Rapamycin resistant cells

Abstract

To provide compositions including proteins for expression in host cells to render them resistant to rapamycin, and methods of using the proteins, cells, and compositions disclosed herein for modulating cell signaling and for selective cell expansion.SOLUTION: Provided herein is a system comprising: a deoxyribonucleic acid (DNA) endonuclease or a nucleic acid encoding the DNA endonuclease; a guide RNA (gRNA) comprising a spacer sequence complementary to a target sequence within a target genomic locus in a cell, or nucleic acid encoding the gRNA; and a donor template including a donor cassette comprising a nucleic acid sequence encoding a naked FKBP-rapamycin binding (FRB) domain polypeptide.SELECTED DRAWING: None

Description

[Technical field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of priority to U.S. Provisional Application No. 62 / 663,562, entitled "Rapamycin-Resistant Cells," filed April 27, 2018, which is expressly incorporated by reference in its entirety.

[0002] Sequence Listing Reference This application has been filed with an electronic Sequence Listing, which has been provided as an approximately 120 kb file created on April 25, 2019 under the file name SCRI186WOSEQLISTING. The information set forth in the electronic Sequence Listing is incorporated herein by reference in its entirety.

[0003] The present invention provides a chemically induced signaling complex in which the two components are combined in the presence of rapamycin or a related compound, which is an active signaling complex that is used with naked FKBP-rapamycin binding protein expressed in a cell to confer rapamycin resistance to a host cell. [Background technology]

[0004] Rapamycin, also known as sirolimus, is a complex macrolide natural product isolated in 1975 from the bacterium Streptomyces hygroscopicus, which was discovered in soil samples from Easter Island (also known as Rapa Nui) (Huang, S. et al. (2003). Cancer Biol. Ther., 2(3):222-232; Abraham, RT et al. (1996). Ann. Rev. Immunol., 14:483-510; Pollock, R. et al. (2002). Curr. Opin. Biotechnol., 13(5):459-467; Bayle, JH et al. (2006). Chem. Biol., 13(1):99-107). Rapamycin mediates heterodimerization of FKBP12 protein (FK506 binding protein 12) and FRB (FKBP12 rapamycin binding domain) (Huang, S. et al. (2003). Cancer Biol. Ther., 2(3):222-232). Rapamycin has excellent physiological properties, such as good solubility, membrane permeability across the blood-brain barrier, and good pharmacokinetic parameters such as oral bioavailability (Abraham, RT et al. (1996). Ann. Rev. Immunol., 14:483-510), and has been used as a small molecule dimerizer in a wide range of applications in mammalian cells and organisms (see, for example, Pollock, R. et al. (2002). Curr. Opin. Biotechnol., 13(5):459-467).

[0005] CISC (chemically induced signaling complex) is a synthetic protein complex consisting of multiple components that are configured to be co-expressed as two chimeric proteins in a host cell, as described in International Patent Application PCT / US2017 / 065746, which is incorporated herein by reference in its entirety. CISC contains two chimeric protein components, one of which is an extracellular domain that constitutes one half of a rapamycin-binding complex, which is fused to an intracellular signaling complex that constitutes the other half of the rapamycin-binding complex. By delivering a nucleic acid encoding CISC to a host cell, intracellular signaling that can be controlled by the presence of rapamycin or a rapamycin-related compound can be generated in the host cell.

[0006] On the other hand, although rapamycin-induced CISC dimerization can induce intracellular signaling, the presence of rapamycin inhibits host cell proliferation and viability, limiting its usefulness in therapeutic and research applications.Therefore, there is a need for novel compositions and methods that can utilize rapamycin-mediated intracellular signaling by CISC and mitigate the adverse effects of rapamycin or rapamycin-related compounds on host cell proliferation and viability. Summary of the Invention [Means for solving the problem]

[0007] Provided herein, inter alia, are compositions and methods for conferring rapamycin resistance to cells.

[0008] In one embodiment, (i) a deoxyribonucleic acid (DNA) endonuclease, or a nucleic acid encoding the DNA endonuclease; (ii) a guide RNA (gRNA) comprising a spacer sequence complementary to a target sequence within a target genomic locus of the cell, or a nucleic acid encoding the gRNA; and (iii) a donor template comprising a donor cassette comprising a nucleic acid sequence encoding a naked FKBP-rapamycin binding (FRB) domain polypeptide; A system comprising: The system is characterized in that the DNA endonuclease, the gRNA and the donor template are configured such that a complex formed by association of the DNA endonuclease with the gRNA promotes targeted integration of the donor cassette into the target genomic locus of a cell to generate a genetically modified cell capable of expressing the naked FRB domain polypeptide. In some embodiments, the DNA endonuclease is a Cas9 endonuclease. In some embodiments, the nucleic acid encoding the DNA endonuclease is codon-optimized for expression in the genetically modified cell; the nucleic acid encoding the gRNA is codon-optimized for expression in the genetically modified cell; and / or one or more coding sequences in the donor cassette are codon-optimized for expression in the genetically modified cell. In some embodiments, the donor template is configured such that integration of the donor cassette into the target genomic locus occurs by homology directed repair (HDR). In some embodiments, the donor template is configured such that integration of the donor cassette into the target genomic locus occurs by non-homologous end joining (NHEJ). In some embodiments, the DNA endonuclease or the nucleic acid encoding the DNA endonuclease is formulated by encapsulation in a liposome or lipid nanoparticle. In some embodiments, the liposome or the lipid nanoparticle further comprises the gRNA or the nucleic acid encoding the gRNA. In some embodiments, the system further comprises a ribonucleoprotein (RNP) complex formed by association of the DNA endonuclease and the gRNA.

[0009] In some embodiments, a naked FKBP-rapamycin binding (FRB) domain polypeptide is provided. In some embodiments, the naked FRB polypeptide comprises the amino acid sequence set forth in SEQ ID NO:1 or SEQ ID NO:2.

[0010] In some embodiments, the donor cassette further comprises one or more nucleic acid sequences encoding polypeptide elements of a dimerization activatable chemical-induced signaling complex (CISC); The polypeptide component of the CISC is (i) a first CISC component comprising a first extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof; And (ii) a second CISC component comprising a second extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof; Including, The first and second CISC components are configured such that when expressed in a cell, they can dimerize in the presence of rapamycin or a rapalog to form a signaling-competent CISC.

[0011] In some embodiments, either the first or the second extracellular binding domain or a functional derivative thereof comprises an FK506 binding protein (FKBP) domain or a functional derivative thereof, and / or the other extracellular binding domain or a functional derivative thereof comprises an FRB domain or a functional derivative thereof. In some embodiments, the transmembrane domain of the first CISC component comprises an IL-2 receptor transmembrane domain, and / or the transmembrane domain of the second CISC component comprises an IL-2 receptor transmembrane domain. In some embodiments, either the signaling domain of the first or the signaling domain of the second CISC component or a functional derivative thereof comprises an IL-2 receptor subunit gamma (IL2Rγ) domain or a functional derivative thereof, and / or the signaling domain of the other CISC component or a functional derivative thereof comprises an IL-2 receptor subunit beta (IL2Rβ) domain or a functional derivative thereof. In some embodiments, the IL2Rβ domain polypeptide is truncated. In some embodiments, the nucleic acid encoding the IL2Rβ domain comprises the nucleotide sequence set forth in SEQ ID NO:4. In some embodiments, the IL2Rβ domain comprises the amino acid sequence set forth in SEQ ID NO:5.

[0012] In some embodiments, the rapalog is selected from the group consisting of everolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP1903, AP23573, and metabolites and derivatives thereof.

[0013] In some embodiments, the nucleic acid encoding the naked FRB domain is located downstream of one or more nucleic acid sequences encoding the polypeptide elements of the CISC. In some embodiments, the donor cassette further comprises a nucleic acid sequence encoding a self-cleaving polypeptide (i) between each of the one or more nucleic acid sequences encoding each polypeptide element of the CISC; and / or (ii) between the nucleic acid encoding the naked FRB domain and an adjacent nucleic acid sequence encoding a polypeptide element of the CISC.

[0014] In some embodiments, each self-cleaving polypeptide encoded by the donor cassette is independently selected from the group consisting of P2A, T2A, E2A and F2A. In some embodiments, the donor cassette further comprises a promoter operably linked to one or more coding sequences contained in the donor cassette. In some embodiments, the promoter is an inducible promoter or a constitutive promoter. In some embodiments, the promoter is an MND promoter. In some embodiments, the donor cassette further comprises a nucleic acid encoding a detectable marker. In some embodiments, the detectable marker is a green fluorescent protein (GFP) polypeptide, an mCherry polypeptide, or a low affinity nerve growth factor receptor (LNGFR). In some embodiments, the nucleic acid encoding the naked FRB domain polypeptide does not have a nucleic acid encoding an endoplasmic reticulum localization signal peptide. In some embodiments, the donor cassette comprises a nucleic acid sequence contained in the nucleotide sequence shown in SEQ ID NO:3.

[0015] In some embodiments, the donor template is a viral vector. In some embodiments, the viral vector is a lentiviral vector, an adenoviral vector, or an adeno-associated viral (AAV) vector.

[0016] In one embodiment, there is provided a method for editing the genome of a cell, comprising: (i) a deoxyribonucleic acid (DNA) endonuclease, or a nucleic acid encoding the DNA endonuclease; (ii) a guide RNA (gRNA) comprising a spacer sequence complementary to a target sequence within a target genomic locus of the cell, or a nucleic acid encoding the gRNA; and (iii) a donor template comprising a donor cassette comprising a nucleic acid sequence encoding a naked FKBP-rapamycin binding (FRB) domain polypeptide; providing to a cell The method is characterized in that the DNA endonuclease, the gRNA and the donor template are configured such that a complex formed by association of the DNA endonuclease with the gRNA promotes targeted integration of the donor cassette into the target genomic locus of a cell to generate a genetically modified cell capable of expressing the naked FRB domain polypeptide.

[0017] In one aspect, there is provided a genetically modified cell prepared according to the method for editing the genome of a cell described herein, the method comprising: (i) a deoxyribonucleic acid (DNA) endonuclease, or a nucleic acid encoding the DNA endonuclease; (ii) a guide RNA (gRNA) comprising a spacer sequence complementary to a target sequence within a target genomic locus of the cell, or a nucleic acid encoding the gRNA; and (iii) a donor template comprising a donor cassette comprising a nucleic acid sequence encoding a naked FKBP-rapamycin binding (FRB) domain polypeptide; providing to a cell The DNA endonuclease, the gRNA and the donor template are configured such that a complex formed by association of the DNA endonuclease with the gRNA promotes targeted integration of the donor cassette into the target genomic locus of the cell, thereby producing a genetically modified cell capable of expressing the naked FRB domain polypeptide. In some embodiments, the donor cassette is configured to express a naked FRB domain polypeptide in a cell. In some embodiments, the cell is a eukaryotic cell. In some embodiments, the cell is a mammalian cell. In some embodiments, the cell is a hematopoietic stem cell. In some embodiments, the cell is a lymphocyte. In some embodiments, the cell is a precursor T cell or a regulatory T cell (T reg). In some embodiments, the cells are CD34+ cells, CD8+ cells, or CD4+ cells. In some embodiments, the cells are CD8+ cytotoxic T lymphocytes selected from the group consisting of naive CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells, and bulk CD8+ T cells. In some embodiments, the cells are CD4+ helper T lymphocytes selected from the group consisting of naive CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. In some embodiments, the cells have enhanced proliferation in the presence of rapamycin or a rapalog compared to control cells in which the donor cassette does not include a nucleic acid encoding a naked FRB domain polypeptide. In some embodiments, the concentration of rapamycin or a rapalog is 0.1 nM to 100 nM or about 0.1 nM to about 100 nM.

[0018] In another aspect, a method of activating a genetically modified cell disclosed herein is described, comprising contacting the cell with a rapamycin or a rapalog. In some embodiments, the rapalog is selected from the group consisting of everolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP1903, AP23573, and metabolites, derivatives and / or combinations thereof. In some embodiments, the concentration of rapamycin or rapalog contacted with the cell is between 0.1 nM and 100 nM or between about 0.1 nM and about 100 nM. In some embodiments, cells expressing components of a dimerization activatable chemical-induced signaling complex (CISC) are selectively expanded after contact with the rapamycin or rapalog.

