavage domain of Fokl, and at least one zinc finger motif (e.g., at least 2, at least 3, at least 4, or at least 5 zinc finger motifs) which can bind polynucleotides such as DNA and RNA. In some embodiments, a ZFN is used in a targeting moiety of the disclosure to bind a polynucleotide (e.g., target gene or target gene regulatory sequence), but the ZFN does not cleave or substantially does not cleave the polynucleotide, e.g., a nuclease dead ZFN. A ZFN or a variant, fragment, or derivative thereof can be fused to or associated with one of more heterologous gene effectors to form a complex of the disclosure.

[253] The heterodimerization at certain positions in a polynucleotide of two individual ZFNs in certain orientation and spacing can lead to cleavage of the polynucleotide in nuclease-active ZFN. For example, a ZFN binding to DNA can induce a double-strand break in the DNA. In order to allow two cleavage domains to dimerize and cleave DNA, two individual ZFNs can bind opposite strands of DNA with their C-termini at a certain distance apart. In some cases, linker sequences between the zinc finger domain and the cleavage domain can require the 5' edge of each binding site to be separated by about 5-7 base pairs. In some cases, a cleavage domain is fused to the C-terminus of each zinc finger domain.

[254] In some embodiments, the cleavage domain of a guide moiety comprising a ZFN comprises a modified form of a wild type cleavage domain. The modified form of the cleavage domain can comprise an amino acid change (e.g., deletion, insertion, or substitution) that reduces the nucleic acid-cleaving activity of the cleavage domain. For example, the modified form of the cleavage domain can have no more than 90%, no more than 80%, no more than 70%, no more than 60%, no more than 50%, no more than 40%, no more than 30%, no more than 20%, no more than 10%, no more than 5%, or no more than 1% of the nucleic acid-cleaving activity of the corresponding wild-type cleavage domain. The modified form of the cleavage domain can have no substantial nucleic acid-cleaving activity. In some embodiments, the cleavage domain is enzymatically inactive.

[255] In some embodiments, a guide moiety comprises a “TALEN” or “TAL-effector nuclease” or a variant, fragment, or derivative thereof. TALENs refer to engineered transcription activator-like effector nucleases that generally contain a central domain of DNA-binding tandem repeats and a cleavage domain. TALENs can be produced by fusing a TAL effector DNA -59- binding domain to a DNA cleavage domain. In some cases, a DNA-binding tandem repeat comprises 33-35 amino acids in length and contains two hypervariable amino acid residues at positions 12 and 13 that can recognize at least one specific DNA base pair. A transcription activator-like effector (TALE) protein can be fused to a nuclease such as a wild-type or mutated Fok1 endonuclease or the catalytic domain of Fok1. In some embodiments, a TALEN is used in a targeting moiety of the disclosure to bind a polynucleotide (e.g., target gene or target gene regulatory sequence), but the TALEN does not cleave or substantially does not cleave the polynucleotide, e.g., a nuclease dead TALEN. A TALEN or a variant, fragment, or derivative thereof can be fused to or associated with one of more heterologous gene effectors to form a complex of the disclosure.

[256] In some embodiments, a TALEN is engineered for reduced nuclease activity. In some embodiments, the nuclease domain of a TALEN comprises a modified form of a wild type nuclease domain. The modified form of the nuclease domain can comprise an amino acid change (e.g., deletion, insertion, or substitution) that reduces the nucleic acid-cleaving activity of the nuclease domain. For example, the modified form of the nuclease domain can have no more than 90%, no more than 80%, no more than 70%, no more than 60%, no more than 50%, no more than 40%, no more than 30%, no more than 20%, no more than 10%, no more than 5%, or no more than 1% of the nucleic acid-cleaving activity of the wild-type nuclease domain. The modified form of the nuclease domain can have no substantial nucleic acid-cleaving activity. In some embodiments, the nuclease domain is enzymatically inactive. A TALEN or a variant, fragment, or derivative thereof can be fused to or associated with one of more heterologous gene effectors to form a complex of the disclosure.

[257] Several mutations to Fok1 have been made for its use in TALENs, which, for example, improve cleavage specificity or activity. Such TALENs can be engineered to bind any desired DNA sequence. TALENs can be used to generate gene modifications (e.g., nucleic acid sequence editing) by creating a double-strand break in a target DNA sequence, which in turn, undergoes NHEJ or HDR.

[258] A TALE or a variant, fragment, or derivative thereof can be fused to or associated with one of more heterologous gene effectors to form a complex of the disclosure. In some embodiments, the transcription activator-like effector (TALE) protein is fused to a heterologous gene effector and does not comprise a nuclease. In some embodiments, a TALEN does not cleave or substantially does not cleave the polynucleotide, e.g., a nuclease dead TALE. A TALE or a variant, fragment, or derivative thereof can be fused to or associated with one of more heterologous gene effectors to form a complex of the disclosure.

[259] In some embodiments, the complex of the transcription activator-like effector (TALE) protein and the heterologous gene effector is designed to function as a transcriptional activator. In some embodiments, the complex of the transcription activator-like effector (TALE) protein and the heterologous gene effector is designed to function as a transcriptional repressor. For example, the DNA-binding domain of the transcription activator-like effector (TALE) protein can be fused (e.g., linked) to one or more heterologous gene effectors that comprise transcriptional activation domains, or to one or more heterologous gene effectors that comprise transcriptional repression domains.

[260] In some embodiments, a guide moiety comprises a meganuclease. Meganucleases generally refer to rare-cutting endonucleases or homing endonucleases that can be highly sequence specific. Meganucleases can recognize DNA target sites ranging from at least 12 base pairs in length, e.g., from 12 to 40 base pairs, 12 to 50 base pairs, or 12 to 60 base pairs in length. Meganucleases can be modular DNA-binding nucleases such as any fusion protein comprising at least one catalytic domain of an endonuclease and at least one DNA binding domain or protein specifying a nucleic acid target sequence. The DNA-binding domain can contain at least one motif that recognizes single- or double-stranded DNA. A nuclease-active meganuclease can generate a double-stranded break. In some embodiments, a meganuclease is used in a targeting moiety of the disclosure to bind a polynucleotide (e.g., target gene or target gene regulatory sequence), but the meganuclease does not cleave or substantially does not cleave the polynucleotide, e.g., a nuclease dead meganuclease. A meganuclease or a variant, fragment, or derivative thereof can be fused to or associated with one of more heterologous gene effectors to form a complex of the disclosure.

[261] The meganuclease can be monomeric or dimeric. In some embodiments, the meganuclease is naturally-occurring (found in nature) or wild-type, and in other instances, the meganuclease is non-natural, artificial, engineered, synthetic, rationally designed, or man-made. In some embodiments, the meganuclease of the present disclosure includes an I-CreI meganuclease, I-CeuI meganuclease, I-Msol meganuclease, I-SceI meganuclease, variants thereof, derivatives thereof, and fragments thereof.

[262] In some embodiments, the nuclease domain of a meganuclease comprises a modified form of a wild type nuclease domain. The modified form of the nuclease domain can comprise an amino acid change (e.g., deletion, insertion, or substitution) that reduces or eliminates the nucleic acid-cleaving activity of the nuclease domain. For example, the modified form of the nuclease domain can have no more than 90%, no more than 80%, no more than 70%, no more than 60%, no more than 50%, no more than 40%, no more than 30%, no more than 20%, no more than 10%, no more than 5%, or no more than 1% of the nucleic acid-cleaving activity of -61- the wild-type nuclease domain. The modified form of the nuclease domain can have no substantial nucleic acid-cleaving activity. In some embodiments, the nuclease domain is enzymatically inactive. In some embodiments, a meganuclease can bind DNA but cannot cleave the DNA. In some embodiments, a nuclease-inactive meganuclease is fused to or associated with one or more heterologous gene effectors to generate a complex of the disclosure.

[263] In some embodiments, the guide moiety can regulate expression and / or activity of a target gene (e.g., target endogenous gene). In some embodiments, the guide moiety can edit the sequence of a nucleic acid (e.g., a gene and / or gene product). A nuclease-active Cas protein can edit a nucleic acid sequence by generating a double-stranded break or single-stranded break in a target polynucleotide.

[264] In some embodiments, a guide moiety comprising a nuclease can generate a doublestrand break in a target polynucleotide, such as DNA. A double-strand break in DNA can result in DNA break repair which allows for the introduction of gene modification(s) (e.g., nucleic acid editing). In some embodiments, a nuclease induces site-specific single-strand DNA breaks or nicks, thus resulting in HDR.

[265] A double-strand break in DNA can result in DNA break repair which allows for the introduction of gene modification(s) (e.g., nucleic acid editing). DNA break repair can occur via non-homologous end joining (NHEJ) or homology-directed repair (HDR). In HDR, a donor DNA repair template or template polynucleotide that contains homology arms flanking sites of the target DNA can be provided.

[266] In some embodiments, a guide moiety or complex comprising a nuclease does not generate a double-strand break in a target polynucleotide, such as DNA. COMPLEXES

[267] Disclosed herein, in some aspects, are complexes that comprise a heterologous gene effector and a guide moiety, for example, a guide nucleic acid and / or a nuclease, such as an endonuclease that lacks or substantially lacks cleavage activity.

[268] Complexes of the disclosure can be useful, for example, for bringing one or more heterologous gene effectors into close proximity with a target gene (e.g., target endogenous gene) or target gene regulatory sequence, thereby facilitating modulation of an expression or activity level of the target gene.

[269] In some embodiments, a complex of the disclosure binds to DNA, e.g., genomic DNA. In some embodiments, a complex of the disclosure binds to RNA, e.g., mRNA, microRNA, siRNA, or non-coding RNA. In some embodiments, a complex of the disclosure binds to DNA and RNA.

[270] In some embodiments, a complex can modulate (e.g., increase or decrease) expression and / or activity of a target gene (e.g., target endogenous gene) by physical obstruction of a polynucleotide sequence (e.g., a promoter, enhancer, repressor, operator, or silencer, insulator, cis-regulatory element, trans-regulatory element, epigenetic modification (e.g., DNA methylation) site, coding sequence).

[271] In some embodiments, a complex can modulate (e.g., increase or decrease) expression and / or activity of a target gene (e.g., target endogenous gene) by recruitment of additional factors effective to suppress or enhance expression of the target gene.

[272] In some embodiments, complexes of the disclosure are used for introducing epigenetic modifications to a target gene (e.g., target endogenous gene) or target gene regulatory sequence (e.g., promoter, enhancer, silencer, insulator, cis-regulatory element, trans-regulatory element, or epigenetic modification (e.g., DNA methylation) site). In some embodiments, complexes of the disclosure are used for producing three-dimensional structures, topologically associating domains, or genomic boundaries comprising a target gene or target gene regulatory sequence (e.g., distal or proximal gene from the target gene).

[273] In some cases, regulation of a target gene (e.g., a target endogenous gene) by a complex as disclosed herein, such as a complex comprising one or more heterologous gene effectors and a guide nucleic acid, may utilize an endogenous target gene regulatory sequence (e.g., promoter, enhancer, repressor, silencer, insulator, cis-regulatory element, trans-regulatory element, epigenetic modification (e.g., DNA methylation) site, etc.) operatively coupled to the target gene. Thus, such regulation of the target gene by the complex may not and need not involve an exogenous, synthetic, and / or heterologous regulatory sequence, such as a promoter, enhancer, repressor, silencer, insulator, cis-regulatory element, trans-regulatory element, epigenetic modification (e.g., DNA methylation) site, etc. that is heterologous with respect to the subject or the host cell. In some embodiments, regulation of the target gene by the complex does not involve use of an engineered inducible system, repressible system, and / or reporter system. In some embodiments, regulation of the target gene by the complex does not involve use of an exogenous, engineered, or synthetic regulatory element, for example, does not involve a response element that is modulated by tetracycline or analogs thereof. In some embodiments, regulation of the target gene by the complex does not involve use of a transactivator or reverse transactivator that functions as part of an engineered inducible system, repressible system, and / or reporter system. In some embodiments, regulation of the target gene by the complex does not involve a Tet off or tTA-dependent system, or a component thereof. In some embodiments, regulation of the target gene by the complex does not involve a Tet On or rtTA-dependent system, or a component thereof.

[274] In some cases, a complex disclosed herein (e.g., a complex comprising one or more heterologous gene effectors and a guide nucleic acid) may be capable of regulating a target gene (e.g., a target endogenous gene) without any further control by a modulating agent, such as an agent that directly or indirectly allows the complex to increase or reduce expression of the target gene. In some embodiments, the complex is capable of regulating the target gene without involvement of a transactivating agent, a reverse transactivating agent, a small molecule, a drug, a chemical inducer of dimerization or multimerization, an additional inducing agent, an additional repressing agent, or any combination thereof. For example, upon introducing the individual complex to the host cell (e.g., expressing and / or transfecting each individual component of the individual complex to the host cell), such introduction may be sufficient to allow the individual complex to regulate expression or activity of the target gene.

[275] In some embodiments, a complex comprises a heterologous gene effector and a guide moiety. In some embodiments, a complex comprises one heterologous gene effector and one guide moiety. In some embodiments, a complex comprises two heterologous gene effectors and one guide moiety. In some embodiments, a complex comprises three or more heterologous gene effectors and one guide moiety.

[276] In some embodiments, a complex comprises a heterologous gene effector and a guide nucleic acid. In some embodiments, a complex comprises one heterologous gene effector and one guide nucleic acid. In some embodiments, a complex comprises two heterologous gene effectors and one guide nucleic acid. In some embodiments, a complex comprises three or more heterologous gene effectors and one guide nucleic acid.