[0019] In yet another aspect, there is provided a method for selectively expanding a population of genetically modified cells as described herein in a mixed cell population, comprising: contacting the mixed cell population with rapamycin or a rapalog; We describe a method for characterizing enhanced in vitro or in vivo activation and expansion of recombinant cells expressing components of the dimerization activatable chemical-induced signaling complex (CISC) and a naked FRB domain relative to other cells in the mixed cell population. In some embodiments, the rapalog is selected from the group consisting of everolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP1903, AP23573, and metabolites, derivatives and / or combinations thereof. In some embodiments, the concentration of rapamycin or rapalog contacted with the mixed cell population is between 0.1 nM and 100 nM or between about 0.1 nM and about 100 nM.

[0020] Each of the aspects and embodiments described herein can be used in combination, unless expressly or specifically excluded in those embodiments or aspects.

[0021] Throughout this specification, various patents, patent applications and other types of publications (e.g., journal articles, electronic database entries, etc.) are cited. All patents, patent applications and publications cited herein are hereby incorporated by reference in their entirety for all purposes. [Brief description of the drawings]

[0022] [Figure 1]Schematic diagram of lentiviral construct expressing naked "decoy" FRB (FKBP12 rapamycin binding domain) in cells. Construct expressing additional naked FRB* domain with CISC was named "decoy-CISC" or "DISC". Asterisks in the figure indicate that this sequence has a point mutation that allows interaction with rapalogs AP21967 and rapamycin (T2098L mutation on the amino acid sequence of mTOR (Bayle, JH et al. (2006). Chem. Biol., 13(1):99-107)).

[0023] [Diagram 2] FIG. 1 is a schematic diagram showing a hypothesis of the mechanism of action of naked FRB in T cells.

[0024] [Diagram 3] Figure 1 shows a graph comparing the expansion of T cells expressing the CISC construct to those expressing the DISC construct when cultured in the presence of rapamycin or the rapalog AP21967. The DISC construct promotes T cell expansion better than cells transduced with the CISC-only construct at all rapamycin doses tested.

[0025] [Figure 4] A schematic diagram showing the key amino acid changes introduced into the various forms of CISC constructs tested. Four pairs of FRB-IL2Rβ / FKBP-IL2Rγ receptor proteins (V4-V7) were further generated. These V4-V7 contained one or more of the amino acid sequences of the PAAL spacer and / or the amino acid sequences of the GGS linker or GGSP linker. The amino acid sequences of the additional spacers and linkers were placed at the interface between the extracellular FRB / FKBP domain and the IL2Rβ / IL2Rγ domain, or within the IL2Rβ domain.

[0026] [Diagram 5]Graph showing expansion numbers of lentivirally transduced T cells when cultured for several weeks with media additives as indicated in the right legend.

[0027] [Figure 6] Two graphs showing enrichment of lentiviral-transduced T cells (read as percentage of mCherry+ cells) over time when cultured with rapamycin (top panel) or the rapalog AP21967 (bottom panel).

[0028] [Figure 7] A schematic diagram of the lentiviral constructs used to directly compare rapamycin-induced expansion of T cells transduced with DISC or μDISC constructs is shown (the original CISC construct is included as a reference).

[0029] [Figure 8] FIG. 13 shows the number of lentiviral-transduced T cells (mCherry+) over several days when cultured with rapamycin at the indicated concentrations.

[0030] [Figure 9] FIG. 13 is a graph showing enrichment of lentiviral-transduced T cells (read as percentage of mCherry+ cells) after 9 days of culture with various doses of rapamycin.

[0031] [Figure 10] Figure 1 shows the fold expansion of lentiviral transduced (mCherry+) cell numbers after 21 days of culture with various doses of rapamycin. Fold expansion was calculated by dividing the number of mCherry+ cells on day 21 by the number of mCherry+ cells on day 0. The x-axis, from left to right, shows cells treated with 1 nM rapamycin (first 3 bars), cells treated with 5 nM rapamycin (4th-6th bars), and cells treated with 10 nM rapamycin (7th-9th bars).

[0032] [Figure 11] Schematic diagram of the experimental protocol used in gene editing experiments to insert a DISC construct into the endogenous FOXP3 gene. Shown is an AAV6 donor template (upper panel) and a gene editing procedure using the AAV6 delivered donor template and CRISPR / CAS9 RNP (lower panel) to introduce ectopic promoter-driven DISC expression upstream of endogenous FOXP3. gRNA=guide RNA; 5'HA and 3'HA=human FOXP3 homology arms.

[0033] [Figure 12] Schematic diagram of the experimental design used in gene editing experiments to insert DISC constructs into the endogenous FOXP3 gene of regulatory T cells. The MND promoter drives expression of DISC / μDISC upstream of endogenous HA-tagged FOXP3. The 5′ and 3′ homology arms at both ends are human FOXP3 homology regions.

[0034] [Figure 13] Figure 13A is a schematic diagram showing the structure of the AAV construct used in a two-phase expansion protocol designed to improve expansion of CD4+ T cells successfully edited with DISC(edTreg). In this construct, the MND promoter drives cell surface expression of the microDISC and intracellular expression of HA-tagged FOXP3. Figure 13B summarizes the results of the two-phase expansion experiment described herein, with the cell conditions for phase 1 expansion shown on the x-axis. Phase 2 expansion conditions are also shown.

[0035]

[0036] [Figure 14]Figures 14A and 14B are graphs summarizing the number of μDISC edTreg cells relative to total cells in culture 10 and 15 days after editing. Culture conditions during phase 0 expansion are shown on the x-axis. The total number of cells in culture is shown in white, and the number of successfully edited cells (HA+ / μDISC+ and FOXP3+) is shown in black. Based on these findings, the second condition from the left was selected as the optimal condition for generating μDISC edTregs. This condition uses 5ng / ml IL-2 during phase 0 expansion.

[0037] [Figure 15] Figures 15A and 15B show a summary of the results of flow cytometry experiments performed to compare the expansion of μDISC GFP edTregs treated with rapamycin versus vehicle 7 days after transplantation into NSG mice. The mean ± sd of GFP+ cells (%) in 75 μL peripheral blood samples (Figure 15A) and the mean ± sd of GFP+ cell counts are shown in the graphs (Figure 15B). IR = irradiation; Rapa = intraperitoneal injection of 0.1 mg / kg rapamycin every 2 days throughout the experimental period. P values ​​were obtained using Student's t-test. In each figure, the two left bars represent samples from irradiated mice and the two right bars represent samples from non-irradiated mice.

[0038] [Figure 16]Figures 16A and 16B show a summary of the results of an experiment performed to compare the expansion of μDISC GFP edTregs treated with rapamycin versus vehicle 14 days after transplantation into NSG mice. Flow cytometry plots of human CD45 versus live / dead or cellular forward scatter (FCS) versus GFP for representative mice from each cohort are shown in Figure 16A. The graph on the right of Figure 16A shows a summary of the results for each cohort. Figure 16B shows the mean ± sd of the number of GFP+ cells in 75 μL peripheral blood samples. IR = radiation; Rapa = intraperitoneal injection of 0.1 mg / kg rapamycin every 2 days throughout the experiment. P values ​​were obtained using Student's t-test.

[0039] [Figure 17] Figure 1 summarizes the percentage (%) and number of μDISC GFP edTreg cells found in the peripheral blood of in vivo recipient mice with or without rapamycin treatment over time. Plots summarize flow cytometry data, with each symbol representing an individual mouse and mean ± sd shown in each bar. GFP (%) in CD45+CD4+ gating is plotted in the upper panel, and the number of GFP+ cells in peripheral blood samples is plotted in the lower panel.

[0040] [Figure 18] Kaplan-Meier survival curves for the in vivo immunosuppression model. Teff = T effector only group. In these experiments, all groups received effector T cells. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0041] Described herein are compositions and methods intended for use with chemically induced signaling complex (CISC) polypeptides, in particular, to induce rapamycin-mediated intracellular signaling through CISC in a host cell without causing cytotoxicity to the host cell associated with the action of rapamycin, such as by conferring resistance to growth inhibition by rapamycin or rapamycin-related compounds (e.g., rapalogs) to the engineered host cell. In some embodiments, the compositions and methods disclosed herein are intended for use with CISC polypeptides, which are synthetic multicomponent protein complexes configured to be co-expressed as two chimeric proteins in a host cell. The CISC signaling system described in International Application No. PCT / US2017 / 065746, which is incorporated herein by reference, can be engineered to induce intracellular signaling in response to rapamycin, a macrolide compound used in a variety of therapeutic and research applications. The two chimeric protein components contained in CISC are an extracellular domain (either an FK506 binding protein (FKPB) domain or an FKBP rapamycin binding (FRB) domain) that constitutes one half of a rapamycin-binding complex, which is fused to an intracellular signaling complex that constitutes the other half of the rapamycin-binding complex. When rapamycin binds to the extracellular domain of CISC to form a CISC heterodimer, intracellular signaling is induced via the intracellular signaling complex portion of the chimeric polypeptide.

[0042] Although CISC-expressing cells are useful, it has been observed that exposure to rapamycin results in less cell proliferation than the rapalog AP21967. Mammalian target of rapamycin (mTOR), also known as FK506-binding protein 12-rapamycin-related protein 1 (FRAP1), is a kinase encoded by the MTOR gene in humans. mTOR is a member of the phosphatidylinositol 3-kinase-related kinase family of protein kinases. mTOR is a growth regulator that stimulates cell proliferation by phosphorylating substrates that govern anabolic processes such as lipid synthesis and mRNA translation, and by retarding catabolic processes such as autophagy.

[0043] The present applicant has devised a construct and method to overcome the problem of suppressed cell proliferation. As shown in FIG. 2, FKBP domain-containing proteins are naturally expressed in the cytoplasm of cells, and mTOR contains an FRB domain. Without wishing to be bound by any particular theory, it is believed that the binding of a complex of rapamycin and FKBP to the FRB domain of mTOR blocks or reduces intracellular signaling via mTOR, resulting in reduced mRNA translation and cell proliferation. In light of this, and without wishing to be bound by any particular theory, the present inventors hypothesized that a naked FRB protein domain (not bound to mTOR) can be expressed in cells and the naked FRB protein domain can be bound to the intracellular complex of rapamycin and FKBP, thereby reducing the negative effect of rapamycin on the proliferation of CISC-expressing cells. Previous reports have shown that the naked mTOR FRB domain is toxic to mammalian cells when expressed in cells and may not be a suitable means of alleviating the interaction of the mTOR FRB domain with the rapamycin-FKBP complex in human cells (see Vilella-Bach, M. et al. (1999). J. Biol. Chem., 274(7):4266-4272). Furthermore, the T2098L mutation in the FRB domain (numbering according to the amino acid sequence of mTOR) destabilizes the FRB domain compared to the wild-type protein, leading to faster degradation in cells. However, the mutant protein is stabilized by binding to rapamycin (Stankunas, K. et al. (2003). Mol. Cell., 12(6):1615-1624).

[0044] In contrast to these previous reports, the inventors of the present application, as detailed herein, have surprisingly discovered that the growth inhibitory effect of rapamycin can be effectively alleviated by intracellular expression of a naked "decoy" FRB (FRB*) domain in CISC-expressing host cells. The construct expressing an additional naked FRB* domain together with CISC is named "decoy-CISC" or "DISC". Thus, the utility of rapamycin-responsive CISC-expressing cells in both therapeutic applications and in the study of intracellular signaling pathways can be improved by conferring rapamycin resistance by the naked FRB domain expressed in cells.

[0045] Definition of Terms Unless otherwise stated, technical and scientific terms used herein have the meanings commonly understood by those skilled in the art to which this disclosure belongs. All patents, applications, published applications and other publications cited herein are expressly incorporated herein in their entirety by reference unless otherwise stated. In the event that there are a plurality of definitions for terms used herein, the definitions set forth in this section shall prevail unless otherwise stated.

[0046] As used herein, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise.

[0047] As used herein, the term "about" has its common and ordinary meaning in the context of this specification, and may be used, for example, when talking about measured values ​​and may mean including a variation of ±20%, ±10%, ±5%, ±1% or ±0.1% from the given value.

[0048] As used herein, a "protein sequence" refers to a polypeptide sequence of amino acids that is the primary structure of a protein. As used herein, "upstream" refers to a 5' position on a polynucleotide and toward the N-terminus on a polypeptide. As used herein, "downstream" refers to a 3' position on a nucleotide and toward the C-terminus on a polypeptide. Thus, "N-terminus" refers to the position or specific location of an element on a polynucleotide toward the N-terminus on a polypeptide.

[0049] "Nucleic acid" or "nucleic acid molecule" refers to a polynucleotide, such as a deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), an oligonucleotide, a fragment obtained by polymerase chain reaction (PCR), or a fragment obtained by ligation, cleavage, endonuclease action, or exonuclease action. A nucleic acid molecule may be composed of natural nucleotide monomers (DNA, RNA, etc.), or monomers consisting of analogs of natural nucleotides (e.g., enantiomers of natural nucleotides), or combinations thereof. "Nucleic acid molecule" also encompasses so-called "peptide nucleic acids," which contain natural or modified nucleobases attached to a polyamide backbone. A nucleic acid may be single-stranded or double-stranded. In some embodiments, a nucleic acid sequence encoding a fusion protein is provided. In some embodiments, the nucleic acid is RNA or DNA.

[0050] As used herein, "encode" refers to the property of a particular nucleotide sequence in a polynucleotide, such as a gene, cDNA, mRNA, etc., serving as a template for the synthesis of another macromolecule, such as a given amino acid sequence. Thus, when the mRNA corresponding to a particular gene is transcribed and translated to produce a protein in a cell or other biological system, the gene encodes the protein.

[0051] A "nucleic acid sequence encoding a polypeptide" includes all degenerate nucleotide sequences that encode the same amino acid sequence. In some embodiments, nucleic acids encoding fusion proteins are provided.

[0052] A "vector", "expression vector" or "construct" is a nucleic acid used to introduce heterologous nucleic acid into a cell and contains various regulatory elements, thereby allowing the expression of the heterologous nucleic acid in the cell. Vectors include, but are not limited to, plasmids, minicircles, yeast, and viral genomes. In some embodiments, the vector is a plasmid, minicircle, yeast, or viral genome. In some embodiments, the vector is a viral vector. In some embodiments, the viral vector is a lentivirus. In some embodiments, the vector is an adeno-associated virus (AAV) vector (e.g., but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, etc.). In some embodiments, the vector is a vector for protein expression in bacterial systems, such as E. coli.

[0053] As used herein, the term "expression" or "protein expression" refers to the translation of a transcribed RNA molecule into a protein molecule. Protein expression may be characterized by its temporal, spatial, developmental or morphological characteristics, and quantitative or qualitative indicators. In some embodiments, a single protein or multiple proteins are expressed in a configuration (e.g., arranged) such that they dimerize in the presence of a ligand.

[0054] As used herein, a "fusion protein" or "chimeric protein" is a protein created by joining two or more genes that originally coded for separate proteins or portions of separate proteins. Fusion proteins can also be created from specific protein domains from two or more separate proteins. Such fusion genes can be translated to obtain a single polypeptide or multiple polypeptides with functional properties from each of the original proteins. Recombinant fusion proteins can be artificially created by recombinant DNA techniques used in biological research or therapy. Methods for creating such fusion proteins are known to those skilled in the art. Some fusion proteins combine entire peptides and therefore contain all domains, and in particular all functional domains, of the original proteins. However, other fusion proteins, especially non-naturally occurring proteins, combine only parts of the coding sequences and therefore do not maintain the original functions of the parent genes from which such proteins are derived.

[0055] The term "regulatory element" as used herein refers to a DNA molecule having gene-regulating activity, e.g., a DNA molecule capable of affecting the transcription and / or translation of an operably linked transcribable DNA molecule. Regulatory elements such as promoters (e.g., but not limited to, MND promoters, e.g., MND promoters comprising the nucleic acid sequence of SEQ ID NO: 33), leaders, introns, transcription termination regions, and the like, are DNA molecules that have gene-regulating activity and play an essential role in the overall expression of genes in living cells. Thus, isolated regulatory elements (e.g., promoters) that function in plants are useful for modifying plant phenotypes by genetic engineering methods.

[0056] As used herein, the term "operably linked" refers to a first molecule being bound to a second molecule, and the molecules are arranged such that the first molecule affects the function of the second molecule. The two molecules may be part of a single continuous molecule, or may be adjacent. For example, if a promoter controls the transcription of a transcribable DNA molecule of interest in a cell, the promoter is operably linked to the transcribable DNA molecule.

[0057] As used herein, "dimeric chemical-induced signaling complex," "dimerized CISC," or "dimer" refers to two components that make up CISC, which may or may not bind to each other to form a fusion protein complex. "Dimerization" refers to the process by which two separate entities bind to each other to become a single entity, such as in response to binding of a ligand (e.g., rapamycin). In some embodiments, dimerization is stimulated by a ligand or drug. In some embodiments, "dimerization" refers to homodimerization, i.e., two identical entities bind and dimerize, e.g., two identical CISC components bind and dimerize. In some embodiments, "dimerization" refers to heterodimerization, i.e., two different entities bind and dimerize, e.g., two different and separate CISC components bind and dimerize. In some embodiments, dimerization of CISC components forms a cell signaling pathway. In some embodiments, dimerization of CISC components allows selective expansion of cells or cell populations. Additional CISC systems may include CISC and gibberellin dimerization systems or CISC dimerization systems using SLF-TMP. Other chemically inducible dimerization (CID) systems and their components may also be used.

[0058] As used herein, "chemical-induced signaling complex" or "CISC" refers to a genetically engineered complex that initiates a signal inside a cell and, as a direct result, undergoes ligand-induced dimerization. CISCs can be homodimers (dimerization of two identical components) or heterodimers (dimerization of two different components). Thus, as used herein, the term "homodimer" refers to a dimer consisting of two protein components described herein that have identical amino acid sequences. Additionally, the term "heterodimer" refers to a dimer consisting of two protein components described herein that do not have identical amino acid sequences.

[0059] CISC may be a synthetic complex as described in further detail herein. As used herein, "synthetic" refers to a complex, protein, dimer, or composition described herein that is not naturally occurring or found in nature. In some embodiments, "IL2R-CISC" refers to a signaling complex that includes an interleukin 2 receptor component. In some embodiments, "IL2 / 15-CISC" refers to a signaling complex that includes a receptor signaling subunit shared by interleukin 2 (IL2) and interleukin 15 (IL15). In some embodiments, "IL7-CISC" refers to a signaling complex that includes an interleukin 7 receptor component. Thus, CISC may be named according to the component parts that make up a particular CISC component. One of skill in the art will recognize that the component parts of a chemically induced signaling complex may be composed of natural or synthetic components that are useful for incorporation into a CISC. Thus, these examples provided herein are not intended to limit the invention.

[0060] As used herein, a "cytokine receptor" refers to a receptor molecule that recognizes and binds to a cytokine. In some embodiments, a cytokine receptor encompasses modified cytokine receptor molecules (e.g., "cytokine receptor variants") that contain substitutions, deletions, and / or additions in the amino acid and / or nucleic acid sequence of the cytokine receptor. Thus, the term "cytokine receptor" is intended to encompass not only wild-type cytokine receptors, but also recombinant cytokine receptors, synthetic cytokine receptors, and cytokine receptor variants. In some embodiments, the cytokine receptor is a fusion protein that includes an extracellular binding domain, a hinge domain, a transmembrane domain, and a signaling domain. In some embodiments, the components of the receptor (i.e., each domain of the receptor) are natural or synthetic. In some embodiments, each domain is of human origin.

[0061] As used herein, "FKBP" refers to an FK506 binding protein domain. FKBP refers to a family of proteins with prolyl isomerase activity, which are related in function to cyclophilin but are not similar in amino acid sequence. FKBP has been identified in many eukaryotic organisms, including yeast and humans, and functions as a protein folding chaperone for proteins containing proline residues. FKBP, along with cyclophilin, belongs to the immunophilin family. FKBP includes, for example, FKBP12, as well as proteins encoded by the AIP gene, the AIPL1 gene, the FKBP1A gene, the FKBP1B gene, the FKBP2 gene, the FKBP3 gene, the FKBP5 gene, the FKBP6 gene, the FKBP7 gene, the FKBP8 gene, the FKBP9 gene, the FKBP9L gene, the FKBP10 gene, the FKBP11 gene, the FKBP14 gene, the FKBP15 gene, the FKBP52 gene, and / or the LOC541473 gene; homologues and functional protein fragments thereof.

[0062] As used herein, "FRB" refers to the FKBP rapamycin binding domain. The FRB domain is a polypeptide region (protein "domain") that is configured to form a ternary complex with the FKBP protein and rapamycin or its rapalog. The FRB domain is present in a variety of natural proteins, including the mTOR protein (also referred to herein as FRAP, RAPT1 or RAFT) from humans and other species; yeast proteins, including Tor1 and / or Tor2; and the FRAP homologue from Candida. Both FKBP and FRB are key components of mammalian target of rapamycin (mTOR) signal transduction.

[0063] "Naked FKBP rapamycin binding domain polypeptide" or "naked FRB domain polypeptide" (also referred to as "FKBP rapamycin binding domain polypeptide" or "FRB domain polypeptide") refers to a polypeptide consisting of the amino acid sequence of an FRB domain, or to a protein in which about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% of the amino acid sequence of the protein consists of the amino acid sequence of an FRB domain. Typically, such proteins are capable of binding and interacting with the rapalog AP21967 or rapamycin. The FRB domain can be expressed as a soluble protein of 12 kDa (Chen, J. et al. (1995). Proc. Natl. Acad. Sci. USA, 92(11):4947-4951). The FRB domain forms a four-helix bundle, a structural motif commonly found in globular proteins. The overall dimensions of the FRB domain are 30 Å×45 Å×30 Å, with the four helices connected by a short lower loop similar to the fold of cytochrome b562 (Choi, J. et al. (1996). Science, 273(5272):239-242). In some embodiments, the naked FRB domain comprises the amino acid sequence of SEQ ID NO:1 (MEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISK) or the amino acid sequence of SEQ ID NO:2 (MEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLLQAWDLYYHVFRRISK).

[0064] The "extracellular binding domain" referred to herein is one of the domains constituting a complex, and refers to a domain that is configured to bind to a specific atom or a specific molecule and exists outside a cell. In some embodiments, the extracellular binding domain of CISC is an FKBP domain or a functional derivative thereof. In some embodiments, the extracellular binding domain is an FRB domain or a functional derivative thereof. In some embodiments, the extracellular binding domain is configured to stimulate dimerization of two CISC components by binding to a ligand or a drug. In some embodiments, the extracellular binding domain is configured to bind to a cytokine receptor modulator.

[0065] As used herein, a "cytokine receptor modulator" refers to an agent that modulates phosphorylation of downstream targets of a cytokine receptor, activation of a signaling pathway associated with the cytokine receptor, and / or expression of a specific protein, such as a cytokine. Such agents may directly or indirectly modulate phosphorylation of downstream targets of a cytokine receptor, activation of a signaling pathway associated with the cytokine receptor, and / or expression of a specific protein, such as a cytokine. Thus, examples of cytokine receptor modulators include, but are not limited to, cytokines; fragments of cytokines; fusion proteins; and / or antibodies or binding portions thereof that immunospecifically bind to a cytokine receptor or a fragment thereof. Additionally, examples of cytokine receptor modulators include, but are not limited to, peptides, polypeptides (e.g., soluble cytokine receptors), fusion proteins, and / or antibodies or binding portions thereof that immunospecifically bind to a cytokine or a fragment thereof.

[0066] As used herein, "activate" refers to the enhancement of at least one biological activity of a protein of interest. Similarly, "activation" refers to the state of a protein of interest in an enhanced state of activity. "Activatable" refers to the protein of interest being activatable in the presence of a signal, drug, ligand, compound, or stimulus. In some embodiments, the dimers described herein are activated in the presence of a signal, drug, ligand, compound, or stimulus to become signal transduction-competent dimers. As used herein, "signal transduction-competent" refers to the ability or configuration of a dimer to initiate or sustain a downstream signal transduction pathway.