[277] In some embodiments, a complex comprises a heterologous gene effector and a nuclease (e.g., a guide moiety that comprises a nuclease, such as a heterologous endonuclease). A combination of the nuclease and the heterologous gene effector can be a chimeric fusion polypeptide comprising the nuclease and the heterologous gene effector. In some embodiments, the nuclease and the heterologous gene effector are not part of a chimeric fusion polypeptide, e.g., are not present in the same polypeptide chain. The combination of the nuclease and the heterologous gene effector can have a length that is less than a threshold length. In some embodiments, the combined length of the heterologous gene effector and the nuclease is at most about 1,200 amino acids, at most about 1,100 amino acids, at most about 1,000 amino acids, at most about 950 amino acids, at most about 900 amino acids, at most about 850 amino acids, at most about 800 amino acids, at most about 750 amino acids, at most about 700 amino acids, at most about 650 amino acids, at most about 600 amino acids, at most about 550 amino acids, at most about 500 amino acids, at most about 450 amino acids, at most about 400 amino acids, at most about 350 amino acids, or at most about 300 amino acids. In some embodiments, the -64- combined length of the heterologous gene effector and the nuclease is at least about 300 amino acids, at least about 350 amino acids, at least about 400 amino acids, at least about 450 amino acids, at least about 500 amino acids, at least about 550 amino acids, at least about 600 amino acids, at least about 650 amino acids, at least about 700 amino acids, at least about 750 amino acids, at least about 800 amino acids, at least about 850 amino acids, at least about 900 amino acids, at least about 950 amino acids, at least about 1,000 amino acids, at least about 1,100 amino acids, or at least about 1,200 amino acids.

[278] A complex disclosed herein can comprise (i) a guide moiety (for example, a nuclease or part thereof, such as a nuclease deactivated Cas, e.g., a nuclease deactivated Cas9, Cas12a, or Un1Cas12f1, optionally with a guide nucleic acid sequence), and (ii) a heterologous gene effector, wherein the heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 70%, at least about 75%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 16-16154, any one of SEQ ID NOs: 16-13605, any one of SEQ ID NOs: 16155-47350, any one of SEQ ID NOs: 16155-43953, any one of SEQ ID NOs: 47351-49333, any one of SEQ ID NOs: 49353-50032, or any two or more of SEQ ID NOs: 16-49333 and 49353-50032, e.g., over the entire length.

[279] In some embodiments, a complex disclosed herein comprises (i) a guide moiety (for example, a guide nucleic acid sequence and / or a nuclease or part thereof, such as a nuclease deactivated Cas, e.g., a nuclease deactivated Cas9, Cas12a, or Un1Cas12f1), and (ii) a heterologous gene effector, wherein the heterologous gene effector comprises, consists essentially of, or consists of a peptide sequence with at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97.5%, at least about 98%, at least about 98.5%, at least about 99%, at least about 99.5%, at least about 99.9%, or about 100% sequence identity or sequence similarity to any one of SEQ ID NOs: 23631.

[280] Two components present in a complex can be covalently linked, for example, present in a fusion protein, or cross-linked, e.g., treated with a crosslinking agent, or joined by a peptide or non-peptide linker as disclosed herein.

[281] In some embodiments, two components present in a complex are part of the same fusion protein. Components can optionally be joined by a linker, such as a peptide linker or a nonpeptide linker.

[282] In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is joined to a heterologous gene effector by a linker. In some embodiments the guide moiety or part thereof is further joined to a second heterologous gene effector by a second linker that is the same or different. In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is fused to a heterologous gene effector without a linker.

[283] In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is joined to an oligomerization domain or dimerization (e.g., heterodimerization) domain by a linker. In some embodiments the guide moiety or part thereof is further joined to a second oligomerization domain or dimerization (e.g., heterodimerization) domain by a second linker that is the same or different. In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is fused to a second oligomerization domain or dimerization (e.g., heterodimerization) domain without a linker.

[284] In some embodiments, heterologous gene effector is joined to a second heterologous gene effector by a linker. In some embodiments the heterologous gene effector is further joined to a third heterologous gene effector by a second linker that is the same or different. In some embodiments, a heterologous gene effector is fused to a second heterologous gene effector without a linker.

[285] In some embodiments, heterologous gene effector is joined to an oligomerization domain or dimerization (e.g., heterodimerization) domain by a linker. In some embodiments the heterologous gene effector is further joined to a second oligomerization domain or dimerization (e.g., heterodimerization) domain by a second linker that is the same or different. In some embodiments, a heterologous gene effector is fused to a second oligomerization domain or dimerization (e.g., heterodimerization) domain without a linker.

[286] Any suitable linker can be used. A flexible linker can have a sequence containing stretches of glycine and serine residues. The small size of the glycine and serine residues provides flexibility and allows for mobility of the connected functional domains. The incorporation of serine or threonine can maintain the stability of the linker in aqueous solutions by forming hydrogen bonds with the water molecules, thereby reducing unfavorable interactions between the linker and protein moieties. Flexible linkers can also contain additional amino acids such as threonine and alanine to maintain flexibility, as well as polar amino acids such as lysine and glutamine to improve solubility. A rigid linker can have, for example, an alpha helixstructure. An alpha-helical rigid linker can act as a spacer between protein domains. Non- limiting examples of linkers include the sequences in TABLE 2, and repeats thereof, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 repeats. SEQ ID NOs: 1-6 provide flexible linkers or subunits thereof. SEQ ID NOs: 7-10 provide rigid linkers or subunits thereof. TABLE 2 SEQ ID NO: Sequence 1 GGGGS 2 GGGS 3 GG 4 KESGSVSSEQLAQFRSLD 5 EGKSSGSGSESKST 6 GSAGSAAGSGEF 7 EAAAK 8 EAAAR 9 PAPAP 10 AEAAAKEAAAKA

[287] A linker sequence can be, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acid residues in length.

[288] In some embodiments, a linker is at least 1, at least 2, at least 3, at least 5, at least 7, at least 9, at least 11, at least 13, at least 15, or at least 20 amino acids. In some embodiments, a linker is at most 5, at most 7, at most 9, at most 11, at most 13, at most 15, at most 20, at most 25, at most 30, at most 40, or at most 50 amino acids.

[289] In some embodiments, non-peptide linkers are used. A non-peptide linker can be, for example a chemical linker. Two parts of a complex of the disclosure can be connected by a chemical linker. Each chemical linker of the disclosure can be alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, any of which is optionally substituted. In some embodiments, a chemical linker of the disclosure can be an ester, ether, amide, thioether, or polyethyleneglycol (PEG). In some embodiments, a linker can reverse the order of the amino acids sequence in a compound, for example, so that the amino acid sequences linked by the linked are head-to-head, rather than head-to-tail. Non-limiting examples of such linkers include diesters of dicarboxylic acids, such as oxalyl diester, malonyl diester, succinyl diester, glutaryl diester, adipyl diester, pimetyl diester, fumaryl diester, maleyl diester, phthalyl diester, isophthalyl diester, and terephthalyl diester. Non-limiting examples of such linkers include diamides of dicarboxylic acids, such as oxalyl diamide, malonyl diamide, succinyl diamide, glutaryl diamide, adipyl diamide, pimetyl diamide, fumaryl diamide, maleyl diamide, phthalyl diamide, isophthalyl diamide, and terephthalyl diamide. Non-limiting examples of such linkers include diamides of diamino linkers, such as ethylene diamine, 1,2-di(methylamino)ethane, 1,3-diaminopropane, 1,3-di(methylamino)propane, 1,4-di(methylamino)butane, 1,5-di(methylamino)pentane, 1,6-di(methylamino)hexane, and pipyrizine. Non-limiting examples of optional substituents include hydroxyl groups, sulfhydryl groups, halogens, amino groups, nitro groups, nitroso groups, cyano groups, azido groups, sulfoxide groups, sulfone groups, sulfonamide groups, carboxyl groups, carboxaldehyde groups, imine groups, alkyl groups, halo-alkyl groups, alkenyl groups, halo-alkenyl groups, alkynyl groups, halo-alkynyl groups, alkoxy groups, aryl groups, aryloxy groups, aralkyl groups, arylalkoxy groups, heterocyclyl groups, acyl groups, acyloxy groups, carbamate groups, amide groups, ureido groups, epoxy groups, and ester groups.

[290] Two components present in a complex can be non-covalently coupled, for example, by ionic bonds, hydrogen bonds, interactions mediated by oligomerization or dimerization domains disclosed herein, etc.

[291] In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is joined to a heterologous gene effector by non-covalent coupling. In some embodiments the guide moiety or part thereof is further joined to a second heterologous gene effector by non-covalent coupling. In some embodiments the guide moiety or part thereof is joined to a first heterologous gene effector covalently (e.g., as a fusion protein, optionally with a linker), and the guide moiety or part thereof is further joined to a second heterologous gene effector by non-covalent coupling.

[292] In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is joined to an oligomerization domain or dimerization (e.g., heterodimerization) domain by non-covalent coupling. In some embodiments the guide moiety or part thereof is further joined to a second oligomerization domain or dimerization (e.g., heterodimerization) domain by non-covalent coupling. In some embodiments, a guide moiety or a part thereof (e.g., nuclease, such as dCas9) is fused to a first oligomerization domain or dimerization (e.g., heterodimerization) domain by covalent coupling (e.g., fused, optionally by a linker) and is joined to a second oligomerization domain or dimerization (e.g., heterodimerization) domain by non-covalent coupling.

[293] In some embodiments, a first component of a guide moiety (e.g., a guide nucleic acid) is joined to a second component of the guide moiety (e.g., nuclease) non-covalently. In some embodiments, a first component of a guide moiety (e.g., a guide nucleic acid) is joined to a second component of the guide moiety (e.g., nuclease) covalently.

[294] Any combination of covalent and non-covalent coupling can be used in a complex of the disclosure, for example, one or more heterologous gene effectors can be fused to a guide moiety non-covalently, and one or more oligomerization domains can be bound to a component of the complex (e.g., nuclease) covalently.

[295] In some embodiments, a polypeptide providing increased or decreased stability is fused to or otherwise associated with a component of a complex of the disclosure, e.g., a guide moiety or a heterologous gene effector. The fused polypeptide can be located at the N-terminus, the C-terminus, or internally within the fusion protein.

[296] In some embodiments, one or more components of a complex of the disclosure is fused to a domain that directs desirable sub-cellular localization, for example, a nuclear localization signal or a protein for targeting to the inner nuclear membrane, outer nuclear membrane, Cajal body, nuclear speckle, nuclear pore complex, PML body, nucleolus, P granule, GW body, stress granule, sponge body, endoplasmic reticulum, mitochondria, etc.

[297] In some embodiments, a complex of the disclosure comprises a first protein linked to a first oligomerization (e.g., dimerization) domain, and a second protein linked to a second oligomerization (e.g., dimerization) domain. In some embodiments, an oligomerization domain or a dimerization domain can comprise a peptide interaction domain, for example, systems utilizing sgRNA2.0, SAM, SunTag, RAB, FLAG-biotin, or inducible oligomerization (e.g., dimerization) systems disclosed herein. Complexes comprising combinations of heterologous gene effectors

[298] Disclosed herein, in some embodiments, are complexes that comprise two or more heterologous gene effectors, and systems and methods for identifying the same.

[299] In some embodiments, recruitment of two or more heterologous gene effectors to a locus of interest as disclosed herein can result in superior modulation of transcription compared to either heterologous gene effector alone, for example, more potent and / or persistent modulation of target gene (e.g., target endogenous gene) expression.

[300] In some embodiments, recruitment of two or more heterologous gene effectors to a locus of interest as disclosed herein in a complex of the disclosure can result in superior modulation of transcription compared to recruitment of the combination of heterologous gene effectors separately, i.e., not present in a complex of the disclosure. The superior modulation of transcription can comprise, for example, more potent and / or persistent modulation of target gene (e.g., target endogenous gene) expression (e.g., activation or repression).

[301] In some disclosures, assay systems of the disclosure, for example, high throughput screens, are used to identify combinations of heterologous gene effectors that are suitable for achieving a desired result, for example, increased expression of a target gene (e.g., target endogenous gene) or set of genes, reduced expression of a target gene or set of genes, increased -69- expression above a certain threshold, decreased expression below a certain threshold, persistence of expression above or below a desired threshold for a desirable amount of time, etc.

[302] A combination of heterologous gene effectors that are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene (e.g., target endogenous gene) can be a combination of factors that do not interact in normal in vivo contexts (for example, due to cell type source, organism, tissue specific expression, localization to a given sub-cellular compartment or organelle, co-factor, structural, or complex requirements, etc.), but nonetheless mediate desirable epigenetic and / or transcriptional effects when orthogonally recruited to a target locus of interest, for example in a complex of the disclosure.

[303] In some embodiments, a combination of heterologous gene effectors that are present in a complex of the disclosure are from different sources, for example, from any two or more of a human protein, a viral protein, a mammalian protein, a protein that primarily localizes to the nucleus, a chromatin regulator, a factor that facilitates heterochromatin formation, a factor that modulates histones through methylation, a factor that modulates histones through acetylation, a factor that modulates histones through phosphorylation, a factor that modulates histones through ADP-ribosylation, a factor that modulates histones through glycosylation, a factor that modulates histones through SUMOylation, a factor that modulates histones through ubiquitination, a factor that modulates histones by remodeling histone structure, e.g., via an ATP hydrolysis-dependent process, a histone acetyltransferase, a histone lysine methyltransferase, a component of a chromatin remodeling complex, a transcriptional regulator, a transcriptional activator, a transcriptional repressor domain, a transcription factor, a mesenchymal stem cell transcription factor, an embryonic stem cell transcription factor, an induced pluripotent stem cell (iPSC) transcription factor, an epithelial stem cell transcription factor, a cancer stem cell transcription factor, a cancer-related transcription factor, an immune cell transcription factor, a nuclear receptor, a nuclear hormone receptor, a validated human virus transcriptional regulator, a factor from a genome of a virus (e.g., from a virus family, subfamily, genus, species etc. disclosed herein), a factor from a genome of a virus that is capable of zoonotic transmission to humans, a factor from a shared human / bat virus, a factor from a viral genome from a metagenomic survey, a factor from a virus found in the human gut, a factor from a virus found in extreme environments, a factor from a virus or protein class with a high degree of documented transcriptional regulator modularity, or another source disclosed herein.