[0067] As used herein, "hinge domain" refers to a domain that may link the extracellular binding domain to the transmembrane domain, thereby providing flexibility to the extracellular binding domain. In some embodiments, the hinge domain positions the extracellular domain close to the cell membrane, minimizing the possibility of recognition by an antibody or binding fragment thereof. In some embodiments, the extracellular binding domain is located N-terminal to the hinge domain. In some embodiments, the hinge domain may be natural or synthetic.

[0068] As used herein, "transmembrane domain" or "TM domain" refers to a domain that is stable inside a membrane, such as a cell membrane. The terms "transmembrane span", "integral membrane protein" and "integral membrane domain" are also used herein. In some embodiments, the hinge domain and the extracellular domain are located N-terminal to the transmembrane domain. In some embodiments, the transmembrane domain is a natural domain or a synthetic domain. In some embodiments, the transmembrane domain is an IL-2 transmembrane domain.

[0069] As used herein, a "signaling domain" refers to a domain of a fusion protein or a domain of a component of a CISC that is involved in a signaling cascade inside a cell (such as a mammalian cell). A "signaling domain" refers to a signaling moiety that provides a signal to a cell (such as a T cell) that mediates a cellular response (such as a T cell response) in addition to a first signal provided by, such as the CD3ζ chain of the TCR / CD3 complex, including, but not limited to, activation, proliferation, differentiation, and / or cytokine secretion. In some embodiments, the signaling domain is N-terminal to the transmembrane domain, hinge domain, and extracellular domain. In some embodiments, the signaling domain is a synthetic or naturally occurring domain. In some embodiments, the signaling domain is a linked cytoplasmic signaling domain. In some embodiments, the signaling domain is a cytokine signaling domain. In some embodiments, the signaling domain is an antigen signaling domain. In some embodiments, the signaling domain is an interleukin 2 receptor gamma subunit (IL2Rγ or IL2Rg) domain. In some embodiments, the signaling domain is an interleukin 2 receptor beta subunit (IL2Rβ or IL2Rb) domain, or a truncated IL2Rβ domain (e.g., a truncated IL2Rβ domain comprising the amino acid sequence of SEQ ID NO:5). In some embodiments, binding of an agent or ligand to the extracellular binding domain results in dimerization of the CISC components, which in turn activates a signaling pathway and transduces a signal through the signaling domain. As used herein, "signal transduction" refers to activation of a signaling pathway by binding of a ligand or agent to the extracellular domain. Binding of the extracellular domain to a ligand or agent results in dimerization of the CISC components and activation of a signal.

[0070] As used herein, "IL2Rb" or "IL2Rβ" refers to the interleukin 2 receptor β subunit. Similarly, "IL2Rg" or "IL2Rγ" refers to the interleukin 2 receptor γ subunit, and "IL2Ra" or "IL2Rα" refers to the interleukin 2 receptor α subunit. There are three forms of IL-2 receptor, namely, the α chain, the β chain, and the γ chain, which are also subunits of the receptors for other cytokines. IL2Rβ and IL2Rγ are members of the type I cytokine receptor family. As used herein, "IL2R" refers to the interleukin 2 receptor, which is involved in T-cell-mediated immune responses. IL2R is involved in receptor-mediated endocytosis and the transmission of mitogenic signals from interleukin 2. Similarly, "IL-2 / 15R" refers to the receptor signaling subunit shared by IL-2 and IL-15 and can include the α subunit (IL2 / 15Ra or IL2 / 15Rα), β subunit (IL2 / 15Rb or IL2 / 15Rβ) or γ subunit (IL2 / 15Rg or IL2 / 15Rγ).

[0071] In some embodiments, the chemical-induced signaling complex is a heterodimerization-activated signaling complex that includes two components. In some embodiments, the first component includes an extracellular binding domain, an optional hinge domain, a transmembrane domain, and one or more linked intracytoplasmic signaling domains that are one member of a heterodimerization pair. In some embodiments, the second component includes an extracellular binding domain, an optional hinge domain, a transmembrane domain, and one or more linked intracytoplasmic signaling domains that are the other member of a heterodimerization pair. Thus, in some embodiments, two genetic recombination events occur. In some embodiments, the two CISC components are expressed in a cell, such as a mammalian cell. In some embodiments, a cell, such as a mammalian cell, or a cell population, such as a mammalian cell population, is contacted with a ligand or factor that causes heterodimerization, thereby initiating signaling. In some embodiments, the homodimerization pair dimerizes, thereby resulting in a single CISC component being expressed in a cell, such as a mammalian cell, and the homodimerized CISC component initiates signaling.

[0072] As used herein, a "ligand" or "drug" refers to a molecule that has a desired biological effect. In some embodiments, the extracellular binding domain recognizes and binds to the ligand, forming a ternary complex that includes the ligand and two binding CISC components. Ligands include, but are not limited to, proteinaceous molecules, such as, but not limited to, peptides, polypeptides, proteins, post-translationally modified proteins, antibodies, and binding portions thereof; small molecules (less than 1000 daltons), inorganic or organic compounds; and nucleic acid molecules, such as, but not limited to, double-stranded or single-stranded DNA, double-stranded or single-stranded RNA (e.g., antisense RNA, RNAi, etc.), aptamers, triple helix nucleic acid molecules. Ligands may be derived from or obtained from any known organism, including, but not limited to, animals (e.g., mammals (human and non-human mammals)), plants, bacteria, fungi, protists, and viruses, or may be derived from or obtained from a synthetic molecule library. In some embodiments, the ligand is a protein, an antibody or functional derivative thereof, a small molecule, or a drug. In some embodiments, the ligand is rapamycin or a rapamycin analog (rapalog). In some embodiments, the rapalog includes variants of rapamycin that have been modified by one or more of the following: demethylation, removal or replacement of methoxy at C7, C42 and / or C29; removal, derivatization or replacement of hydroxy at C13, C43 and / or C28; reduction, removal or derivatization of ketone at C14, C24 and / or C30; replacement of 6-membered pipecolate ring with 5-membered prolyl ring; and replacement of cyclohexyl ring with another or substituted cyclopentyl ring.Thus, in some embodiments, the rapalog is everolimus, merilimus, novolimus, pimecrolimus, ridaforolimus, tacrolimus, temsirolimus, umirolimus, zotarolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP23573 or AP1903, or any metabolites, derivatives and / or combinations thereof. In some embodiments, the ligand is an IMID drug (e.g., thalidomide, pomalidomide, lenalidomide or related analogs thereof).

[0073] As used herein, "simultaneous binding" refers to two or more CISC components binding to a ligand simultaneously, and in some cases, two or more CISC components binding to a ligand substantially simultaneously to form a multi-component complex that includes a CISC component and a ligand component, resulting in signal activation. Simultaneous binding requires that the CISC components are configured to spatially bind to a single ligand, and that both CISC components are configured to bind to (different portions of) the same ligand.

[0074] As used herein, "selective expansion" refers to the expansion potential of a desired cell, such as a mammalian cell, or a desired cell population, such as a mammalian cell population. In some embodiments, selective expansion refers to the generation or expansion of a population of pure cells (such as mammalian cells) in which two genes are recombined. One component of the dimerized CISC is involved in one genetic modification, and the other component is involved in the other genetic modification. Thus, each component of the heterodimerized CISC is associated with each genetic modification. By exposing the cells to a ligand, it becomes possible to selectively expand only cells (such as mammalian cells) that have both desired modifications. Thus, in some embodiments, the only cells (e.g., mammalian cells) that can respond to contact with the ligand are those that express both components of the heterodimerized CISC.

[0075] As used herein, a "host cell" includes any type of cell (e.g., a mammalian cell) that is susceptible to transformation, transfection, or transduction with a nucleic acid construct or vector. In some embodiments, the host cell, such as a mammalian cell, can be a T cell or a regulatory T cell (T reg). As used herein, "T cells" or "T lymphocytes" may be from any mammal, including, for example, primates or other species, including monkeys, dogs, and humans. In some embodiments, the T cells are allogeneic (same species but from a different donor) to the recipient subject. In some embodiments, the T cells are autologous (donor and recipient are the same). In some embodiments, the T cells are syngeneic (donor and recipient are different but identical twins). In some embodiments, the host cell, such as a mammalian cell, is a hematopoietic stem cell. In some embodiments, the host cell is a CD34+ cell, a CD8+ cell, or a CD4+ cell. In some embodiments, the host cell is a CD8+ cytotoxic T lymphocyte selected from the group consisting of naive CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells, and bulk CD8+ T cells. In some embodiments, the host cells are CD4+ helper T lymphocytes selected from the group consisting of naive CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, and bulk CD4+ T cells. As used herein, a "cell population" refers to a cell population (e.g., a mammalian cell population) that includes two or more types of cells. In some embodiments, cells (e.g., mammalian cells) that include the protein sequences described herein or expression vectors that encode the protein sequences are produced.

[0076] As used herein, "cytotoxic T lymphocytes (CTLs)" refer to T lymphocytes that express CD8 on the cell surface (e.g., CD8+ T cells). In some embodiments, such cells include, for example, antigen-experienced "memory" T cells (T M In some embodiments, the cells are provided for secreting the fusion protein. In some embodiments, the cells are cytotoxic T lymphocytes. As used herein, "central memory" T cells (or "T CM" refers to an antigen-experienced cytotoxic T lymphocyte (CTL) that expresses CD62L, CCR-7 and / or CD45RO on its surface, but does not express CD45RA or has reduced expression of CD45RA, as compared to naive cells. In some embodiments, cells are provided for secreting the fusion protein. In some embodiments, the cells are central memory T cells (T CM In some embodiments, central memory cells may express positively for CD62L, CCR7, CD28, CD127, CD45RO, and / or CD95, but may have reduced expression of CD54RA, as compared to naive cells. As used herein, "effector memory" T cells (or "T EM " refers to an antigen-experienced T cell that does not express or has reduced expression of CD62L on its surface compared to a central memory cell, and does not express or has reduced expression of CD45RA compared to a naive cell. In some embodiments, a cell is provided for secreting a fusion protein. In some embodiments, the cell is an effector memory T cell. In some embodiments, an effector memory cell may have negative expression of CD62L and / or CCR7 and positive or negative expression of CD28 and / or CD45RA compared to a naive or central memory cell.

[0077] As used herein, a "naive" T cell refers to a T lymphocyte that has not experienced an antigen and expresses CD62L and / or CD45RA, but not CD45RO, as compared to a central memory cell or an effector memory cell. In some embodiments, a cell (such as a mammalian cell) is provided for secreting the fusion protein. In some embodiments, the cell (such as a mammalian cell) is a naive T cell. In some embodiments, the naive CD8+ T lymphocyte is characterized by the expression of phenotypic markers of naive T cells, including CD62L, CCR7, CD28, CD127, and / or CD45RA.

[0078] As used herein, an "effector" T cell refers to an antigen-experienced cytotoxic T lymphocyte that does not express CD62L, CCR7, and / or CD28, or has reduced expression of CD62L, CCR7, and / or CD28, and is granzyme B-positive and / or perforin-positive, compared to central memory T cells or naive T cells. In some embodiments, a cell (such as a mammalian cell) is provided for secreting the fusion protein. In some embodiments, the cell (such as a mammalian cell) is an effector T cell. In some embodiments, the cell (such as a mammalian cell) does not express CD62L, CCR7, and / or CD28, or has reduced expression of CD62L, CCR7, and / or CD28, and is granzyme B-positive and / or perforin-positive, compared to central memory T cells or naive T cells.

[0079] As used herein, "transformed" or "transfected" refers to a cell (such as a mammalian cell), tissue, organ, or organism into which an exogenous polynucleotide molecule, such as a construct, has been introduced. The introduced polynucleotide molecule may be integrated into the genomic DNA of the recipient cell (such as a mammalian cell), tissue, organ, or organism, thereby allowing the introduced polynucleotide molecule to be passed on to subsequent offspring. Furthermore, a "transgenic" cell (such as a mammalian cell) or "transgenic" organism, or a "transfected" cell (such as a mammalian cell) or "transfected" organism, includes the progeny of a transgenic cell or organism or a transfected cell or organism, including progeny produced by a breeding program using such transgenic organisms as parents in matings, and including those that exhibit an altered phenotype resulting from the presence of the exogenous polynucleotide molecule. "Transgenic" also refers to a bacterium, fungus, or plant that contains one or more heterologous nucleic acid molecules.

[0080] As used herein, "transduction" refers to the introduction of genes into a cell (such as a mammalian cell) using a virus (eg, a lentivirus or an adeno-associated virus).

[0081] As used herein, "subject" or "individual" refers to an animal that is the subject of treatment, observation, or experiment. "Animal" includes cold-blooded vertebrates, warm-blooded vertebrates, and invertebrates such as fish, crustaceans, and reptiles, particularly mammals. "Mammals" include, but are not limited to, mice, rats, rabbits, guinea pigs, dogs, cats, sheep, goats, cows, horses, and primates (monkeys, chimpanzees, apes, etc.), particularly humans. In some embodiments, the subject is a human.

[0082] A "marker sequence" as described herein encodes a protein that is used to select or track cells (such as mammalian cells) that have a protein of interest or a protein of interest. In embodiments described herein, fusion proteins are provided that may include a selectable marker sequence in experiments such as flow cytometry.

[0083] "Amino acid sequence identity (%)" with respect to the CISC sequence or other polypeptide sequences (e.g., naked FRB domain polypeptide sequences) described herein is defined as the percentage of amino acid residues in each of the extracellular binding domain, hinge domain, transmembrane domain and / or signaling domain in the candidate sequence that match the amino acid residues in each domain in the reference sequence, and this amino acid sequence identity is calculated after aligning the candidate sequence with the reference sequence and inserting gaps as necessary to calculate the maximum sequence identity (%), and conservative substitutions are not considered as part of the sequence identity. Alignment for determining amino acid sequence identity (%) can be performed in various ways within the scope of the art, for example, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2, Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithm required to maximize alignment over the entire length of the sequences being compared. For example, percent amino acid sequence identity is calculated using the WU-BLAST-2 computer program (Altschul, SF et al. (1996). Methods in Enzymol., 266:460-480) using several search parameters, most of which are set to default values. Parameters that are not set to default values ​​(e.g., adjustable parameters) are set as follows: overlap span=1, overlap fraction=0.125, word threshold (T)=11, and scoring matrix=BLOSUM62. In some embodiments of CISCs, the CISCs include an extracellular binding domain, a hinge domain, a transmembrane domain, and a signaling domain, each of which includes a naturally occurring or synthetic domain, or a mutated or truncated version of a naturally occurring domain.In some embodiments, variants or truncations of a given domain comprise amino acid sequences having 100%, 95%, 90% or 85% sequence identity, or a percentage of sequence identity within a range defined by any two of the foregoing percentages, with a sequence set forth in the sequences provided herein.

[0084] As used herein, a "CISC variant polypeptide sequence" or "CISC variant amino acid sequence" refers to a protein sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% amino acid sequence identity (or a range of amino acid sequence identity (%) defined by any two of these percentages) with the protein sequences provided herein, as defined below, or a specifically derived fragment thereof, such as the protein sequence of the extracellular binding domain, hinge domain, transmembrane domain and / or signaling domain. Typically, a CISC variant polypeptide or fragment thereof will have at least 80% or at least about 80% amino acid sequence identity, at least 81% or at least about 81% amino acid sequence identity, at least 82% or at least about 82% amino acid sequence identity, at least 83% or at least about 83% amino acid sequence identity, at least 84% or at least about 84% amino acid sequence identity, at least 85% or at least about 85% amino acid sequence identity, at least 86% or at least about 86% amino acid sequence identity, at least 87% or at least about 87% amino acid sequence identity, at least 88% or at least about 88% amino acid sequence identity, at least 89% or at least about 89% amino acid sequence identity, to the amino acid sequence of CISC or a fragment derived therefrom. or at least about 89% amino acid sequence identity, at least 90% or at least about 90% amino acid sequence identity, at least 91% or at least about 91% amino acid sequence identity, at least 92% or at least about 92% amino acid sequence identity, at least 93% or at least about 93% amino acid sequence identity, at least 94% or at least about 94% amino acid sequence identity, at least 95% or at least about 95% amino acid sequence identity, at least 96% or at least about 96% amino acid sequence identity, at least 97% or at least about 97% amino acid sequence identity, at least 98% or at least about 98% amino acid sequence identity, or at least 99% or at least about 99% amino acid sequence identity.Variants do not encompass the native protein sequence.

[0085] As used herein, a "naked FRB domain variant polypeptide sequence" or a "naked FRB domain variant amino acid sequence" refers to a protein sequence having at least 80% or at least about 80%, at least 85% or at least about 85%, at least 90% or at least about 90%, at least 95% or at least about 95%, at least 98% or at least about 98%, or at least 99% or at least about 99% amino acid sequence identity (or amino acid sequence identity (%) within a range defined by any two of these percentages) with a protein sequence provided herein (e.g., SEQ ID NO:1 or SEQ ID NO:2), as defined below, or a specifically derived fragment thereof, such as the protein sequence of the extracellular binding domain, hinge domain, transmembrane domain and / or signaling domain.Typically, a variant polypeptide of a naked FRB domain or a fragment thereof will have at least 80% or at least about 80% amino acid sequence identity, at least 81% or at least about 81% amino acid sequence identity, at least 82% or at least about 82% amino acid sequence identity, at least 83% or at least about 83% amino acid sequence identity, at least 84% or at least about 84% amino acid sequence identity, at least 85% or at least about 85% amino acid sequence identity, at least 86% or at least about 86% amino acid sequence identity, at least 87% or at least about 87% amino acid sequence identity, at least 88% or at least about 88% amino acid sequence identity to the amino acid sequence of the naked FRB domain or a fragment derived therefrom. , at least 89% or at least about 89% amino acid sequence identity, at least 90% or at least about 90% amino acid sequence identity, at least 91% or at least about 91% amino acid sequence identity, at least 92% or at least about 92% amino acid sequence identity, at least 93% or at least about 93% amino acid sequence identity, at least 94% or at least about 94% amino acid sequence identity, at least 95% or at least about 95% amino acid sequence identity, at least 96% or at least about 96% amino acid sequence identity, at least 97% or at least about 97% amino acid sequence identity, at least 98% or at least about 98% amino acid sequence identity, or at least 99% or at least about 99% amino acid sequence identity. Variants do not encompass naturally occurring protein sequences.

[0086] As used herein, the terms "comprise(s)" and "comprising," whether in the transitional or main body of a claim, are to be construed as having an open-ended meaning; that is, these terms are to be construed as synonymous with the expressions "having at least" or "comprising at least." When the term "comprise" is used in the context of a process, it means that the process includes at least the specified steps and may include additional steps. When the term "comprise" is used in the context of a compound, composition, or device, it means that the compound, composition, or device includes at least the specified features or components and may include additional features or components.

[0087] CISC The one or more protein sequences may have a first sequence and a second sequence. In some embodiments, the first sequence encodes a first CISC component that may include a first extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof. In some embodiments, the second sequence encodes a second CISC component that may include a second extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a portion thereof. In some embodiments, the first CISC component and the second CISC component may be arranged to dimerize in the presence of a ligand when expressed. In some embodiments, the first CISC component and the second CISC component may be arranged to dimerize simultaneously in the presence of a ligand when expressed.

[0088] In some embodiments, protein sequences of two CISC components that heterodimerize or sequences encoding two CISC components that heterodimerize are provided. In some embodiments, the first CISC component is an IL2Rγ-CISC complex. In some embodiments, the IL2Rγ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO:9. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO:9. In some embodiments, the IL2Rγ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO:10. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO:10. In some embodiments, the IL2Rγ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO:11. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO:11. In some embodiments, the IL2Rγ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO:12. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO:12.

[0089] In some embodiments, the protein sequence of the first CISC component comprises a protein sequence encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. Also included in the embodiments are nucleic acid sequences encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. In some embodiments, the protein sequence of the first CISC component comprising the first extracellular binding domain, the hinge domain, the transmembrane domain, and / or the signaling domain comprises an amino acid sequence having 100%, 99%, 98%, 95%, 90%, 85% or 80% sequence identity with the sequence set forth in SEQ ID NO: 9, 10, 11, or 12, including all numbers and ranges contained within these percentages.

[0090] In some embodiments, the second CISC component is a complex comprising IL2Rβ. In some embodiments, the IL2Rβ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 13. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO: 13. In some embodiments, the IL2Rβ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 14. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO: 14. In some embodiments, the IL2Rβ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 15. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO: 15. In some embodiments, the IL2Rβ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 24. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO: 24. In some embodiments, the second CISC component is a complex comprising IL7Rα. In some embodiments, the IL7Rα-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 16, 17 or 26. Also included in the embodiments are nucleic acid sequences encoding the protein sequence of SEQ ID NO: 16, 17 or 26.

[0091] In another embodiment, the IL2Rβ-CISC comprises a truncated intracellular IL2Rβ domain or a nucleic acid sequence encoding a truncated intracellular IL2Rβ domain. The truncated IL2Rβ domain retains the ability to activate downstream IL2 signaling upon heterodimerization with the IL2Rγ-CISC protein sequence. In some embodiments, the truncated IL2Rβ comprises the amino acid sequence shown in SEQ ID NO:5 (PAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSLNTDAYLSLQELQ; SEQ ID NO:5). In some embodiments, the truncated IL2Rβ domain of SEQ ID NO:5 is missing 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids at the N-terminus. In another embodiment, the FRB-CISC having a truncated intracellular IL2Rβ domain comprises the amino acid sequence set forth in SEQ ID NO: 7 (MALPVTALLLPLALLLHAARPILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLLQAWDLYYHVFRRISKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSP*WORFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSLNTDAYLSLQELQ; SEQ ID NO: 7).

[0092] In some embodiments, the protein sequence of the second CISC component comprises a protein sequence encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. Also included in the embodiments are nucleic acid sequences encoding the extracellular binding domain, the hinge domain, the transmembrane domain, or the signaling domain of the second CISC component. In some embodiments, the protein sequence of the second CISC component comprising the second extracellular binding domain, the hinge domain, the transmembrane domain, and / or the signaling domain (including, in some embodiments, a truncated IL2Rβ signaling domain) comprises an amino acid sequence having 100%, 99%, 98%, 95%, 90%, 85% or 80% sequence identity with the sequence shown in SEQ ID NO: 5, 8, 13, 14, 15, 16, or 17, or any combination of all numbers and ranges contained within these percentages.

[0093] In some embodiments, the protein sequence may include a linker. In some embodiments, the linker includes 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids (such as glycines), or includes a number of amino acids (such as glycines), or includes a number of amino acids within a range defined by any two of these numbers. In some embodiments, the glycine spacer includes at least three glycines. In some embodiments, the glycine spacer includes a sequence shown in SEQ ID NO: 18 (GGGS; SEQ ID NO: 18), a sequence shown in SEQ ID NO: 19 (GGGSGGG; SEQ ID NO: 19), a sequence shown in SEQ ID NO: 20 (GGG; SEQ ID NO: 20), a sequence shown in SEQ ID NO: 21 (GGS; SEQ ID NO: 21), a sequence shown in SEQ ID NO: 22 (GGSP; SEQ ID NO: 22), or a sequence shown in SEQ ID NO: 31 (PAAL; SEQ ID NO: 31). Nucleic acid sequences encoding SEQ ID NOs: 18-22 and 31 are also included in the embodiments. In some embodiments, the transmembrane domain is located N-terminal to the signaling domain, the hinge domain is located N-terminal to the transmembrane domain, the linker is located N-terminal to the hinge domain, and the extracellular binding domain is located N-terminal to the linker.