[304] In some embodiments, a combination of heterologous gene effectors that are present in a complex of the disclosure are from the same or similar sources, for example, two or more heterologous gene effectors each of which contains a sequence from a human protein, a viral protein, a mammalian protein, a protein that primarily localizes to the nucleus, a chromatin -70- regulator, a factor that facilitates heterochromatin formation, a factor that modulates histones through methylation, a factor that modulates histones through acetylation, a factor that modulates histones through phosphorylation, a factor that modulates histones through ADP-ribosylation, a factor that modulates histones through glycosylation, a factor that modulates histones through SUMOylation, a factor that modulates histones through ubiquitination, a factor that modulates histones by remodeling histone structure, e.g., via an ATP hydrolysis-dependent process, a histone acetyltransferase, a histone lysine methyltransferase, a component of a chromatin remodeling complex, a transcriptional regulator, a transcriptional activator, a transcriptional repressor domain, a transcription factor, a mesenchymal stem cell transcription factor, an embryonic stem cell transcription factor, an induced pluripotent stem cell (iPSC) transcription factor, an epithelial stem cell transcription factor, a cancer stem cell transcription factor, a cancer-related transcription factor, an immune cell transcription factor, a nuclear receptor, a nuclear hormone receptor, a validated human virus transcriptional regulator, a factor from a genome of a virus (e.g., from a virus family, subfamily, genus, species etc. disclosed herein), a factor from a genome of a virus that is capable of zoonotic transmission to humans, a factor from a shared human / bat virus, a factor from a viral genome from a metagenomic survey, a factor from a virus found in the human gut, a factor from a virus found in extreme environments, a factor from a virus or protein class with a high degree of documented transcriptional regulator modularity, or another source disclosed herein.

[305] In some embodiments, a complex comprises two or more heterologous gene effectors that are from the same or similar sources and two or more heterologous gene effectors that are from different sources.

[306] Two heterologous gene effectors that are present in a complex of the disclosure can be covalently linked to the complex, for example, present in a fusion protein, or treated with a crosslinking agent, etc. in any manner as disclosed elsewhere herein.

[307] Two heterologous gene effectors that are present in a complex of the disclosure can be non-covalently associated to the complex, for example, by ionic bonds, hydrogen bonds, using an inducible and / or reversible system, etc. in any manner as disclosed elsewhere herein.

[308] Two heterologous gene effectors that are present in a complex of the disclosure can be associated with the complex by using an inducible system. In some embodiments, the inducible system is reversible, e.g., upon withdrawal of the inducing agent, or upon treating with a dissociating agent.

[309] Inducible systems for associating complex components can comprise fusing dimerization, oligomerization, or multimerization domains to the proteins to be associated. In some embodiments, the dimerization, oligomerization, or multimerization domains are fused to the N--71- terminus of the protein to be associated. In some embodiments, the dimerization, oligomerization, or multimerization domains are fused to the C-terminus of the protein to be associated. In some embodiments, the dimerization, oligomerization, or multimerization domains are fused to the N-terminus and the C-terminus of the protein to be associated (e.g., the same or different dimerization, oligomerization, or multimerization domains at the N-terminus and the C-terminus). In some embodiments, the dimerization, oligomerization, or multimerization domains are added in-frame within the amino acid sequence of a protein to be associated.

[310] An inducible system for associating complex components can be a chemically-inducible system. Non-limiting examples of chemically-inducible systems include small molecule inducible systems, systems based on tetracycline or doxycycline, systems based on ponasterone A, abscisic acid (ABA)-inducible ABI-PYL1, gibberellin (GA)-inducible GID1-GAI, rapamycin-inducible FKBP-FRB, a TMP-Htag induced HaloTag / DHFR dimerization system, a dimerization system using an enzyme-catalyzed reaction, and systems utilizing a combination of the inducible components.

[311] An inducible system for associating complex components can be a light-inducible system (e.g., an optogenetic system). Non-limiting examples of light-inducible systems include phytochrome-based red light-inducible PHYB-PIF, cryptochrome-based blue light-inducible CRY2PHR-CIBN, light oxygen voltage-based blue-light-inducible FKF1-GI, pMAG, nMAG, BphS, and systems utilizing a combination of the inducible components.

[312] In some embodiments, components of a complex of the disclosure are associated using inducible and reversible heterodimeric protein pairs from Arabidopsis thaliana (PYL1-ABI and GID1-GAI). Fusing heterodimerization domains from this system to each of two separately-expressed polypeptides allows for association of the polypeptides upon treatment with an inducing agent (the plant hormones ABA and GA).

[313] For example, by fusing one protein from a heterodimeric pair to a guide moiety (e.g., dCas9) and the other to a heterologous gene effector, recruitment of the effector to the guide moiety can be achieved by addition of the appropriate plant hormone. Recruitment of a second heterologous gene effector can similarly be achieved by fusing one protein from a second heterodimeric pair to the guide moiety and the other to the second heterologous gene effector. In some embodiments, the same system an alternative inducible system is used to associate components in a complex that does not contain two or more different heterologous gene effectors, for example, to reversibly induce complex formation between one heterologous gene effector and a nuclease.

[314] In some embodiments, components of an inducible system can be transiently or permanently expressed in cells of the disclosure. For example, cells can be transduced to -72- transiently or stably express a guide moiety (e.g., dCas9) with fusions of heterodimerization domains from GAI and ABI.

[315] In some embodiments, compositions and methods of the disclosure utilize candidate heterologous gene effectors with a high degree of documented transcriptional regulator modularity. In some embodiments, heterologous gene effectors with a high degree of documented transcriptional regulator modularity can be useful in combination with other gene effectors, for example, can be more likely to facilitate combinatorial or synergistic effects on gene transcription. This system allows, for example, orthogonal recruitment of candidate effector domains to test thousands of possible combinations in an unbiased manner. The inducibility and reversibility of the system allows the persistence of observed effects on transcriptional activation or repression to be evaluated. Aspects of the system (for example, that allow AND, OR, NAND, and NOR logic operators and a diametric regulator that activates gene expression with one inducer and represses with another) are described in Gao et al., "Complex transcriptional modulation with orthogonal and inducible dCas9 regulators." Nature methods 13.12 (2016): 1043-1049.

[316] In some disclosures, a complex comprises a combination of a chromatin regulator and a transcriptional regulator. In some disclosures, a complex comprises a combination of a first chromatin regulator and a second chromatin regulator. In some disclosures, a complex comprises a combination of a first transcriptional regulator and a second transcriptional regulator.

[317] In some disclosures, a complex comprises a combination of at least one chromatin regulator and at least one transcriptional regulator. In some disclosures, a complex comprises a combination of a first chromatin regulator and at least a second chromatin regulator. In some disclosures, a complex comprises a combination of a first transcriptional regulator and at least a second transcriptional regulator.

[318] In some disclosures, a complex comprises a combination of a chromatin regulator with two transcriptional regulators. In some disclosures, a complex comprises a combination of a transcriptional regulator with two chromatin regulators. In some disclosures, a complex comprises a combination of three chromatin regulators. In some disclosures, a complex comprises a combination of three transcriptional regulators.

[319] In some disclosures, a complex comprises a combination of at least one chromatin regulator with at least two transcriptional regulators. In some disclosures, a complex comprises a combination of at least one transcriptional regulator with at least two chromatin regulators. In some disclosures, a complex comprises a combination of at least three chromatin regulators. In some disclosures, a complex comprises a combination of at least three transcriptional regulators.

[320] A complex of the disclosure can comprise any suitable number of heterologous gene effectors, for example, at least one, at least two, at least three, at least four, or at least five. In some embodiments, a complex of the disclosure comprises at most two, at most three, at most four, or at most five heterologous gene effectors. In some embodiments, a complex of the disclosure comprises 1 - 5, 1 - 4, 1 - 3, 1 - 2, 2 - 5, 2 - 4, 2 - 3, 3 - 5, 3 - 4, or 4 - 5 heterologous gene effectors. In some embodiments, a complex of the disclosure comprises at most one, at most two, at most three, at most four, at most five, at most six, at most seven, at most eight, at most nine, or at most ten heterologous gene effectors. In some embodiments, a complex of the disclosure comprises one, two, three, four, five, six, seven, eight, nine, or ten heterologous gene effectors. In some embodiments, a complex of the disclosure comprises one heterologous gene effector. In some embodiments, a complex of the disclosure comprises two heterologous gene effectors. In some embodiments, a complex of the disclosure comprises three heterologous gene effectors.

[321] In some embodiments two heterologous gene effectors are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene (e.g., target endogenous gene). In some embodiments three heterologous gene effectors are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene (e.g., target endogenous gene). In some embodiments four heterologous gene effectors are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene (e.g., target endogenous gene). In some embodiments five heterologous gene effectors are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene (e.g., target endogenous gene).

[322] When two or more heterologous gene effectors are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene (e.g., target endogenous gene), the heterologous gene effectors can be the same or different. In some embodiments, two heterologous gene effectors that are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene are different to each other (e.g., from derived from different proteins of origin). In some embodiments, three heterologous gene effectors that are present in a complex of the disclosure and / or are recruited to a locus that regulates expression of a target gene are different to each other (e.g., from derived from different proteins of origin).

[323] In some embodiments, a complex of the disclosure comprises at least one heterologous gene effector that is not or does not contain a sequence from P300, TET1, TET2, TET3, and / or HSF1.

[324] In some embodiments, a complex of the disclosure comprises at least one heterologous gene effector that is not or does not contain a sequence from VP64, P65, Rta, VPR, AD2, CR3, -74- ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta).

[325] In some embodiments, a complex of the disclosure comprises at least one heterologous gene effector that is not or does not contain a sequence from KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A. TARGET GENES

[326] The disclosure provides compositions, methods, and systems for modulating expression of target genes (e.g., target endogenous genes). For example, disclosed herein are complexes that comprise a guide moiety and one or more heterologous gene effectors that can increase or decrease an activity or expression level of a target gene.

[327] In some embodiments, a target gene or regulatory sequence thereof is endogenous to a subject, for example, present in the subject’s genome. In some embodiments, a target gene or regulatory sequence thereof is not part of an engineered reporter system.

[328] In some disclosures, a target gene is exogenous to a host subject, for example, a pathogen target gene or an exogenous gene expressed as a result of a therapeutic intervention, such as a gene therapy and / or cell therapy. In some disclosures, a target gene is an exogenous reporter gene, such as a reporter gene disclosed herein (e.g., a fluorescent protein). In some disclosures, a target gene is an exogenous synthetic gene.

[329] In some embodiments, a complex of the disclosure can increase expression of a target gene (e.g., upon introducing the complex into a cell or population of cells). In some embodiments, an expression level is an RNA expression level can be measured by, for example, RNAseq, qPCR, microarray, gene array, FISH, etc. In some embodiments, an expression level is a protein expression level can be measured by, for example, Western Blot, ELISA, multiplex immunoassay, mass spectrometry, NMR, proteomics, flow cytometry, mass cytometry, etc.

[330] In some embodiments, a complex of the disclosure can increase expression of a target gene (e.g., upon introducing the complex into a cell or population of cells) by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 11 fold, at least 12 fold, at least 13 fold, at least 14, at least 15 fold, at least 20 fold, at least 30 fold, at least 40 fold, at least 50 fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, at least 100 fold, at least 150 fold, at least 200 fold, at least 250 fold, at least 300 fold, at least 350 fold, at least 400 fold, at least 500 fold, at least 600 fold, at least 700 fold, at least 800 fold, at least 900 fold, at least 1000 fold, at least 1500 fold, at least 2000 fold, or at least 3000 fold.

[331] In some embodiments, a complex of the disclosure can increase expression of a target gene (e.g., upon introducing the complex into a cell or population of cells) at most 50%, at most 60%, at most 70%, at most 80%, at most 90%, at most 2-fold, at most 3 fold, at most 4 fold, at most 5 fold, at most 6 fold, at most 7 fold, at most 8 fold, at most 9 fold, at most 10 fold, at most 11 fold, at most 12 fold, at most 13 fold, at most 14, at most 15 fold, at most 20 fold, at most 30 fold, at most 40 fold, at most 50 fold, at most 60 fold, at most 70 fold, at most 80 fold, at most 90 fold, at most 100 fold, at most 150 fold, at most 200 fold, at most 250 fold, at most 300 fold, at most 350 fold, at most 400 fold, at most 500 fold, at most 600 fold, at most 700 fold, at most 800 fold, at most 900 fold, at most 1000 fold, at most 1500 fold, at most 2000 fold, at most 3000 fold, at most 5000 fold, or at most 10000 fold.

[332] In some embodiments, a complex of the disclosure can increase expression of a target gene (e.g., upon introducing the complex into a cell or population of cells) about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 2-fold, about 3 fold, about 4 fold, about 5 fold, about 6 fold, about 7 fold, about 8 fold, about 9 fold, about 10 fold, about 11 fold, about 12 fold, about 13 fold, about 14, about 15 fold, about 20 fold, about 30 fold, about 40 fold, about 50 fold, about 60 fold, about 70 fold, about 80 fold, about 90 fold, about 100 fold, about 150 fold, about 200 fold, about 250 fold, about 300 fold, about 350 fold, about 400 fold, about 500 fold, about 600 fold, about 700 fold, about 800 fold, about 900 fold, about 1000 fold, about 1500 fold, about 2000 fold, about 3000 fold, about 5000 fold, or about 10000 fold.

[333] In some embodiments, a complex of the disclosure can increase an expression level of a target gene (e.g., upon introducing the complex into a cell or population of cells) from below a limit of detection to a detectable level.

[334] In some disclosures, a complex of the disclosure can reduce expression of a target gene (e.g., upon introducing the complex into a cell or population of cells) by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 11 fold, at least 12 fold, at least 13 fold, at -76- least 14, at least 15 fold, at least 20 fold, at least 30 fold, at least 40 fold, at least 50 fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, at least 100 fold, at least 150 fold, at least 200 fold, at least 250 fold, at least 300 fold, at least 350 fold, at least 400 fold, at least 500 fold, at least 600 fold, at least 700 fold, at least 800 fold, at least 900 fold, at least 1000 fold, at least 1500 fold, at least 2000 fold, or at least 3000 fold.

[335] In some disclosures, a complex of the disclosure can reduce expression of a target gene (e.g., upon introducing the complex into a cell or population of cells) at most 50%, at most 60%, at most 70%, at most 80%, at most 90%, at most 2-fold, at most 3 fold, at most 4 fold, at most 5 fold, at most 6 fold, at most 7 fold, at most 8 fold, at most 9 fold, at most 10 fold, at most 11 fold, at most 12 fold, at most 13 fold, at most 14, at most 15 fold, at most 20 fold, at most 30 fold, at most 40 fold, at most 50 fold, at most 60 fold, at most 70 fold, at most 80 fold, at most 90 fold, at most 100 fold, at most 150 fold, at most 200 fold, at most 250 fold, at most 300 fold, at most 350 fold, at most 400 fold, at most 500 fold, at most 600 fold, at most 700 fold, at most 800 fold, at most 900 fold, at most 1000 fold, at most 1500 fold, at most 2000 fold, at most 3000 fold, at most 5000 fold, or at most 10000 fold.

[336] In some disclosures, a complex of the disclosure can reduce expression of a target gene (e.g., upon introducing the complex into a cell or population of cells) about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 2fold, about 3 fold, about 4 fold, about 5 fold, about 6 fold, about 7 fold, about 8 fold, about 9 fold, about 10 fold, about 11 fold, about 12 fold, about 13 fold, about 14, about 15 fold, about 20 fold, about 30 fold, about 40 fold, about 50 fold, about 60 fold, about 70 fold, about 80 fold, about 90 fold, about 100 fold, about 150 fold, about 200 fold, about 250 fold, about 300 fold, about 350 fold, about 400 fold, about 500 fold, about 600 fold, about 700 fold, about 800 fold, about 900 fold, about 1000 fold, about 1500 fold, about 2000 fold, about 3000 fold, about 5000 fold, or about 10000 fold.

[337] In some disclosures, a complex of the disclosure can reduce an expression level of a target gene (e.g., upon introducing the complex into a cell or population of cells) from a detectable level to below a limit of detection.

[338] In some embodiments, the degree in change of expression is relative to before introducing the complex into the cell or population of cells. In some embodiments, the degree in change of expression is relative to a corresponding control cell or population of cells that are not treated with the complex. In some embodiments, the degree in change of expression is relative to a corresponding control cell or population of cells that are treated with an alternative complex or gene expression regulator, for example, a complex comprising an alternative heterologous gene effector or combination thereof, or a different agent that modulates expression of the target gene. In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from P300, TET1, TET2, TET3, HSF1, VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta), KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A.

[339] In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from VPR. In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from KRAB. In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from VP64. In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from Rta. In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from p65. In some embodiments, the degree in change of expression is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is KAL.

[340] In some embodiments, a complex of the disclosure can increase an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells). An activity level can be determined by a suitable functional assay for the target gene in question depending on the functional characteristics of the target gene. For example, an activity level of a target gene that is a mitogen could be determined by measuring cell proliferation; an activity level of a target gene that induces apoptosis could be measured by an annexin V assay or other suitable cell death assay; an activity level of an anti-inflammatory cytokine could be measured by an LPS-induced cytokine release assay.

[341] In some embodiments, a complex of the disclosure can increase an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 11 fold, at least 12 fold, at least 13 fold, at least 14, at least 15 fold, at least 20 fold, at least 30 fold, at least 40 fold, at least 50 fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, at least 100 fold, at least 150 fold, at least 200 fold, at least 250 fold, at least 300 fold, at least 350 fold, at least 400 fold, at least 500 fold, at least 600 fold, at least 700 fold, at least 800 fold, at least 900 fold, at least 1000 fold, at least 1500 fold, at least 2000 fold, or at least 3000 fold.

[342] In some embodiments, a complex of the disclosure can increase an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) at most 50%, at most 60%, at most 70%, at most 80%, at most 90%, at most 2-fold, at most 3 fold, at most 4 fold, at most 5 fold, at most 6 fold, at most 7 fold, at most 8 fold, at most 9 fold, at most 10 fold, at most 11 fold, at most 12 fold, at most 13 fold, at most 14, at most 15 fold, at most 20 fold, at most 30 fold, at most 40 fold, at most 50 fold, at most 60 fold, at most 70 fold, at most 80 fold, at most 90 fold, at most 100 fold, at most 150 fold, at most 200 fold, at most 250 fold, at most 300 fold, at most 350 fold, at most 400 fold, at most 500 fold, at most 600 fold, at most 700 fold, at most 800 fold, at most 900 fold, at most 1000 fold, at most 1500 fold, at most 2000 fold, at most 3000 fold, at most 5000 fold, or at most 10000 fold.

[343] In some embodiments, a complex of the disclosure can increase an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 2-fold, about 3 fold, about 4 fold, about 5 fold, about 6 fold, about 7 fold, about 8 fold, about 9 fold, about 10 fold, about 11 fold, about 12 fold, about 13 fold, about 14, about 15 fold, about 20 fold, about 30 fold, about 40 fold, about 50 fold, about 60 fold, about 70 fold, about 80 fold, about 90 fold, about 100 fold, about 150 fold, about 200 fold, about 250 fold, about 300 fold, about 350 fold, about 400 fold, about 500 fold, about 600 fold, about 700 fold, about 800 fold, about 900 fold, about 1000 fold, about 1500 fold, about 2000 fold, about 3000 fold, about 5000 fold, or about 10000 fold.

[344] In some embodiments, a complex of the disclosure can increase an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) from below a limit of detection to a detectable level.

[345] In some disclosures, a complex of the disclosure can reduce an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) by at least 10%, at -79- least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 11 fold, at least 12 fold, at least 13 fold, at least 14, at least 15 fold, at least 20 fold, at least 30 fold, at least 40 fold, at least 50 fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, at least 100 fold, at least 150 fold, at least 200 fold, at least 250 fold, at least 300 fold, at least 350 fold, at least 400 fold, at least 500 fold, at least 600 fold, at least 700 fold, at least 800 fold, at least 900 fold, at least 1000 fold, at least 1500 fold, at least 2000 fold, or at least 3000 fold.

[346] In some disclosures, a complex of the disclosure can reduce an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) at most 50%, at most 60%, at most 70%, at most 80%, at most 90%, at most 2-fold, at most 3 fold, at most 4 fold, at most 5 fold, at most 6 fold, at most 7 fold, at most 8 fold, at most 9 fold, at most 10 fold, at most 11 fold, at most 12 fold, at most 13 fold, at most 14, at most 15 fold, at most 20 fold, at most 30 fold, at most 40 fold, at most 50 fold, at most 60 fold, at most 70 fold, at most 80 fold, at most 90 fold, at most 100 fold, at most 150 fold, at most 200 fold, at most 250 fold, at most 300 fold, at most 350 fold, at most 400 fold, at most 500 fold, at most 600 fold, at most 700 fold, at most 800 fold, at most 900 fold, at most 1000 fold, at most 1500 fold, at most 2000 fold, at most 3000 fold, at most 5000 fold, or at most 10000 fold.

[347] In some disclosures, a complex of the disclosure can reduce an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 2-fold, about 3 fold, about 4 fold, about 5 fold, about 6 fold, about 7 fold, about 8 fold, about 9 fold, about 10 fold, about 11 fold, about 12 fold, about 13 fold, about 14, about 15 fold, about 20 fold, about 30 fold, about 40 fold, about 50 fold, about 60 fold, about 70 fold, about 80 fold, about 90 fold, about 100 fold, about 150 fold, about 200 fold, about 250 fold, about 300 fold, about 350 fold, about 400 fold, about 500 fold, about 600 fold, about 700 fold, about 800 fold, about 900 fold, about 1000 fold, about 1500 fold, about 2000 fold, about 3000 fold, about 5000 fold, or about 10000 fold.

[348] In some disclosures, a complex of the disclosure can reduce an activity level of a target gene (e.g., upon introducing the complex into a cell or population of cells) from a detectable level to below a limit of detection.

[349] In some embodiments, the degree in change of an activity level is relative to before introducing the complex into the cell or population of cells. In some embodiments, the degree in change of an activity level is relative to a corresponding control cell or population of cells that are not treated with the complex. In some embodiments, the degree in change of an activity level -80- is relative to a corresponding control cell or population of cells that are treated with an alternative complex or gene expression regulator, for example, a complex comprising an alternative heterologous gene effector or combination thereof, or a different agent that modulates an activity level of the target gene (e.g., target endogenous gene). In some embodiments, the degree in change of an activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from P300, TET1, TET2, TET3, HSF1, VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta), KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A.

[350] In some embodiments, the degree in change of activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from VPR. In some embodiments, the degree in change of activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from KRAB. In some embodiments, the degree in change of activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from VP64. In some embodiments, the degree in change of activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from Rta. In some embodiments, the degree in change of activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from p65. In some embodiments, the degree in change of activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is KAL.

[351] Complexes of the disclosure can, in some cases, elicit changes in expression and / or activity level of a target gene (e.g., target endogenous gene) that persists for longer than can be achieved with alternative compositions and methods. In some embodiments, persistent modulation of gene expression is advantageous as compared to transient modulation.

[352] In some embodiments, a complex of the disclosure can increase expression and / or activity level of a target gene (e.g., target endogenous gene) to above a certain threshold for a period of time that is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold longer than a control.

[353] In some disclosures, a complex of the disclosure can reduce expression and / or activity level of a target gene (e.g., target endogenous gene) to below a certain threshold for a period of time that is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold longer than a control.

[354] In some embodiments, transient modulation of gene expression is advantageous as compared to persistent modulation, for example, where persistent over-expression or underexpression would lead to toxicity or off-target effects. Complexes of the disclosure can, in some cases, elicit changes in expression and / or activity level of a target gene (e.g., target endogenous gene) that persists for shorter periods of time than can be achieved with alternative compositions and methods.

[355] In some embodiments, a complex of the disclosure can increase expression and / or activity level of a target gene (e.g., target endogenous gene) to above a certain threshold for at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold less time than a control.

[356] In some disclosures, a complex of the disclosure can reduce expression and / or activity level of a target gene (e.g., target endogenous gene) to below a certain threshold for at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 2-fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 6 fold, at least 7 fold, at least 8 fold, at least 9 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold less time than a control.

[357] A control for an amount of time that expression and / or activity level is modulated can be, for example, a corresponding control cell or population of cells that are treated with an alternative complex or gene expression regulator, for example, a complex comprising an alternative heterologous gene effector or combination thereof, or a different agent that modulates an activity level of the target gene (e.g., target endogenous gene). In some embodiments, the -82- persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from P300, TET1, TET2, TET3, HSF1, VP64, P65, Rta, VPR, AD2, CR3, ELKF1, GATA4, PRVIE, p53, SP1, MYOD, MEF2C, TAX, PPAR-gamma, MED1, MED7, MED17, MED26, MED29, TBP, GTF2H-2D, GTF2B, CBP, HSF1, MS2-p65-HSF1, MS2-TET1, NLS-dCas9-VP64, P300, p65, PRDM9, PUFa-GADD45A- TET1, R2, SunTag-scFv-sfGFP-TET1CD, TET1, TET2, TET3, VP120, VP16, VP16, VP16, VP48, VP64, VP64 or p65 + / - HSF1 or MyoD1, and / or VPR (Vp64+p65+Rta), KRAB, Mad mSIN3 interaction domain (SID), ERF repressor domain (ERD), cat3a, last 301 amino acids of Dnmt3a Isoform 1, dCas9-KRAB-MeCP2, DNMT3A, DNMT3A, DNMT3A, DNMT3A R887E-DNMT3L, DNMT3A-DNMT3L, DNMT3B, EZH2, HDAC, KRAB-DNMT3A, KRAB-DNMT3A-DNMT3L, KRAB-DNMT3L, LSD1, M.SssI, MQ1, MQ1 Q147E, SID4x, and / or SuntTag-DNMT3A.

[358] In some embodiments, the persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from VPR. In some embodiments, the persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from KRAB. In some embodiments, the persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from VP64. In some embodiments, the persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from Rta. In some embodiments, the persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is from p65. In some embodiments, the persistence in change of an expression and / or activity level is relative to a corresponding cell or population thereof that is treated with a control agent comprising a heterologous gene effector that is KAL.

[359] In some embodiments, a complex of the disclosure can increase expression and / or activity level of a target gene (e.g., target endogenous gene) to above a certain threshold for at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 5 hours, at least 6 hours, at least 7 hours, at least 8 hours, at least 9 hours, at least 10 hours, at least 12 hours, at least 14 hours, at least 18 hours, at least 20 hours, at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days, at least 7 days, at least 8 days, at least 9 days, at least 10 days, at least 14 days, at least 21 days, at least 28 days, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 12 weeks, at least 14 -83- weeks, at least 18 weeks, at least 20 weeks, or at least 26 weeks. The threshold can be, for example, a baseline level observed prior to treatment with the complex or in a corresponding population of cells not treated with the complex.