[0094] In some embodiments, the protein sequence of two homodimerizing CISC components or a sequence encoding two homodimerizing CISC components is provided. In some embodiments, the first CISC component is the IL2Rγ-CISC complex. In some embodiments, the IL2Rγ-CISC complex comprises the amino acid sequence shown in SEQ ID NO:23. Also included in the embodiments is a nucleic acid sequence encoding the protein sequence of SEQ ID NO:23.

[0095] In some embodiments, the protein sequence of the first CISC component comprises a protein sequence encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. Also included in the embodiments are nucleic acid sequences encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. In some embodiments, the protein sequence of the first CISC component comprising the first extracellular binding domain, the hinge domain, the transmembrane domain, and / or the signaling domain comprises an amino acid sequence having 100%, 99%, 98%, 95%, 90%, 85% or 80% sequence identity with the sequence set forth in SEQ ID NO:23, including all numbers and ranges contained within these percentages.

[0096] In some embodiments, the second CISC component is an IL2Rβ-containing complex or an IL2Rα-containing complex. In some embodiments, the IL2Rβ-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 24. Also included in the embodiments are nucleic acid sequences that encode the protein sequence of SEQ ID NO: 24.

[0097] In some embodiments, the IL2Rα-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 25. Also included in embodiments are nucleic acid sequences that encode the protein sequence of SEQ ID NO: 25.

[0098] In some embodiments, the protein sequence of the second CISC component comprises a protein sequence encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. Also included in the embodiments are nucleic acid sequences encoding the extracellular binding domain, the hinge domain, the transmembrane domain, or the signaling domain of the second CISC component. In some embodiments, the protein sequence of the second CISC component comprising the second extracellular binding domain, the hinge domain, the transmembrane domain, and / or the signaling domain comprises an amino acid sequence having 100%, 99%, 98%, 95%, 90%, 85% or 80% sequence identity with the sequence shown in SEQ ID NO:24 or SEQ ID NO:25, including all numbers and ranges contained within these percentages.

[0099] In some embodiments, the protein sequence may include a linker. In some embodiments, the linker includes 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids (such as glycines), or includes a number of amino acids (such as glycines), or includes a number of amino acids within a range defined by any two of these numbers. In some embodiments, the glycine spacer includes at least three glycines. In some embodiments, the glycine spacer includes a sequence shown in SEQ ID NO: 18 (GGGS; SEQ ID NO: 18), a sequence shown in SEQ ID NO: 19 (GGGSGGG; SEQ ID NO: 19), a sequence shown in SEQ ID NO: 20 (GGG; SEQ ID NO: 20), a sequence shown in SEQ ID NO: 21 (GGS; SEQ ID NO: 21), a sequence shown in SEQ ID NO: 22 (GGSP; SEQ ID NO: 22), or a sequence shown in SEQ ID NO: 31 (PAAL; SEQ ID NO: 31). Nucleic acid sequences encoding SEQ ID NOs: 18-22 and 31 are also included in the embodiments. In some embodiments, the transmembrane domain is located N-terminal to the signaling domain, the hinge domain is located N-terminal to the transmembrane domain, the linker is located N-terminal to the hinge domain, and the extracellular binding domain is located N-terminal to the linker.

[0100] In some embodiments, the sequence encoding the two homodimerizing CISC components incorporates the FKBP F36V domain, which homodimerizes with the ligand, AP1903.

[0101] In some embodiments, a protein sequence of a single homodimerizing CISC component or a sequence encoding a single homodimerizing CISC component is provided. In some embodiments, the single CISC component is an IL7Rα-CISC complex. In some embodiments, the IL7Rα-CISC complex comprises the amino acid sequence shown in SEQ ID NO:26. Also included in the embodiments is a nucleic acid sequence encoding the protein sequence of SEQ ID NO:26.

[0102] In some embodiments, the single CISC component is an MPL-CISC complex. In some embodiments, the MPL-CISC complex comprises the amino acid sequence set forth in SEQ ID NO: 27. Also included in embodiments are nucleic acid sequences that encode the protein sequence of SEQ ID NO: 27.

[0103] In some embodiments, the protein sequence of the single CISC component comprises a protein sequence encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. Also included in the embodiments are nucleic acid sequences encoding an extracellular binding domain, a hinge domain, a transmembrane domain, or a signaling domain. In some embodiments, the protein sequence of the first CISC component comprising a first extracellular binding domain, a hinge domain, a transmembrane domain, and / or a signaling domain comprises an amino acid sequence having 100%, 99%, 98%, 95%, 90%, 85% or 80% sequence identity, or within a range defined by any two of these percentages, with the sequence shown in SEQ ID NO:26 or SEQ ID NO:27.

[0104] In some embodiments, the sequence encoding a single homodimerizing CISC component incorporates the FKBP F36V domain, which homodimerizes with the ligand, AP1903.

[0105] vector A combination of various vectors can be constructed for efficient transduction and transgene expression. In some embodiments, the vector is a viral vector. In another embodiment, the vector includes a combination of a viral vector and a plasmid vector. Another viral vector includes a foamy virus, an adenoviral vector, an adeno-associated viral (AAV) vector, a retroviral vector, and / or a lentiviral vector. In some embodiments, the vector is a lentiviral vector. In some embodiments, the vector is a foamy virus vector, an adenoviral vector, a retroviral vector, or a lentiviral vector. In some embodiments, the vector is a vector for protein expression in a bacterial system such as E. coli. In another embodiment, a first vector can encode a first CISC component comprising a first extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof, and a second vector can encode a second CISC component comprising a second extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a portion thereof.

[0106] The vector may have one or more promoters for inducing expression of DNA sequences in the vector (e.g., DNA sequences encoding naked FRB domains or components of CISC). A "promoter" is a DNA region that initiates transcription of a particular gene. The promoter may be located near the gene transcription start site or upstream in the same DNA strand (5' region of the sense strand). The promoter may be a conditionally inducible promoter or a constitutive promoter. The promoter may be specific for protein expression in bacterial cells, mammalian cells, or insect cells. In some embodiments, when a nucleic acid encoding a fusion protein is provided, the nucleic acid further comprises a promoter sequence. In some embodiments, the promoter is specific for protein expression in bacterial cells, mammalian cells, or insect cells. In some embodiments, the promoter is a conditional promoter or a constitutive promoter. In some embodiments, the promoter is a MND promoter (a synthetic promoter comprising a modified MoMuLV LTR U3 region and a myeloproliferative sarcoma virus enhancer). In some embodiments, the MND promoter comprises the nucleic acid sequence of SEQ ID NO: 33.

[0107] As used herein, "conditional" or "inducible" refers to a nucleic acid construct, such as a promoter, that causes a gene to be expressed in the presence of an inducer, but does not cause substantial gene expression in the absence of the inducer.

[0108] As used herein, "constitutive" refers to a nucleic acid construct that contains a constitutive promoter and thus directs expression of a polypeptide that is produced continuously.

[0109] In some embodiments, the inducible promoter has low basal activity. In some embodiments, when using lentiviral vectors, the basal activity in uninduced cells is 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1% or less (but not 0%), or a percentage within a range defined by any two of these values, of the basal activity in cells in which expression of the gene is induced. Basal activity can be determined by measuring the expression of a transgene (e.g., a marker gene) in the absence of an inducer (e.g., a drug) using flow cytometry. In some of the embodiments described herein, expression is measured using a marker protein (e.g., mCherry).

[0110] In some embodiments, the inducible promoter is capable of inducing higher activity when expressed than when expression is not induced or at basal levels. In some embodiments, the level of activity when expression is induced is 2-fold, 4-fold, 6-fold, 8-fold, 9-fold, 10-fold or more than when expression is not induced, or within a range defined by any two of these values. In some embodiments, the transgene under the control of the inducible promoter is turned off in the absence of a transactivator for less than 10 days, less than 8 days, less than 6 days, less than 4 days, less than 2 days, or less than 1 day, or within a range defined by any two of these periods, but not at 0 days.

[0111] In some embodiments, inducible promoters are designed and / or engineered to have low basal activity, be induced to produce high levels of expression, and / or be capable of being switched on and off for short periods of time.

[0112] In some embodiments, the expression vector comprises a nucleic acid encoding a protein sequence set forth in one or more of SEQ ID NOs: 1, 2, 5, 7, 9, 10, 11, 12, 13, 14, 15, 16, and 17. In some embodiments, the expression vector comprises a nucleic acid sequence set forth in SEQ ID NO: 28. SEQ ID NO: 28 encodes the protein sequence set forth in SEQ ID NO: 12 and SEQ ID NO: 16.

[0113] In some embodiments, the expression vector is a variant of SEQ ID NO: 28 as set forth in SEQ ID NO: 29. SEQ ID NO: 29 encodes the protein sequence set forth in SEQ ID NO: 10 and SEQ ID NO: 14.

[0114] In some embodiments, the expression vector is a variant of SEQ ID NO:28 as set forth in SEQ ID NO:30. SEQ ID NO:30 encodes the protein sequences set forth in SEQ ID NO:11 and SEQ ID NO:15.

[0115] In some embodiments, the expression vector comprises a nucleic acid having at least 80%, 85%, 90%, 95%, 98% or 99% nucleic acid sequence identity (or a percentage of nucleic acid sequence identity within a range defined by any two of these percentages) to a nucleotide sequence provided herein, or a specifically derived fragment thereof. In some embodiments, the expression vector comprises a promoter. In some embodiments, the expression vector comprises the nucleic acid encoding a fusion protein. In some embodiments, the vector is RNA or DNA.

[0116] Naked FRB domain Provided is a naked FKBP-rapamycin binding (FRB) domain polypeptide for intracellular expression. In some embodiments, the naked FRB domain polypeptide is co-expressed with one or more protein sequences of a first CISC component and a second CISC component as described in more detail herein. The naked FRB domain polypeptide may comprise an amino acid sequence having 100%, 99%, 98%, 95%, 90%, 85% or 80% sequence identity with the sequence shown in SEQ ID NO: 1 or 2, or sequence identity including all numbers and ranges contained within these percentages.

[0117] Genome editing systems The present disclosure also provides a system for genome editing in a cell, the system comprising a nucleic acid encoding a naked FRB domain polypeptide and optionally further encoding CISC, targeted into the genome of the cell to express the naked FRB domain polypeptide described herein and optionally express CISC as described herein.The present disclosure also provides, inter alia, a system for use in the selective activation and / or expansion of a genetically modified cell population, for example, for preparing a cell population selectively enriched for genetically modified cells.

[0118] In some embodiments, i) a deoxyribonucleic acid (DNA) endonuclease, or a nucleic acid encoding said DNA endonuclease; ii) a guide RNA (gRNA) comprising a spacer sequence complementary to a target sequence within a target genomic locus of the cell, or a nucleic acid encoding the gRNA; and iii) a donor template comprising a donor cassette comprising a nucleic acid sequence encoding a naked FKBP-rapamycin binding (FRB) domain polypeptide. The present invention provides a system including: The DNA endonuclease, the gRNA and the donor template are configured such that a complex formed by association of the DNA endonuclease with the gRNA promotes targeted integration of the donor cassette into the target genomic locus of the cell, generating a genetically modified cell capable of expressing the naked FRB domain polypeptide.

[0119] In some embodiments, according to any of the systems described herein, the gRNA comprises a spacer sequence complementary to a sequence within the FOXP3 locus, AAVS1 locus, or TCRa (TRAC) locus of a cell. In some embodiments, the gRNA comprises a spacer sequence set forth in any of SEQ ID NOs: 40-57, or a variant of the spacer sequence having 3 or fewer mismatches compared to any of SEQ ID NOs: 40-57.

[0120] As used herein, "Cas endonuclease" or "Cas nuclease" includes, but is not limited to, RNA-guided DNA endonuclease enzymes, for example, those associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immune system. As used herein, "Cas endonuclease" refers to both native and recombinant Cas endonucleases. In some embodiments, according to any of the systems described herein, the Cas DNA endonuclease is a Cas9 endonuclease. In some embodiments, the Cas9 endonuclease is a Cas9 endonuclease from Streptococcus pyogenes (spCas9). In some embodiments, the Cas9 is a Cas9 from Staphylococcus lugdunensis (SluCas9).

[0121] In some embodiments, according to any of the systems described herein, the system includes a nucleic acid encoding a DNA endonuclease. In some embodiments, the nucleic acid encoding a DNA endonuclease is codon-optimized for expression in a host cell. In some embodiments, the nucleic acid encoding a DNA endonuclease is codon-optimized for expression in a human cell. In some embodiments, the nucleic acid encoding a DNA endonuclease is DNA (such as a DNA plasmid). In some embodiments, the nucleic acid encoding a DNA endonuclease is RNA (such as an mRNA).

[0122] In some embodiments, according to any of the systems described herein, the donor template is configured to integrate the donor cassette into the genomic locus targeted by the gRNA by homology-directed repair (HDR) included in the system. In some embodiments, the donor cassette is flanked by homology arms corresponding to the sequence of the targeted genomic locus. In some embodiments, the length of the homology arms is at least 0.2 kb or at least about 0.2 kb (e.g., at least 0.3 kb, at least 0.4 kb, at least 0.5 kb, at least 0.6 kb, at least 0.7 kb, at least 0.8 kb, at least 0.9 kb, at least 1 kb or at least more, or at least about 0.3 kb, at least about 0.4 kb, at least about 0.5 kb, at least about 0.6 kb, at least about 0.7 kb, at least about 0.8 kb, at least about 0.9 kb, at least about 1 kb or at least more). In some embodiments, the length of the homologous arm is at least 0.4 kb or at least about 0.4 kb, such as 0.45 kb, 0.6 kb, or 0.8 kb. Exemplary homologous arms further include those contained in a donor template having the sequence of SEQ ID NO: 32. Exemplary donor templates include donor templates having the sequences of SEQ ID NOs: 3-4, 8, 28-30, 32, and 37-39. In some embodiments, the donor template is encoded by an adeno-associated virus (AAV) vector. In some embodiments, the AAV vector is an AAV2 vector, an AAV5 vector, or an AAV6 vector. In some embodiments, the AAV vector is an AAV6 vector.

[0123] In some embodiments, according to any of the systems described herein, the donor template is configured to integrate the donor cassette into a genomic locus targeted by a gRNA included in the system by non-homologous end joining (NHEJ). In some embodiments, the donor cassette is flanked on one or both sides by a gRNA target site. In some embodiments, the donor cassette is flanked on both sides by a gRNA target site. In some embodiments, the gRNA target site is a target site of a gRNA included in the system. In some embodiments, the gRNA target site of the donor template is the reverse complement of a cellular genomic gRNA target site targeted by a gRNA included in the system. In some embodiments, the donor template is encoded by an adeno-associated virus (AAV) vector. In some embodiments, the AAV vector is an AAV2 vector, an AAV5 vector, or an AAV6 vector. In some embodiments, the AAV vector is an AAV6 vector.

[0124] In some embodiments, according to any of the systems described herein, the DNA endonuclease or a nucleic acid encoding the DNA endonuclease is formulated by encapsulation in a liposome or lipid nanoparticle. In some embodiments, the liposome or the lipid nanoparticle further comprises a gRNA. In some embodiments, the liposome or the lipid nanoparticle is a lipid nanoparticle. In some embodiments, the system comprises a lipid nanoparticle comprising a nucleic acid encoding a DNA endonuclease and a gRNA. In some embodiments, the nucleic acid encoding the DNA endonuclease is an mRNA encoding a DNA endonuclease.

[0125] In some embodiments, according to any of the systems described herein, the DNA endonuclease associates with a gRNA to form a ribonucleoprotein (RNP) complex.

[0126] Genome editing Provided is a method for genetically modifying a host cell or organism using gene editing, expressing any of the naked FRB domain polypeptides disclosed herein, and optionally expressing the chemical-induced signaling complex polypeptides disclosed herein. In some embodiments, gene editing is performed using the CRISPR / Cas system.

[0127] CRISPR endonuclease system Genomic loci of Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) can be found in the genomes of many prokaryotes (e.g., bacteria and archaea). In prokaryotes, CRISPR loci encode products that function as a type of immune system useful in the defense of prokaryotes from foreign invaders such as viruses and phages. The function of a CRISPR locus has three stages, consisting of the integration of new sequences into the CRISPR locus, the expression of CRISPR RNA (crRNA), and the silencing of foreign invading nucleic acids. Five types of CRISPR systems (e.g., type I, type II, type III, type U, and type V) have been identified.

[0128] CRISPR loci contain many short repeating sequences called "repeats". When expressed, the repeats can form secondary hairpin structures (e.g. hairpins) and / or have unstructured single-stranded sequences. The repeats usually occur in clusters and vary widely between species. The repeats are spaced apart by unique intervening sequences called "spacers", resulting in a repeat-spacer-repeat structured locus. The spacers are identical or highly homologous to a known foreign invader sequence. The spacer-repeat unit encodes a crisprRNA (crRNA), which is processed to yield the mature form of the spacer-repeat unit. The crRNA has a "seed" or spacer sequence that is responsible for targeting the target nucleic acid (in the prokaryotic native form, the spacer sequence targets the foreign invader nucleic acid). The spacer sequence is located at the 5' or 3' end of the crRNA.

[0129] CRISPR locus further has a polynucleotide sequence encoding CRISPR-associated (Cas) gene. Cas gene encodes an endonuclease involved in the biosynthesis and interference stages of crRNA function in prokaryotes. Some Cas genes have homologous secondary and / or tertiary structures.

[0130] The genome-targeting nucleic acid interacts with a site-directed polypeptide (e.g., a nucleic acid-guided nuclease such as Cas9) to form a complex. The genome-targeting nucleic acid (e.g., a gRNA) guides the site-directed polypeptide to the target nucleic acid.

[0131] As mentioned above, in some embodiments, the site-directed polypeptide and the genome-targeting nucleic acid can be administered separately to a cell or a subject. Meanwhile, in some other embodiments, the site-directed polypeptide can be pre-complexed with one or more guideRNAs, or the site-directed polypeptide can be pre-complexed with a tracrRNA and one or more crRNAs. The pre-complexed material can then be administered to a cell or a subject. Such pre-complexed material is known as a ribonucleoprotein particle (RNP).

[0132] Type II CRISPR systems The biogenesis of crRNA in natural type II CRISPR systems requires trans-activating CRISPR RNA (tracrRNA). tracrRNA is modified by endogenous RNaseIII and then hybridizes to the crRNA repeat sequence of the pre-crRNA array. Endogenous RNaseIII is recruited to cleave the pre-crRNA. The cleaved crRNA is trimmed (e.g., trimming of the 5' end) by an exoribonuclease to generate the mature form of crRNA. tracrRNA remains hybridized to the crRNA, and the tracrRNA and crRNA associate with a site-directed polypeptide (e.g., Cas9). In the crRNA-tracrRNA-Cas9 complex, the crRNA guides the complex to a target nucleic acid to which the crRNA can hybridize. Hybridization of the crRNA to the target nucleic acid activates Cas9 to cleave the target nucleic acid. The target nucleic acid in type II CRISPR systems is called a protospacer adjacent motif (PAM). In fact, PAM is essential to facilitate the binding of site-directed polypeptides (e.g., Cas9) to target nucleic acids. Type II systems (also called Nmeni or CASS4) are further subdivided into type II-A (CASS4) and type II-B (CASS4a). Jinek, M. et al. (2012). Science, 337(6096):816-821 show the usefulness of the CRISPR / Cas9 system for RNA-programmable genome editing, and furthermore, international patent application WO 2013 / 176772 describes numerous examples and applications of the CRISPR / Cas endonuclease system for site-directed gene editing.

[0133] V-type CRISPR system Type V CRISPR systems have some important differences from type II systems. For example, Cpf1 is a single-stranded RNA-guided endonuclease, but unlike type II systems, it lacks tracrRNA. Indeed, Cpf1-associated CRISPR arrays are processed into mature crRNAs without the further need for trans-activated tracrRNA. Type V CRISPR arrays are processed into short mature crRNAs of 42-44 nucleotides in length, and each mature crRNA begins with a 19-nucleotide-long direct repeat sequence followed by a 23-25-nucleotide-long spacer sequence. In contrast, mature crRNAs in type II systems begin with a 20-24-nucleotide-long spacer sequence followed by a 22-nucleotide or approximately 22-nucleotide-long direct repeat sequence. Moreover, Cpf1 utilizes a T-rich protospacer adjacent motif, allowing the target DNA following this short T-rich PAM to be efficiently cleaved by the Cpf1-crRNA complex. This is in contrast to type II systems, which utilize a G-rich PAM following the target DNA. Thus, type V systems cleave targets at a position distant from the PAM, whereas type II systems cleave targets adjacent to the PAM. Furthermore, in contrast to type II systems, Cpf1 cleaves the DNA double strand at a staggered position, resulting in the formation of 4- or 5-nucleotide long 5'-end overhangs. In contrast, type II double strand breaks result in the formation of blunt ends. Like type II systems, Cpf1 is predicted to contain a RuvC-like endonuclease domain, but unlike type II systems, it does not possess a second HNH endonuclease domain.

[0134] Site-directed polypeptide or DNA endonuclease Modification of the target DNA by NHEJ and / or HDR can result in, for example, mutations, deletions, alterations, integrations, gene corrections, gene replacements, gene tagging, transgene insertions, nucleotide deletions, gene disruptions, translocations, and / or gene mutations. The integration of non-natural nucleic acids into genomic DNA is an example of genome editing.

[0135] The site-directed polypeptide is a nuclease used in genome editing to cut DNA. The site-directed polypeptide can be administered to cells or subjects as one or more polypeptides or one or more mRNAs encoding the polypeptide.

[0136] In the context of the CRISPR / Cas or CRISPR / Cpf1 system, the site-directed polypeptide binds to the guide RNA, which in turn identifies the site of the target DNA to which the site-directed polypeptide is directed. In the embodiments of the CRISPR / Cas or CRISPR / Cpf1 system described herein, the site-directed polypeptide is an endonuclease, such as a DNA endonuclease. As used herein, "Cas endonuclease" or "Cas nuclease" includes, but is not limited to, the RNA-guided DNA endonuclease enzymes associated with, for example, the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immune system. As used herein, "Cas endonuclease" refers to both natural and recombinant Cas endonucleases.

[0137] In some embodiments, the site-directed polypeptide has multiple nucleic acid cleavage domains (e.g., nuclease sites). Two or more nucleic acid cleavage domains can be linked via a linker. In some embodiments, the linker has a flexible linker. The length of the linker can be 1 amino acid, 2 amino acids, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, 8 amino acids, 9 amino acids, 10 amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids, 15 amino acids, 16 amino acids, 17 amino acids, 18 amino acids, 19 amino acids, 20 amino acids, 21 amino acids, 22 amino acids, 23 amino acids, 24 amino acids, 25 amino acids, 30 amino acids, 35 amino acids, 40 amino acids, or more.

[0138] Natural wild-type Cas9 enzyme has two nuclease domains: HNH nuclease domain and RuvC domain. In this specification, "Cas9" refers to both natural Cas9 and recombinant Cas9. The Cas9 enzyme envisioned in this specification has HNH nuclease domain or HNH-like nuclease domain, and / or RuvC nuclease domain or RuvC-like nuclease domain.

[0139] The HNH domain or HNH-like domain has an McrA-like fold. The HNH domain or HNH-like domain has two antiparallel β-strands and one α-helix. The HNH domain or HNH-like domain has a metal binding site (e.g., a divalent cation binding site). The HNH domain or HNH-like domain can cleave a single strand of a target nucleic acid (e.g., the complementary strand of the target strand of crRNA).

[0140] The RuvC domain or RuvC-like domain has an RNaseH fold or an RNaseH-like fold. The RuvC domain or RNaseH domain is involved in a diverse set of nucleic acid-based functions, including acting on both RNA and DNA. The RNaseH domain has five β-strands surrounded by multiple α-helices. The RuvC domain or RNaseH domain or RuvC-like domain or RNaseH-like domain has a metal binding site (e.g., a divalent cation binding site). The RuvC domain or RNaseH domain or RuvC-like domain or RNaseH-like domain can cleave a single strand of a target nucleic acid (e.g., a non-complementary strand of a double-stranded target DNA).