[360] In some embodiments, a complex of the disclosure can reduce expression and / or activity level of a target gene (e.g., target endogenous gene) to below a certain threshold for at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 5 hours, at least 6 hours, at least 7 hours, at least 8 hours, at least 9 hours, at least 10 hours, at least 12 hours, at least 14 hours, at least 18 hours, at least 20 hours, at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days, at least 7 days, at least 8 days, at least 9 days, at least 10 days, at least 14 days, at least 21 days, at least 28 days, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 12 weeks, at least 14 weeks, at least 18 weeks, at least 20 weeks, or at least 26 weeks. The threshold can be, for example, a baseline level observed prior to treatment with the complex or in a corresponding population of cells not treated with the complex.

[361] In some embodiments, a complex of the disclosure can increase expression and / or activity level of a target gene (e.g., target endogenous gene) to above a certain threshold for at most 1 hour, at most 2 hours, at most 3 hours, at most 4 hours, at most 5 hours, at most 6 hours, at most 7 hours, at most 8 hours, at most 9 hours, at most 10 hours, at most 12 hours, at most 14 hours, at most 18 hours, at most 20 hours, at most 1 day, at most 2 days, at most 3 days, at most 4 days, at most 5 days, at most 6 days, at most 7 days, at most 8 days, at most 9 days, at most 10 days, at most 14 days, at most 21 days, at most 28 days, at most 5 weeks, at most 6 weeks, at most 7 weeks, at most 8 weeks, at most 9 weeks, at most 10 weeks, at most 12 weeks, at most 14 weeks, at most 18 weeks, at most 20 weeks, or at most 26 weeks. The threshold can be, for example, a baseline level observed prior to treatment with the complex or in a corresponding population of cells not treated with the complex.

[362] In some embodiments, a complex of the disclosure can reduce expression and / or activity level of a target gene (e.g., target endogenous gene) to below a certain threshold for at most 1 hour, at most 2 hours, at most 3 hours, at most 4 hours, at most 5 hours, at most 6 hours, at most 7 hours, at most 8 hours, at most 9 hours, at most 10 hours, at most 12 hours, at most 14 hours, at most 18 hours, at most 20 hours, at most 1 day, at most 2 days, at most 3 days, at most 4 days, at most 5 days, at most 6 days, at most 7 days, at most 8 days, at most 9 days, at most 10 days, at most 14 days, at most 21 days, at most 28 days, at most 5 weeks, at most 6 weeks, at most 7 weeks, at most 8 weeks, at most 9 weeks, at most 10 weeks, at most 12 weeks, at most 14 weeks, at most 18 weeks, at most 20 weeks, or at most 26 weeks. The threshold can be, for example, a baseline level observed prior to treatment with the complex or in a corresponding population of cells not treated with the complex.

[363] In some embodiments, a complex of the disclosure can increase expression and / or activity level of a target gene (e.g., target endogenous gene) to above a certain threshold for about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 14 hours, about 18 hours, about 20 hours, about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 14 days, about 21 days, about 28 days, about 5 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 9 weeks, about 10 weeks, about 12 weeks, about 14 weeks, about 18 weeks, about 20 weeks, or about 26 weeks. The threshold can be, for example, a baseline level observed prior to treatment with the complex or in a corresponding population of cells not treated with the complex.

[364] In some embodiments, a complex of the disclosure can reduce expression and / or activity level of a target gene (e.g., target endogenous gene) to below a certain threshold for about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 12 hours, about 14 hours, about 18 hours, about 20 hours, about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 14 days, about 21 days, about 28 days, about 5 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 9 weeks, about 10 weeks, about 12 weeks, about 14 weeks, about 18 weeks, about 20 weeks, or about 26 weeks. The threshold can be, for example, a baseline level observed prior to treatment with the complex or in a corresponding population of cells not treated with the complex.

[365] The target gene (e.g., target endogenous gene) or regulatory sequence thereof can be any suitable gene or regulatory sequence thereof that is present in a cell, such as a stem cell, hematopoietic cell, an immune cell, or other cell type disclosed herein.

[366] The target gene (e.g., target endogenous gene) can be a gene involved in immune cell regulation. In some embodiments, the target gene (e.g., target endogenous gene) is associated with cancer. The target gene associated with cancer can be a cell cycle gene, cell response gene, apoptosis gene, or phagocytosis gene.

[367] In some embodiments, the term target gene (e.g., target endogenous gene) can also include target gene regulatory sequences, for example, promoters, enhancers, repressors, silencers, insulators, cis-regulatory elements, trans-regulatory elements, epigenetic modification (e.g., DNA methylation) sites, etc. that can influence an expression or activity level of the target gene, for example, upon binding of a complex, heterologous gene effector, and / or other factors to the regulatory sequence. Target gene regulatory sequences can be physically located outside of the transcriptional unit or open reading frame that encodes a product of the target gene.

[368] A target gene regulatory sequence can be an endogenous regulatory sequence, for example, an endogenous promoter, endogenous enhancer, endogenous repressor, endogenous silencer, endogenous insulator, endogenous cis-regulatory element, endogenous trans-regulatory element, endogenous epigenetic modification (e.g., DNA methylation) site, etc., that is operatively coupled to the target gene (e.g., target endogenous gene). In some embodiments, a target gene regulatory sequence does not contain a component of an engineered or synthetic reporter system. In some embodiments, a target gene regulatory sequence does not function as part of an engineered reporter system. In some embodiments, a target gene regulatory sequence does not contain an exogenous, engineered, or synthetic regulatory element, for example, does not contain a response element that is modulated by tetracycline or analogs thereof. In some embodiments, a target gene regulatory sequence does not contain a response element that is modulated by an exogenous, engineered, or synthetic factor, for example, a does not contain a response element that is modulated by a transactivator or reverse transactivator. In some embodiments, a target gene regulatory sequence does not contain an element that is responsive to a transactivator or reverse transactivator that functions as part of an engineered inducible system, repressible system, and / or reporter system. In some embodiments, a target gene regulatory sequence is not a component of a Tet off or tTA-dependent system. In some embodiments, a target gene regulatory sequence is not a component of a Tet On or rtTA-dependent system.

[369] In some embodiments, a target gene regulatory sequence does not contain a nucleotide sequence that is exogenous to the subject or host cell. In some embodiments, a target gene regulatory sequence does not contain an engineered or artificially generated or introduced nucleotide sequence.

[370] In some embodiments, a complex or a heterologous gene effector identified by methods of the disclosure effects a desirable change that is specific to a particular target gene (e.g., target endogenous gene). In some embodiments, a complex or a heterologous gene effector identified by methods of the disclosure effects a desirable change that is applicable to two or more target genes (e.g., target endogenous genes). In some embodiments, a complex or a heterologous gene effector identified by methods of the disclosure effects a desirable change that is applicable to three or more target genes (e.g., target endogenous genes). In some embodiments, a complex or a heterologous gene effector identified by methods of the disclosure effects a desirable change that is applicable to a class of target genes (e.g., target endogenous genes), for example, genes with overlapping functional roles, that function in the same pathway, or are responsive to similar endogenous stimuli. In some embodiments, a complex or a heterologous gene effector identified -86- by methods of the disclosure effects a desirable change that is broadly applicable to a wide variety of target genes (e.g., target endogenous genes), for example, elicits an expression level that is above or below a certain threshold for multiple target genes when present in a complex with a suitable guide moiety to direct binding to the target gene or a regulatory sequence thereof.

[371] In some embodiments, a target gene (e.g., target endogenous gene) is a gene that is overexpressed or under-expressed in a disease or condition. In some embodiments, a target gene is a gene that is over-expressed or under-expressed in a heritable genetic disease.

[372] In some embodiments, a target gene (e.g., target endogenous gene) is a gene that is overexpressed or under-expressed in an autoimmune disease. In some embodiments, a target gene is a gene that is over-expressed or under-expressed in Acute disseminated encephalomyelitis, Acute motor axonal neuropathy, Addison's disease, Adiposis dolorosa, Adult-onset Still's disease, Alopecia areata, Ankylosing Spondylitis, Anti-Glomerular Basement Membrane nephritis, Anti-neutrophil cytoplasmic antibody-associated vasculitis, Anti-N-Methyl-D-Aspartate Receptor Encephalitis, Antiphospholipid syndrome, Antisynthetase syndrome, Aplastic anemia, Autoimmune Angioedema, Autoimmune Encephalitis, Autoimmune enteropathy, Autoimmune hemolytic anemia, Autoimmune hepatitis, Autoimmune inner ear disease, Autoimmune lymphoproliferative syndrome, Autoimmune neutropenia, Autoimmune oophoritis, Autoimmune orchitis, Autoimmune pancreatitis, Autoimmune polyendocrine syndrome, Autoimmune polyendocrine syndrome type 2, Autoimmune polyendocrine syndrome type 3, Autoimmune progesterone dermatitis, Autoimmune retinopathy, Autoimmune thrombocytopenic purpura, Autoimmune thyroiditis, Autoimmune urticaria, Autoimmune uveitis, Balo concentric sclerosis, Behget’s disease, Bickerstaffs encephalitis, Bullous pemphigoid, Celiac disease, Chronic fatigue syndrome, Chronic inflammatory demyelinating polyneuropathy, Churg-Strauss syndrome, Cicatricial pemphigoid, Cogan syndrome, Cold agglutinin disease, Complex regional pain syndrome, CREST syndrome, Crohn's disease, Dermatitis herpetiformis, Dermatomyositis, Diabetes mellitus type 1, Discoid lupus erythematosus, Endometriosis, Enthesitis, Enthesitis-related arthritis, Eosinophilic esophagitis, Eosinophilic fasciitis, Epidermolysis bullosa acquisita, Erythema nodosum, Essential mixed cryoglobulinemia, Evans syndrome, Felty syndrome, Fibromyalgia, Gastritis, Gestational pemphigoid, Giant cell arteritis, Goodpasture syndrome, Graves' disease, Graves ophthalmopathy, Guillain-Barre syndrome, Hashimoto’s Encephalopathy, Hashimoto Thyroiditis, Henoch-Schonlein purpura, Hidradenitis suppurativa, Idiopathic dilated cardiomyopathy, Idiopathic inflammatory demyelinating diseases, IgA nephropathy, IgG4-related systemic disease, Inclusion body myositis, Inflamatory Bowel Disease (IBD), Intermediate uveitis, Interstitial cystitis, Juvenile Arthritis, Kawasaki's disease, Lambert-Eaton myasthenic syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease, Lupus nephritis, Lupus vasculitis, Lyme disease, Meniere's disease, Microscopic colitis, Microscopic polyangiitis, Mixed connective tissue disease, Mooren's ulcer, Morphea, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myocarditis, Myositis, Neuromyelitis optica, Neuromyotonia, Opsoclonus myoclonus syndrome, Optic neuritis, Ord's thyroiditis, Palindromic rheumatism, Paraneoplastic cerebellar degeneration, Parry Romberg syndrome, Parsonage-Turner syndrome, Pediatric Autoimmune Neuropsychiatric Disorder Associated with Streptococcus, Pemphigus vulgaris, Pernicious anemia, Pityriasis lichenoides et varioliformis acuta, POEMS syndrome, Polyarteritis nodosa, Polymyalgia rheumatica, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Primary biliary cirrhosis, Primary immunodeficiency, Primary sclerosing cholangitis, Progressive inflammatory neuropathy, Psoriasis, Psoriatic arthritis, Pure red cell aplasia, Pyoderma gangrenosum, Raynaud’s phenomenon, Reactive arthritis, Relapsing polychondritis, Restless leg syndrome, Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Rheumatoid vasculitis, Sarcoidosis, Schnitzler syndrome, Scleroderma, Sjogren's syndrome, Stiff person syndrome, Subacute bacterial endocarditis, Susac's syndrome, Sydenham chorea, Sympathetic ophthalmia, Systemic Lupus Erythematosus, Systemic scleroderma, Thrombocytopenia, Tolosa-Hunt syndrome, Transverse myelitis, Ulcerative colitis, Undifferentiated connective tissue disease, Urticaria, Urticarial vasculitis, Vasculitis, or Vitiligo.

[373] In some embodiments, a target gene (e.g., target endogenous gene) is a gene that is overexpressed or under-expressed in a cancer, for example, acute leukemia, astrocytomas, biliary cancer (cholangiocarcinoma), bone cancer, breast cancer, brain stem glioma, bronchioloalveolar cell lung cancer, cancer of the adrenal gland, cancer of the anal region, cancer of the bladder, cancer of the endocrine system, cancer of the esophagus, cancer of the head or neck, cancer of the kidney, cancer of the parathyroid gland, cancer of the penis, cancer of the pleural / peritoneal membranes, cancer of the salivary gland, cancer of the small intestine, cancer of the thyroid gland, cancer of the ureter, cancer of the urethra, carcinoma of the cervix, carcinoma of the endometrium, carcinoma of the fallopian tubes, carcinoma of the renal pelvis, carcinoma of the vagina, carcinoma of the vulva, cervical cancer, chronic leukemia, colon cancer, colorectal cancer, cutaneous melanoma, ependymoma, epidermoid tumors, Ewings sarcoma, gastric cancer, glioblastoma, glioblastoma multiforme, glioma, hematologic malignancies, hepatocellular (liver) carcinoma, hepatoma, Hodgkin's Disease, intraocular melanoma, Kaposi sarcoma, lung cancer, lymphomas, medulloblastoma, melanoma, meningioma, mesothelioma, multiple myeloma, muscle cancer, neoplasms of the central nervous system (CNS), neuronal cancer, small cell lung cancer, non-small cell lung cancer, osteosarcoma, ovarian cancer, pancreatic cancer, pediatric malignancies, pituitary adenoma, prostate cancer, rectal cancer, renal cell carcinoma, sarcoma of soft tissue, schwanoma, skin cancer, spinal axis tumors, squamous cell carcinomas, stomach cancer, synovial sarcoma, testicular cancer, uterine cancer, or tumors and their metastases, including refractory versions of any of the above cancers, or a combination thereof.

[374] In some disclosures, a target gene (e.g., target endogenous gene) is a differentiation-associated gene, for example, SSEA1, SSEA3 / 4, SSEA5, TRA1-60 / 81, TRA1-85, TRA2-54, GCTM-2, TG343, TG30, CD9, CD29, CD133 / prominin, CD140a, CD56, CD73, CD90, CD105, OCT4, NANOG, SOX2, CD30, CD50, AHR, Aiolos / IKZF3, CDX4, CREB, DNMT3A, DNMT3B, EGR1, FoxO3, GATA-1, GATA-2, GATA-3, Helios, HES-1, HHEX, HIF-1 alpha / HIF1A, HMGB1 / HMG-1, HMGB3, Ikaros, c-Jun, LMO2, LMO4, c-Maf, MafB, MEF2C, MYB, c-Myc, NFATC2, NFIL3 / E4BP4, Nrf2, p53, PITX2, PRDM16 / MEL1, Prox1, PU.1 / Spi-1, RUNX1 / CBFA2, SALL4, SCL / Tal1, Smad2, Smad2 / 3, Smad4, Smad7, Spi-B, STAT Activators, STAT Inhibitors, STAT3, STAT4, STAT5a, STAT6, TSC22, DUX4, DUX4 / DUX4c, DUX4c, EBF-1, EBF-2, EBF-3, ETV5, FoxC2, FoxF1, GATA-4, GATA-6, HMGA2, c-Jun, MYF-5, Myocardin, MyoD, Myogenin, NFATC2, p53, Pax3, PDX-1 / IPF1, PLZF, PRDM16 / MEL1, RUNX2 / CBFA1, Smad1, Smad3, Smad4, Smad5, Smad8, Smad9, Snail, SOX2, SOX9, SOX11, STAT Activators, STAT Inhibitors, STAT1, STAT3, TBX18, Twist-1, Twist-2, Brachyury, EOMES, FoxC2, FoxD3, FoxF1, FoxH1, FoxO1 / FKHR, GATA-2, GATA-3, GBX2, Goosecoid, HES-1, HNF-3 alpha / FoxA1, c-Jun, KLF2, KLF4, KLF5, c-Maf, Max, MEF2C, MIXL1, MTF2, c-Myc, Nanog, NFkB / IkB Activators, NFkB / IkB Inhibitors, NFkB1, NFkB2, Oct-3 / 4, Otx2, p53, Pax2, Pax6, PRDM14, Rex-1 / ZFP42, SALL1, SALL4, Smad1, Smad2, Smad2 / 3, Smad3, Smad4, Smad5, Smad8, Snail, SOX2, SOX7, SOX15, SOX17, STAT Activators, STAT Inhibitors, STAT3, SUZ12, TBX6, TCF-3 / E2A, THAP11, UTF1, WDR5, WT1, ZNF206, ZNF281, KLF2, KLF4, c-Maf, c-Myc, Nanog, Oct-3 / 4, p53, SOX1, SOX2, SOX3, SOX15, SOX18, TBX18, ASCL2 / Mash2, CDX2, DNMT1, ELF3, Ets-1, FoxM1, FoxN1, GATA-6, Hairless, HNF-4 alpha / NR2A1, IRF6, c-Maf, MITF, Miz-1 / ZBTB17, MSX1, MSX2, MYB, c-Myc, Neurogenin-3, NFATC1, NKX3.1, Nrf2, p53, p63 / TP73L, Pax2, Pax3, RUNX1 / CBFA2, RUNX2 / CBFA1, RUNX3 / CBFA3, Smad1, Smad2, Smad2 / 3, Smad4, Smad5, Smad7, Smad8, Snail, SOX2, SOX9, STAT Activators, STAT Inhibitors, STAT3, SUZ12, TCF-3 / E2A, TCF7 / TCF1, Androgen R / NR3C4, AP-2 gamma, beta-Catenin, beta-Catenin Inhibitors, Brachyury, CREB, ER alpha / NR3A1, ER beta / NR3A2, FoxM1, FoxO3, FRA-1, GLI-1, GLI-2, GLI-3, HIF-1 alpha / HIF1A, HIF-2 alpha / EPAS1, HMGA1B, c-Jun, JunB, KLF4, c-Maf, MCM2, MCM7, MITF, c-Myc, Nanog, NFkB / IkB Activators, NFkB / IkB Inhibitors, NFkB1, NKX3.1, Oct-3 / 4, p53, PRDM14, Snail, SOX2, SOX9, STAT Activators, STAT Inhibitors, STAT3, TAZ / WWTR1, TBX3, Twist-1, Twist-2, WT1, or ZEB1.

[375] In some disclosures, a heterologous gene effector is from a gene product that is a hematopoietic stem cell transcription factor. In some disclosures, a target gene is a mesenchymal stem cell transcription factor. In some disclosures, a target gene is an embryonic stem cell transcription factor. In some disclosures, a target gene is an induced pluripotent stem cell (iPSC) transcription factor. In some disclosures, a target gene is an epithelial stem cell transcription factor. In some disclosures, a target gene is a cancer stem cell transcription factor.

[376] In some disclosures, a target gene is an age-related gene. In some disclosures, a target gene is a senescence-associated protein. In some embodiments, a target gene is a drug target.

[377] In some embodiments, a target gene (e.g., target endogenous gene) is a cancer-related gene. Non-limiting examples of cancer-related genes include A1CF, ABI1, ABL1, ABL2, ACKR3, ACSL3, ACSL6, ACVR1, ACVR2A, AFDN, AFF1, AFF3, AFF4, AKAP9, AKT1, AKT2, AKT3, ALDH2, ALK, AMER1, ANK1, APC, APOBEC3B, AR, ARAF, ARHGAP26, ARHGAP5, ARHGEF10, ARHGEF10L, ARHGEF12, ARID1A, ARID1B, ARID2, ARNT, ASPSCR1, ASXL1, ASXL2, ATF1, ATIC, ATM, ATP1A1, ATP2B3, ATR, ATRX, AXIN1, AXIN2, B2M, BAP1, BARD1, BAX, BAZ1A, BCL10, BCL11A, BCL11B, BCL2, BCL2L12, BCL3, BCL6, BCL7A, BCL9, BCL9L, BCLAF1, BCOR, BCORL1, BCR, BIRC3, BIRC6, BLM, BMP5, BMPR1A, BRAF, BRCA1, BRCA2, BRD3, BRD4, BRIP1, BTG1, BTK, BUB1B, C15orf65, CACNA1D, CALR, CAMTA1, CANT1, CARD11, CARS, CASP3, CASP8, CASP9, CBFA2T3, CBFB, CBL, CBLB, CBLC, CCDC6, CCNB1IP1, CCNC, CCND1, CCND2, CCND3, CCNE1, CCR4, CCR7, CD209, CD274, CD28, CD74, CD79A, CD79B, CDC73, CDH1, CDH10, CDH11, CDH17, CDK12, CDK4, CDK6, CDKN1A, CDKN1B, CDKN2A, CDKN2C, CDX2, CEBPA, CEP89, CHCHD7, CHD2, CHD4, CHEK2, CHIC2, CHST11, CIC, CIITA, CLIP1, CLP1, CLTC, CLTCL1, CNBD1, CNBP, CNOT3, CNTNAP2, CNTRL, COL1A1, COL2A1, COL3A1, COX6C, CPEB3, CREB1, CREB3L1, CREB3L2, CREBBP, CRLF2, CRNKL1, CRTC1, CRTC3, CSF1R, CSF3R, CSMD3, CTCF, CTNNA2, CTNNB1, CTNND1, CTNND2, CUL3, CUX1, CXCR4, CYLD, CYP2C8, CYSLTR2, DAXX, DCAF12L2, DCC, DCTN1, DDB2, DDIT3, DDR2, DDX10, DDX3X, DDX5, DDX6, DEK, DGCR8, DICER1, DNAJB1, DNM2, DNMT3A, DROSHA, DUX4L1, EBF1, ECT2L, EED, EGFR, EIF1AX, EIF3E, EIF4A2, ELF3, ELF4, ELK4, ELL, ELN, EML4, EP300, EPAS1, EPHA3, EPHA7, EPS15, ERBB2, ERBB3, ERBB4, ERC1, ERCC2, ERCC3, ERCC4, ERCC5, ERG, ESR1, ETNK1, ETV1, ETV4, ETV5, ETV6, EWSR1, EXT1, EXT2, EZH2, EZR, FAM131B, FAM135B, FAM47C, FANCA, FANCC, FANCD2, FANCE, FANCF, FANCG, FAS, FAT1, FAT3, FAT4, FBLN2, FBXO11, FBXW7, FCGR2B, FCRL4, FEN1, FES, FEV, FGFR1, FGFR1OP, FGFR2, FGFR3, FGFR4, FH, FHIT, FIP1L1, FKBP9, FLCN, FLI1, FLNA, FLT3, FLT4, FNBP1, FOXA1, FOXL2, FOXO1, FOXO3, FOXO4, FOXP1, FOXR1, FSTL3, -90- FUBP1, FUS, GAS7, GATA1, GATA2, GATA3, GLI1, GMPS, GNA11, GNAQ, GNAS, GOLGA5, GOPC, GPC3, GPC5, GPHN, GRIN2A, GRM3, H3F3A, H3F3B, HERPUD1, HEY1, HIF1A, HIP1, HIST1H3B, HIST1H4I, HLA-A, HLF, HMGA1, HMGA2, HMGN2P46, HNF1A, HNRNPA2B1, HOOK3, HOXA11, HOXA13, HOXA9, HOXC11, HOXC13, HOXD11, HOXD13, HRAS, HSP90AA1, HSP90AB1, ID3, IDH1, IDH2, IGF2BP2, IGH, IGK, IGL, IKBKB, IKZF1, IL2, IL21R, IL6ST, IL7R, IRF4, IRS4, ISX, ITGAV, ITK, JAK1, JAK2, JAK3, JAZF1, JUN, KAT6A, KAT6B, KAT7, KCNJ5, KDM5A, KDM5C, KDM6A, KDR, KDSR, KEAP1, KIAA1549, KIF5B, KIT, KLF4, KLF6, KLK2, KMT2A, KMT2C, KMT2D, KNL1, KNSTRN, KRAS, KTN1, LARP4B, LASP1, LATS1, LATS2, LCK, LCP1, LEF1, LEPROTL1, LHFPL6, LIFR, LMNA, LMO1, LMO2, LPP, LRIG3, LRP1B, LSM14A, LYL1, LZTR1, MACC1, MAF, MAFB, MALAT1, MALT1, MAML2, MAP2K1, MAP2K2, MAP2K4, MAP3K1, MAP3K13, MAPK1, MAX, MB21D2, MDM2, MDM4, MDS2, MECOM, MED12, MEN1, MET, MGMT, MITF, MLF1, MLH1, MLLT1, MLLT10, MLLT11, MLLT3, MLLT6, MN1, MNX1, MPL, MRTFA, MSH2, MSH6, MSI2, MSN, MTCP1, MTOR, MUC1, MUC16, MUC4, MUTYH, MYB, MYC, MYCL, MYCN, MYD88, MYH11, MYH9, MYO5A, MYOD1, N4BP2, NAB2, NACA, NBEA, NBN, NCKIPSD, NCOA1, NCOA2, NCOA4, NCOR1, NCOR2, NDRG1, NF1, NF2, NFATC2, NFE2L2, NFIB, NFKB2, NFKBIE, NIN, NKX2-1, NONO, NOTCH1, NOTCH2, NPM1, NR4A3, NRAS, NRG1, NSD1, NSD2, NSD3, NT5C2, NTHL1, NTRK1, NTRK3, NUMA1, NUP214, NUP98, NUTM1, NUTM2B, NUTM2D, OLIG2, OMD, P2RY8, PABPC1, PAFAH1B2, PALB2, PATZ1, PAX3, PAX5, PAX7, PAX8, PBRM1, PBX1, PCBP1, PCM1, PDCD1LG2, PDE4DIP, PDGFB, PDGFRA, PDGFRB, PER1, PHF6, PHOX2B, PICALM, PIK3CA, PIK3CB, PIK3R1, PIM1, PLAG1, PLCG1, PML, PMS1, PMS2, POLD1, POLE, POLG, POLQ, POT1, POU2AF1, POU5F1, PPARG, PPFIBP1, PPM1D, PPP2R1A, PPP6C, PRCC, PRDM1, PRDM16, PRDM2, PREX2, PRF1, PRKACA, PRKAR1A, PRKCB, PRPF40B, PRRX1, PSIP1, PTCH1, PTEN, PTK6, PTPN11, PTPN13, PTPN6, PTPRB, PTPRC, PTPRD, PTPRK, PTPRT, PWWP2A, QKI, RABEP1, RAC1, RAD17, RAD21, RAD51B, RAF1, RALGDS, RANBP2, RAP1GDS1, RARA, RB1, RBM10, RBM15, RECQL4, REL, RET, RFWD3, RGPD3, RGS7, RHOA, RHOH, RMI2, RNF213, RNF43, ROBO2, ROS1, RPL10, RPL22, RPL5, RPN1, RSPO2, RSPO3, RUNX1, RUNX1T1, S100A7, SALL4, SBDS, SDC4, SDHA, SDHAF2, SDHB, SDHC, SDHD, 44444, 44445, 44448, SET, SETBP1, SETD1B, SETD2, SETDB1, SF3B1, SFPQ, SFRP4, SGK1, SH2B3, SH3GL1, SHTN1, SIRPA, SIX1, SIX2, SKI, SLC34A2, SLC45A3, SMAD2, SMAD3, SMAD4, SMARCA4, SMARCB1, SMARCD1, SMARCE1, SMC1A, SMO, SND1, SNX29, SOCS1, SOX2, SOX21, SPECC1, SPEN, SPOP, SRC, SRGAP3, SRSF2, SRSF3, SS18, SS18L1, SSX1, SSX2, SSX4, STAG1, STAG2, STAT3, STAT5B, STAT6, STIL, STK11, STRN, SUFU, -91- SUZ12, SYK, TAF15, TAL1, TAL2, TBL1XR1, TBX3, TCEA1, TCF12, TCF3, TCF7L2, TCL1A, TEC, TENT5C, TERT, TET1, TET2, TFE3, TFEB, TFG, TFPT, TFRC, TGFBR2, THRAP3, TLX1, TLX3, TMEM127, TMPRSS2, TNC, TNFAIP3, TNFRSF14, TNFRSF17, TOP1, TP53, TP63, TPM3, TPM4, TPR, TRA, TRAF7, TRB, TRD, TRIM24, TRIM27, TRIM33, TRIP11, TRRAP, TSC1, TSC2, TSHR, U2AF1, UBR5, USP44, USP6, USP8, VAV1, VHL, VTI1A, WAS, WDCP, WIF1, WNK2, WRN, WT1, WWTR1, XPA, XPC, XPO1, YWHAE, ZBTB16, ZCCHC8, ZEB1, ZFHX3, ZMYM2, ZMYM3, ZNF331, ZNF384, ZNF429, ZNF479, ZNF521, ZNRF3, and ZRSR2.

[378] In some embodiments, a target gene (e.g., target endogenous gene) is an immune cell-related gene, for example, a cytokine, cytokine receptor, chemokine, chemokine receptor, co-inhibitory immune receptor, co-stimulatory immune receptor, immune cell transcription factor, etc.

[379] In some disclosures, a target gene (e.g., target endogenous gene) is a cytokine, for example, 4-1BBL, APRIL, CD153, CD154, CD178, CD70, G-CSF, GITRL, GM-CSF, IFN-a, IFN-P, IFN-y, IL-1RA, IL-1a, IL-1p, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-20, IL-23, LIF, LIGHT, LT-p, M-CSF, MSP, OSM, OX40L, SCF, TALL-1, TGF-P, TGF-P1, TGF-P2, TGF-P3, TNF-a, TNF-P, TRAIL, TRANCE, or TWEAK.

[380] In some disclosures, a target gene (e.g., target endogenous gene) is a cytokine receptor, for example, A common gamma chain receptor, a common beta chain receptor, an interferon receptor, a TNF family receptor, a TGF-B receptor, Apo3, BCMA, CD114, CD115, CD116, CD117, CD118, CD120, CD120a, CD120b, CD121, CD121a, CD121b, CD122, CD123, CD124, CD126, CD127, CD130, CD131, CD132, CD212, CD213, CD213a1, CD213a13, CD213a2, CD25, CD27, CD30, CD4, CD40, CD95 (Fas), CDw119, CDw121b, CDw125, CDw131, CDw136, CDw137 (41BB), CDw210, CDw217, GITR, HVEM, IL-11R, IL-11Ra, IL-14R, IL-15R, IL-15Ra, IL-18R, IL-18Ra, IL-18RP, IL-20R, IL-20Ra, IL-20RP, IL-9R, LIFR, LTPR, OPG, OSMR, OX40, RANK, TACI, TGF-PR1, TGF-PR2, TGF-PR3, TRAILR1, TRAILR2, TRAILR3, or TRAILR4.

[381] In some disclosures, a target gene (e.g., target endogenous gene) is a chemokine, for example, ACT-2, AMAC-a, ATAC, ATAC, BLC, CCL1, CCL11, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL2, CCL20, CCL21, CCL22, CCL23, CCL24, CCL25, CCL26, CCL27, CCL3, CCL4, CCL5, CCL7, CCL8, CKb-6, CKb-8, CTACK, CX3CL1, CXCL1, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, DC-CK1, ELC, ENA-78, eotaxin, eotaxin-2, eotaxin-3, Eskine, exodus-1, exodus-2, exodus-3, fractalkine, GCP-2, GROa, GROb, GROg, HCC-1, HCC--92- 2, HCC-4, I-309, IL-8, ILC, IP-10, I-TAC, LAG-1, LARC, LCC-1, LD78a, LEC, Lkn-1, LMC, lymphoactin, lymphoactin b, MCAF, MCP-1, MCP-2, MCP-3, MCP-4, MDC, MDNCF, MGSA-a, MGSA-b, MGSA-g, Mig, MIP-1d, MIP-1a, MIP-1p, MIP-2a, MIP-2b, MIP-3, MIP-3a, MIP-3p, MIP-4, MIP-4a, MIP-5, MPIF-1, MPIF-2, NAF, NAP-1, NAP-2, oncostatin, PARC, PF4, PPBP, RANTES, SCM-1a, SCM-1b, SDF-1a / p -, SLC, STCP-1, TARC, TECK, XCL1, or XCL2.

[382] In some embodiments, a target gene (e.g., target endogenous gene) is a chemokine receptor, for example, CCR1, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9, CCR10, CX3CR1, CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, XCR1, or XCR1.

[383] In some disclosures, a target gene (e.g., target endogenous gene) is an activating NK receptor, for example, CD100 (SEMA4D), CD16 (FcgRIIIA), CD160 (BY55), CD244 (2B4, SLAMF4), CD27, CD94- NKG2C, CD94- NKG2E, CD94-NKG2H, CD96, CRTAM, DAP12, DNAM1 (CD226), KIR2DL4, KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, Ly49, NCR, NKG2D (KLRK1, CD314), NKp30 (NCR3), NKp44 (NCR2), NKp46 (NCR1), NKp80 (KLRF1, CLEC5C), NTB-A (SLAMF6), PSGL1, or SLAMF7 (CRACC, CS1, CD319).

[384] In some disclosures, a target gene (e.g., target endogenous gene) is an inhibitory NK receptor, for example, CD161 (NKR-P1A, NK1.1), CD94- NKG2A, CD96, CEACAM1, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR3DL1, KIR3DL2, KIR3DL3, KLRG1, LAIR1, LIR1 (ILT2, LILRB1), Ly49a, Ly49b, NKR-P1A (KLRB1), SIGLEC-10, SIGLEC-11, SIGLEC-14, SIGLEC-16, SIGLEC-3 (CD33), SIGLEC-5 (CD170), SIGLEC-6 (CD327), SIGLEC-7 (CD328), SIGLEC-8, SIGLEC-9 (CD329), SIGLEC-E, SIGLEC-F, SIGLEC-G, SIGLEC-H, or TIGIT.

[385] In some disclosures, a target gene (e.g., target endogenous gene) is a co-inhibitory immune receptor, for example, 2B4, B7-1, BTLA, CD160, CTLA-4, DR6, Fas, LAG3, LAIR1, Ly108, PD-1, PD-L1, PD1H, TIGIT, TIM1, TIM2, or TIM3.

[386] In some disclosures, a target gene (e.g., target endogenous gene) is co-stimulatory immune receptor, for example, 2B4, 4-1BB, CD2, CD4, CD8, CD21, CD27, CD28, CD30, CD40, CD84, CD226, CD355, CRACC, DcR3, DR3, GITR, HVEM, ICOS, Ly9, Ly108, LIGHT, LTpR, OX40, SLAM, TIM1, or TIM2.

[387] In some embodiments, a target gene (e.g., target endogenous gene) is itself a gene effector, such as any of the gene effectors disclosed herein (e.g., a transcription factor disclosed herein).

[388] In some disclosures, a target gene (e.g., target endogenous gene) is an immune cell transcription factor, for example, AP-1, Bcl6, E2A, EBF, Eomes, FoxP3, GATA3, Id2, Ikaros, -93- IRF, IRF1, IRF2, IRF3, IRF3, IRF7, NFAT, NFkB, Pax5, PLZF, PU.1, ROR-gamma-T, STAT, STAT1, STAT2, STAT3, STAT4, STAT5, STAT5A, STAT5B, STAT6, T-bet, TCF7, or ThPOK.

[389] In some disclosures, a target gene is a kinase, for example, a tyrosine kinase, or serine / threonine kinase. In some disclosures, a target gene is a phosphatase, for example, a tyrosine phosphatase, or serine / threonine phosphatase.

[390] In some disclosures, a target gene is a receptor. In some disclosures, a target gene is an ion channel. In some embodiments, a target gene is a GPCR. In some disclosures, a target gene is a receptor tyrosine kinase. In some disclosures, a target gene is a ribosomal protein. In some embodiments, a target gene is a membrane protein. In some embodiments, a target gene is a cytoplasmic protein. In some disclosures, a target gene is a nuclear protein. In some disclosures, a target gene is a mitochondrial protein. In some disclosures, a target gene is a ubiquitin ligase. In some disclosures, a target gene is a methyltransferase. In some disclosures, a target gene is a glycosyltransferase. In some disclosures, a target gene is a hydrolase.

[391] In some embodiments, CD45 is a target gene used in compositions and methods of the disclosure (e.g., for gene expression activation screens). In some embodiments, CD45 is not used as a target gene. Compositions and methods disclosed herein to identify complexes that modulate CD45 expression can similarly be modified and adapted to other target genes (e.g., target endogenous genes), including those disclosed herein.

[392] In some embodiments, CD71 is a target gene used in compositions and methods of the disclosure (e.g., for gene expression reduction screens). In some embodiments, CD71 is not used as a target gene. Compositions and methods disclosed herein to identify complexes that modulate CD71 expression can similarly be modified and adapted to other target genes (e.g., target endogenous genes), including those disclosed herein. LIBRARIES

[393] Disclosed herein, are libraries of complexes. Libraries of the disclosure can be useful in screening assays to identify heterologous gene effectors, combinations thereof, and complexes containing the same that elicit desirable changes in expression and / or activity levels of target genes (e.g., target endogenous genes). Libraries of the disclosure can be assayed using methods disclosed herein in various cell types from various sources to identify heterologous gene effectors, combinations thereof, and complexes containing the same that are capable of eliciting the desirable changes in expression and / or activity levels of target gene(s) (e.g., target endogenous gene(s)) in the cell type of interest, for example, in cells from a certain subject, a particular tissue or lineage, a subject with a given disease or condition, etc.

[394] Complexes that are members of a library can share a common attribute, such as sharing the same guide moiety, guide nucleic acid, source of heterologous gene effectors that are present in the library, class of target genes, etc. In some disclosures, where a library comprises complexes with two or more heterologous gene effectors per complex, one of the heterologous gene effectors can share a common attribute with other members of the library, while the other may not share a common attribute. In some disclosures, where a library comprises complexes with two or more heterologous gene effectors per complex, one of the heterologous gene effectors can share a first common attribute with other members of the library, and the second heterologous gene effector can share a second common attribute with other members of the library. In some disclosures, a library is designed without a common attribute amongst heterologous gene effectors, e.g., an unbiased library.

[395] In some disclosures, a library of complexes comprises heterologous gene effectors from human sources. In some disclosures, a library of complexes comprises heterologous gene effectors from viral sources. In some disclosures, a library of complexes comprises heterologous gene effectors from other sources disclosed herein.

[396] In some disclosures, a library of complexes comprises heterologous gene effectors from a particular source, for example, each of the heterologous gene effectors can be derived from a human protein, a viral protein, a mammalian protein, a protein that primarily localizes to the nucleus, a chromatin regulator, a factor that facilitates heterochromatin formation, a factor that modulates histones through methylation, a factor that modulates histones through acetylation, a factor that modulates histones through phosphorylation, a factor that modulates histones through ADP-ribosylation, a factor that modulates histones through glycosylation, a factor that modulates histones through SUMOylation, a factor that modulates histones through ubiquitination, a factor that modulates histones by remodeling histone structure, e.g., via an ATP hydrolysis-dependent process, a histone acetyltransferase, a histone lysine methyltransferase, a component of a chromatin remodeling complex, a transcriptional regulator, a transcriptional activator, a transcriptional repressor domain, a transcription factor, a mesenchymal stem cell transcription factor, an embryonic stem cell transcription factor, an induced pluripotent stem cell (iPSC) transcription factor, an epithelial stem cell transcription factor, a cancer stem cell transcription factor, a cancer-related transcription factor, an immune cell transcription factor, a nuclear receptor, a nuclear hormone receptor, a validated human virus transcriptional regulator, a factor from a genome of a virus (e.g., from a virus family, subfamily, genus, species etc. disclosed herein), a factor from a genome of a virus that is capable of zoonotic transmission to humans, a factor from a shared human / bat virus, a factor from a viral genome from a metagenomic survey, a factor from a virus found in the human gut, a factor from a virus found in extreme environments, a factor from a virus or protein class with a high degree of documented transcriptional regulator modularity, or another source disclosed herein.

[397] In some disclosures, a library of complexes comprises heterologous gene effectors from a combination of sources from, e.g., any two or more of a human protein, a viral protein, a mammalian protein, a protein that primarily localizes to the nucleus, a chromatin regulator, a factor that facilitates heterochromatin formation, a factor that modulates histones through methylation, a factor that modulates histones through acetylation, a factor that modulates histones through phosphorylation, a factor that modulates histones through ADP-ribosylation, a factor that modulates histones through glycosylation, a factor that modulates histones through SUMOylation, a factor that modulates histones through ubiquitination, a factor that modulates histones by remodeling histone structure, e.g., via an ATP hydrolysis-dependent process, a histone acetyltransferase, a histone lysine methyltransferase, a component of a chromatin remodeling complex, a transcriptional regulator, a transcriptional activator, a transcriptional repressor domain, a transcription factor, a mesenchymal stem cell transcription factor, an embryonic stem cell transcription factor, an induced pluripotent stem cell (iPSC) transcription factor, an epithelial stem cell transcription factor, a cancer stem cell transcription factor, a cancer-related transcription factor, an immune cell transcription factor, a nuclear receptor, a nuclear hormone receptor, a validated human virus transcriptional regulator, a factor from a genome of a virus (e.g., from a virus family, subfamily, genus, species etc. disclosed herein), a factor from a genome of a virus that is capable of zoonotic transmission to humans, a factor from a shared human / bat virus, a factor from a viral genome from a metagenomic survey, a factor from a virus found in the human gut, a factor from a virus found in extreme environments, a factor from a virus or protein class with a high degree of documented transcriptional regulator modularity, or another source disclosed herein.

[398] In some disclosures, a library of complexes comprises heterologous gene effectors from a particular subcellular localization, for example, factors that are capable of localizing or primarily localize to the nucleus of cells.

[399] In some disclosures, an individual complex of a library comprises (i) a heterologous gene effector that is different from heterologous gene effectors in other complexes of the library; and (ii) a guide nucleic acid sequence that exhibits 100% sequence identity to guide nucleic acid sequences in the other complexes of the library.

[400] In some disclosures, different individual complexes of a library comprise guide nucleic acids with at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or -96- 100% sequence identity to guide nucleic acid sequences in the other complexes of the library. In some cases, even if the guide nucleic acid molecules (e.g., sgRNAs) in the library disclosed herein do not exhibit 100% sequence identity to each other (e.g., between about 80% and 99% sequence identity among each other), the guide nucleic acid molecules may be capable of binding and complexing with the same target gene (e.g., the same target polynucleotide sequence, such as the same genomic sequence).

[401] In some disclosures, an individual complexes of a library comprises (i) a heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (ii) a guide moiety (e.g., comprising a guide nucleic acid sequence) that is similar to or the same as other individual complexes in the library, for example, the same for all individual complexes in the library. In some disclosures, the guide moiety comprises a nuclease as disclosed herein, for example, an endonuclease that is heterologous with respect to the gene effector. The nuclease can be a nuclease-deficient or nuclease-dead nuclease of the disclosure. The nuclease can exhibit 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library.

[402] In some disclosures, an individual complexes of a library comprises (i) a first heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (ii) a second heterologous gene effector that is the same as heterologous gene effectors present in other individual complexes in the library; and (iii) a guide moiety that is the same as other individual complexes in the library, for example, the same for all individual complexes in the library. The guide moiety can be or can comprise a guide nucleic acid that exhibits 100% identity to other (e.g., all) other individual complexes in the library. The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that exhibits 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library.

[403] In some disclosures, an individual complexes of a library comprises (i) a first heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (ii) a second heterologous gene effector that is the same as heterologous gene effectors present in other individual complexes in the library; (iii) a third heterologous gene effector that is the same as heterologous gene effectors present in other individual complexes in the library; and (iv) a guide moiety that is the same as other individual complexes in the library, for example, the same for all individual complexes in the library. The guide moiety can be or can comprise a guide nucleic acid that exhibits 100% identity to other (e.g., all other individual complexes) in the library. The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that exhibits 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library.

[404] In some disclosures, an individual complexes of a library comprises (i) a first heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (ii) a second heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (iii) a third heterologous gene effector that is the same as heterologous gene effectors present in other individual complexes in the library; and (iv) a guide moiety that is the same as other individual complexes in the library, for example, the same for all individual complexes in the library. The guide moiety can be or can comprise a guide nucleic acid that exhibits 100% identity to other (e.g., all other individual complexes) in the library. The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that exhibits 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library.

[405] In some disclosures, an individual complexes of a library comprises (i) a first heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (ii) a second heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library and the same as yet other individual complexes in the library; (iii) a third heterologous gene effector that is the same as heterologous gene effectors present in other individual complexes in the library; and (iv) a guide moiety that is the same as other individual complexes in the library, for example, the same for all individual complexes in the library. The guide moiety can be or can comprise a guide nucleic acid that exhibits 100% identity to other (e.g., all other) individual complexes in the library). The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that exhibits 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library.

[406] In some disclosures, an individual complexes of a library comprises (i) a first heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; (ii) a second heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library and the same as yet other individual complexes in the library; (iii) a third heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; and (iv) a guide moiety that is the same as other individual complexes in the library, for example, the same for all individual complexes in the library. The guide moiety can be or can comprise a guide nucleic acid that exhibits 100% identity to other (e.g., all other) individual complexes in the library). The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that -98- exhibits 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library.

[407] In some disclosures, an individual complexes of a library comprises (i) a heterologous gene effector that is different to heterologous gene effectors present in other individual complexes in the library; and (ii) a guide moiety (e.g., comprising a guide nucleic acid sequence) that is different to other individual complexes in the library. The guide moiety can comprise a guide nucleic acid sequence that is different to guide sequences present in other individual complexes in the library. The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that exhibits 100% sequence identity to heterologous nuclease of other complexes (e.g., all other complexes) in the library. The guide moiety can comprise a nuclease (e.g., a heterologous endonuclease) that is different to other individual complexes in the library.

[408] In some disclosures, individual complexes of a library (e.g., that comprise different heterologous gene effectors) specifically bind to the same target gene (e.g., target endogenous gene) or target gene regulatory sequence. In some disclosures, individual complexes of a library (e.g., that comprise the same and / or different heterologous gene effectors) specifically bind to different parts (e.g., subsequences) of a target gene or target gene regulatory sequence. In some disclosures, individual complexes of a library (e.g., that comprise the same and / or different heterologous gene effectors) specifically bind to different target gene regulatory sequences, each of which is capable of regulating expression of the same gene. In some disclosures, individual complexes of a library (e.g., that comprise the same and / or different heterologous gene effectors) specifically bind to different target genes (e.g., target endogenous genes) or target gene regulatory sequences.

[409] A library of the disclosure can comprise, consist essentially of, or consist of any suitable number of different complexes for the intended purpose of the library. In some disclosures, “different complexes”, “individual complexes”, or “different individual complexes” can refer to members of the library that differ in composition from each other, for example, comprise different heterologous gene effectors (or combinations of heterologous gene effectors) compared to each other. In such cases multiple copies of the “different complexes”, “individual complexes”, or “different individual complexes” can be present in the library, and multiple copies of the same complex are not “different complexes”, “individual complexes”, or “different individual complexes”. For example, in a library can comprise 5 different complexes, each of which contains a different heterologous gene effector, and 100 copies of each complex can be present in the library, resulting in a library with 500 molecular complexes but only 5 “different complexes”.

[410] In some disclosures, a library of the disclosure comprises at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, at least 170, at least 180, at least 190, at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 550, at least 600, at least 650, at least 700, at least 750, at least 800, at least 850, at least 900, at least 950, at least 1000, at least 1100, at least 1200, at least 1300, at least 1400, at least 1500, at least 1600, at least 1700, at least 1800, at least 1900, at least 2000, at least 2500, at least 3000, at least 3500, at least 4000, at least 4500, at least 5000, at least 5500, at least 6000, at least 6500, at least 7000, at least 7500, at least 8000, at least 8500, at least 9000, at least 9500, at least 10000, at least 10500, at least 11000, at least 11500, at least 12000, at least 12500, at least 13000, at least 13500, at least 14000, at least 14500, at least 15000, at least 15500, at least 16000, at least 16500, at least 17000, at least 17500, at least 18000, at least 18500, at least 19000, at least 19500, at least 20000, at least 20500, at least 21000, at least 21500, at least 22000, at least 22500, at least 23000, at least 23500, at least 24000, at least 24500, at least 25000, at least 25500, at least 26000, at least 26500, at least 27000, at least 27500, at least 28000, at least 28500, at least 29000, at least 29500, at least 30000, at least 35000, at least 40000, at least 45000, at least 50000, at least 60000, at least 70000, at least 80000, at least 90000, or at least 100000 different complexes.

[411] In some disclosures, a library of the disclosure comprises at least 25 different complexes. In some disclosures, a library of the disclosure comprises at least 100 different complexes. In some disclosures, a library of the disclosure comprises at least 500 different complexes. In some disclosures, a library of the disclosure comprises at least 1000 different complexes. In some disclosures, a library of the disclosure comprises at least 15000 different complexes. In some disclosures, a library of the disclosure comprises at least 25000 different complexes.

[412] In some disclosures, a library of the disclosure comprises at most 5, at most 10, at most 15, at most 20, at most 25, at most 30, at most 35, at most 40, at most 45, at most 50, at most 60, at most 70, at most 80, at most 90, at most 100, at most 110, at most 120, at most 130, at most 140, at most 150, at most 160, at most 170, at most 180, at most 190, at most 200, at most 250, at most 300, at most 350, at most 400, at most 450, at most 500, at most 550, at most 600, at most 650, at most 700, at most 750, at most 800, at most 850, at most 900, at most 950, at most 1000, at most 1100, at most 1200, at most 1300, at most 1400, at most 1500, at most 1600, at most 1700, at most 1800, at most 1900, at most 2000, at most 2500, at most 3000, at most 3500, at most 4000, at most 4500, at most 5000, at most 5500, at most 6000, at most 6500, at most 7000, at most 7500, at most 8000, at most 8500, at most 9000, at most 9500, at most 10000, at most 10500, at most 11000, at most 11500, at most 12000, at most 12500, at most 13000, at most -100- 13500, at most 14000, at most 14500, at most 15000, at most 15500, at most 16000, at most 16500, at most 17000, at most 17500, at most 18000, at most 18500, at most 19000, at most 19500, at most 20000, at most 20500, at most 21000, at most 21500, at most 22000, at most 22500, at most 23000, at most 23500, at most 24000, at most 24500, at most 25000, at most 25500, at most 26000, at most 26500, at most 27000, at most 27500, at most 28000, at most 28500, at most 29000, at most 29500, at most 30000, at most 35000, at most 40000, at most 45000, at most 50000, at most 60000, at most 70000, at most 80000, at most 90000, or at most 100000 different complexes.

[413] In some disclosures, a library of the disclosure comprises at most 100000 different complexes. In some disclosures, a library of the disclosure comprises at most 50000 different complexes. In some disclosures, a library of the disclosure comprises at most 30000 different complexes. In some disclosures, a library of the disclosure comprises at most 20000 different complexes.

[414] In some disclosures, a library of the disclosure comprises at least 25 different complexes and at most 100, at most 110, at most 120, at most 130, at most 140, at most 150, at most 160, at most 170, at most 180, at most 190, at most 200, at most 250, at most 300, at most 350, at most 400, at most 450, at most 500, at most 550, at most 600, at most 650, at most 700, at most 750, at most 800, at most 850, at most 900, at most 950, at most 1000, at most 1100, at most 1200, at most 1300, at most 1400, at most 1500, at most 1600, at most 1700, at most 1800, at most 1900, at most 2000, at most 2500, at most 3000, at most 3500, at most 4000, at most 4500, at most 5000, at most 5500, at most 6000, at most 6500, at most 7000, at most 7500, at most 8000, at most 8500, at most 9000, at most 9500, at most 10000, at most 10500, at most 11000, at most 11500, at most 12000, at most 12500, at most 13000, at most 13500, at most 14000, at most 14500, at most 15000, at most 15500, at most 16000, at most 16500, at most 17000, at most 17500, at most 18000, at most 18500, at most 19000, at most 19500, at most 20000,...

Claims

1. A complex comprising:a guide moiety, comprising:a guide nucleic acid; anda nuclease-deactivated Cas protein complexed with the guide nucleic acid; anda heterologous gene effector coupled to the nuclease-deactivated Cas protein, wherein the heterologous gene effector comprises an amino acid sequence with at least 90% sequence identity to SEQ ID NO: 23631.

2. The complex of claim 1, whereinthe heterologous gene effector comprises the amino acid sequence of SEQ ID NO: 23631.

3. The complex of any one of claims 1-2, wherein:(a) the heterologous gene effector contains less than 500 amino acids, or less than 100 amino acids,(b) the guide moiety specifically binds to a target gene or a target gene regulatory sequence,(c) the guide moiety and the heterologous gene effector are fused to each other, optionally via a linker, and / or(d) the guide moiety and the heterologous gene effector are non-covalently coupled to each other.

4. The complex of any one of the preceding claims, wherein:(a) the guide nucleic acid is a guide RNA, or(b) the guide nucleic acid is a single guide RNA (sgRNA).

5. The complex of any one of the preceding claims, wherein the heterologous gene effector is fused to the nuclease-deactivated Cas protein, and wherein the combined length of the heterologous gene effector and the nuclease-deactivated Cas protein is at most 1,200 amino acids.

6. A vector comprising the complex of any one of the preceding claims.

7. A vector comprising a nucleic acid that encodes the heterologous gene effector of the complex of any one of claims 1-5, optionally wherein the vector further comprises a nucleic acid that encodes the guide moiety or a component thereof.

8. An isolated population of cells comprising the complex of any one of claims 1-5.

9. A method of modulating expression or activity of a target gene, the method comprising contacting in vitro or ex vivo a population of cells that comprise the target gene with the complex of any one of claims 1-5 or the vector of any one of claims 6-7.

10. The complex of any one of claims 1-5 or the vector of any one of claims 6-7 for use in a method of treating a subject in need thereof, the method comprising administering to the subject the complex or the vector, thereby modulating expression or activity of a target gene in a population of cells in the subject.11.The method of claim 9, wherein(a) the population of cells comprises mammalian cells, or the population of cells comprises human cells; and / or(b) the population of cells comprises stem cells, or the population of cells comprises differentiated cells.

12. The method of claim 9 or 11, wherein(a) the target gene is a target endogenous gene;(b) the target gene is a disease-associated gene; and / or(c) the target gene is a differentiation- associated gene.

13. The method of any one of claims 9, 11 and 12, wherein modulating expression or activity comprises increasing expression or activity level of the target gene.14.. The method of any one of claims 9 and 11-13, wherein(a) the expression or activity of the target gene is modulated for a period of time that is at least 10% longer than a control, optionally wherein the control is the population of cells prior to the contacting, or the control is a population of cells not contacted with the complex;(b) the expression or activity of the target gene is modulated for at least 12 hours; and / or(c) the expression or activity of the target gene is modulated for at least 28 days.

15. The method of claim 9,wherein the expression or activity of the target gene is increased compared to the expression or activity of the target gene in a control population of cells,wherein the control population of cells comprises a population of cells that comprises the target gene, and is not contacted with the complex.