[0141] In some embodiments, the site-directed polypeptide has an amino acid sequence that has at least 10%, at least 15%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99% or 100% amino acid sequence identity to a typical wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes, SEQ ID NO: 8 described in US2014 / 0068797, or Cas9 described in Sapranauskas, R. et al. (2011). Nucl. Acids Res, 39(21): 9275-9282), and various other site-directed polypeptides).

[0142] In some embodiments, the site-directed polypeptide has an amino acid sequence that has at least 10%, at least 15%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99% or 100% amino acid sequence identity to the nuclease domain of a typical wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes, supra).

[0143] In some embodiments, the site-directed polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity over 10 contiguous amino acids to a wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes, supra). In some embodiments, the site-directed polypeptide has at most 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity over 10 contiguous amino acids to a wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes, supra). In some embodiments, the HNH nuclease domain of the site-directed polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity over 10 consecutive amino acids to a wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes as described above). In some embodiments, the HNH nuclease domain of the site-directed polypeptide has at most 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity over 10 consecutive amino acids to a wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes as described above). In some embodiments, the RuvC nuclease domain of the site-directing polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity over 10 contiguous amino acids to a wild-type site-directing polypeptide (e.g., Cas9 from S. pyogenes, supra). In some embodiments, the RuvC nuclease domain of the site-directing polypeptide has at most 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99% or 100% identity over 10 contiguous amino acids to a wild-type site-directing polypeptide (e.g., Cas9 from S. pyogenes, supra).

[0144] In some embodiments, the site-directed polypeptide has a modified form of a typical wild-type site-directed polypeptide. The modified form of a typical wild-type site-directed polypeptide has a mutation that reduces the nucleic acid cleavage activity of the site-directed polypeptide. In some embodiments, the modified form of a typical wild-type site-directed polypeptide has a nucleic acid cleavage activity of less than 90%, less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nucleic acid cleavage activity of a typical wild-type site-directed polypeptide (e.g., Cas9 from S.pyogenes as described above). In addition, the modified form of the site-directed polypeptide may have substantially no nucleic acid cleavage activity. When the site-directed polypeptide is a modified form that has substantially no nucleic acid cleavage activity, such a modified form is referred to herein as "enzymatically inactive".

[0145] In some embodiments, the modified form of the site-directed polypeptide has a mutation that allows it to induce a single-strand break (SSB) on the target nucleic acid (e.g., by cleaving only one of the sugar-phosphate backbones of a double-stranded target nucleic acid). In some embodiments, the mutation results in a nucleic acid cleavage activity that is less than 90%, less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nucleic acid cleavage activity of one or more of the multiple nucleic acid cleavage domains of the wild-type site-directed polypeptide (e.g., Cas9 from S. pyogenes, as described above). In some embodiments, the mutation reduces the ability of one or more of the multiple nucleic acid cleavage domains to cleave a non-complementary strand of the target nucleic acid while retaining the ability to cleave a complementary strand of the target nucleic acid. In some embodiments, the mutation reduces the ability of one or more of the multiple nucleic acid cleavage domains to cleave a complementary strand of the target nucleic acid while retaining the ability to cleave a non-complementary strand of the target nucleic acid. For example, mutations are made in residues of a typical wild-type S. pyogenes Cas9 polypeptide, such as Asp10, His840, Asn854, and Asn856, that inactivate one or more of the nucleic acid cleavage domains (e.g., nuclease domains). In some embodiments, the residues at which mutations are introduced correspond to the Asp10, His840, Asn854, and Asn856 residues of a typical wild-type S. pyogenes-derived Cas9 polypeptide (e.g., as determined by sequence and / or structure alignment). Examples of such mutations include, but are not limited to, D10A, H840A, N854A, or N856A. One of skill in the art will appreciate that mutations other than alanine substitutions are suitable.

[0146] In some embodiments, the D10A mutation, in combination with one or more of the H840A mutation, the N854A mutation, and the N856A mutation, generates a site-directed polypeptide that is substantially devoid of DNA cleavage activity. In some embodiments, the H840A mutation, in combination with one or more of the D10A mutation, the N854A mutation, and the N856A mutation, generates a site-directed polypeptide that is substantially devoid of DNA cleavage activity. In some embodiments, the N854A mutation, in combination with one or more of the H840A mutation, the D10A mutation, and the N856A mutation, generates a site-directed polypeptide that is substantially devoid of DNA cleavage activity. In some embodiments, the N856A mutation, in combination with one or more of the H840A mutation, the N854A mutation, and the D10A mutation, generates a site-directed polypeptide that is substantially devoid of DNA cleavage activity. Site-directed polypeptides with one substantially inactive nuclease domain are referred to as "nickases."

[0147] In some embodiments, variants of RNA-guided endonucleases (e.g., Cas9) can be used to increase the specificity of CRISPR-mediated genome editing. For example, wild-type Cas9 is generally guided by a single-stranded guide RNA designed to hybridize with a specific sequence of about 20 nucleotides in the target sequence (e.g., an endogenous genomic locus). However, a few mismatches can be tolerated between the guide RNA and the target locus, effectively shortening the length of homologous sequence required at the target site to, for example, as little as 13 nt of homologous sequence, which may increase the likelihood that the CRISPR / Cas9 complex will bind elsewhere in the target genome and cleave the double-stranded nucleic acid. This is also known as off-target cleavage. On the other hand, since each nickase variant of Cas9 cleaves only one strand, a pair of nickases must bind in close proximity on opposite strands of the target nucleic acid to create a pair of nicks that result in a double-stranded break. This requires that two separate guide RNAs (one for each nickase) bind in close proximity on opposite strands of the target nucleic acid. Following this requirement, the minimum length of homologous sequence required to generate a double-stranded break is effectively doubled, and as a result, the two guide RNA sites (if they are present) are unlikely to be close enough to each other to generate a double-stranded break, thereby reducing the possibility that a double-stranded break will occur elsewhere in the genome. As reported in the art, nickases can also be used to promote HDR over NHEJ. By performing HDR using a specific donor sequence that effectively mediates the desired change, the selected change can be introduced into the target site of the genome. Descriptions of various CRISPR / Cas systems for use in gene editing are described, for example, in International Patent Application WO2013 / 176772 and Sander, JD et al. (2014). Nat. Biotechnol., 32(4):347-355, and references cited therein.

[0148] In some embodiments, the site-directed polypeptide (e.g., a variant of a site-directed polypeptide, a mutant of a site-directed polypeptide, an enzymatically inactive site-directed polypeptide, and / or a site-directed polypeptide that is enzymatically inactive under certain conditions) targets a nucleic acid. In some embodiments, the site-directed polypeptide (e.g., a variant of an endoribonuclease, a mutant of an endoribonuclease, an enzymatically inactive endoribonuclease, and / or an endoribonuclease that is enzymatically inactive under certain conditions) targets a DNA. In some embodiments, the site-directed polypeptide (e.g., a variant of an endoribonuclease, a mutant of an endoribonuclease, an enzymatically inactive endoribonuclease, and / or an endoribonuclease that is enzymatically inactive under certain conditions) targets an RNA.

[0149] In some embodiments, the site-directed polypeptide has one or more non-native sequences (eg, the site-directed polypeptide is a fusion protein).

[0150] In some embodiments, the site-directing polypeptide has an amino acid sequence having at least 15% amino acid identity to Cas9 derived from a bacterium (e.g., S. pyogenes), a nucleic acid binding domain, and two nucleic acid cleavage domains (such as an HNH domain and a RuvC domain).

[0151] In some embodiments, the site-directing polypeptide has an amino acid sequence having at least 15% amino acid identity to Cas9 derived from a bacterium (e.g., S. pyogenes) and two nucleic acid cleavage domains (such as an HNH domain and a RuvC domain).

[0152] In some embodiments, the site-directed polypeptide has an amino acid sequence having at least 15% amino acid identity to Cas9 derived from a bacterium (e.g., S. pyogenes) and two nucleic acid cleavage domains, one or both of which have at least 50% amino acid identity to the nuclease domain of Cas9 derived from a bacterium (e.g., S. pyogenes).

[0153] In some embodiments, the site-directing polypeptide has an amino acid sequence having at least 15% amino acid identity to Cas9 derived from a bacterium (e.g., S. pyogenes), two nucleic acid cleavage domains (e.g., an HNH domain and a RuvC domain), and a non-native sequence (e.g., a nuclear localization signal) or a linker that links the site-directing polypeptide to the non-native sequence.

[0154] In some embodiments, the site-directed polypeptide has an amino acid sequence having at least 15% amino acid identity to Cas9 derived from a bacterium (e.g., S. pyogenes), and two nucleic acid cleavage domains (e.g., an HNH domain and a RuvC domain), one or both of which have a mutation that reduces the cleavage activity of these nuclease domains by at least 50%.

[0155] In some embodiments, the site-directed polypeptide has an amino acid sequence that has at least 15% amino acid identity to Cas9 derived from a bacterium (e.g., S. pyogenes), and two nucleic acid cleavage domains (e.g., an HNH domain and a RuvC domain), and has a mutation at position 10 aspartic acid of one of the nuclease domains and / or a mutation at position 840 histidine of one of the nuclease domains that reduces the cleavage activity of the nuclease domain by at least 50%.

[0156] In some embodiments, one or more site-directed polypeptides (e.g., DNA endonucleases) comprise two nickases that cooperate to create one double-stranded break at a specific locus in the genome, or one or more site-directed polypeptides comprise four nickases that cooperate to create two double-stranded breaks at a specific locus in the genome, or one site-directed polypeptide (e.g., DNA endonuclease) acts on one double-stranded break at a specific locus in the genome.

[0157] In some embodiments, the polynucleotide encoding the site-directed polypeptide can be used for genome editing.In some of these embodiments, the polynucleotide encoding the site-directed polypeptide is codon-optimized for expression in the cell that contains the target DNA of interest according to standard methods in the art.For example, when the target nucleic acid of interest is in a human cell, it is envisioned that the polynucleotide encoding Cas9 is optimized for human codons and used to generate Cas9 polypeptide.

[0158] Cas genes / polypeptides and protospacer adjacent motifs Exemplary CRISPR / Cas polypeptides include the Cas9 polypeptide shown in Figure 1 of Fonfara, I. et al. (2014). Nucl. Acids Res., 42(4):2577-2590, which is incorporated herein by reference. The naming system for CRISPR / Cas genes has undergone significant revision since the discovery of Cas genes. Figure 5 by Fonfara et al. (2014) shows the PAM sequences for Cas9 polypeptides from various species.

[0159] nucleic acid Genome-targeting nucleic acids or guide RNAs The present disclosure provides a genome-targeting nucleic acid that can direct the activity of an associated polypeptide (e.g., a site-directed polypeptide or a DNA endonuclease) to a specific target sequence (e.g., a gene of interest) within a target nucleic acid. In some embodiments, the genome-targeting nucleic acid is an RNA. Herein, the genome-targeting RNA is referred to as a "guide RNA" or "gRNA." The guide RNA has at least a spacer sequence and a CRISPR repeat sequence that hybridize to a target nucleic acid sequence of interest. In a type II system, the gRNA further has a second RNA called a tracrRNA sequence. In a type II guide RNA (gRNA), the CRISPR repeat sequence and the tracrRNA sequence hybridize with each other to form a double strand. In a type V guide RNA (gRNA), the CRISPR repeat RNA (crRNA) forms a double strand. In both systems, the double strand binds to a site-directed polypeptide to form a complex of the guide RNA and the site-directed polypeptide. The genome-targeting nucleic acid confers target specificity to the complex formed by associating with the site-directed polypeptide. Thus, the genome-targeting nucleic acid confers directionality to the activity of the site-specific polypeptide.

[0160] In some embodiments, the genome-targeting nucleic acid is a bimolecular guide RNA. In some embodiments, the genome-targeting nucleic acid is a single-molecule guide RNA. A bimolecular guide RNA has two RNA strands. The first strand has, from the 5' to 3' end, an optional spacer extension sequence, a spacer sequence, and a CRISPR minimal repeat sequence. The second strand has a tracrRNA minimal sequence (complementary to the CRISPR minimal repeat sequence), a 3'tracrRNA sequence, and an optional tracrRNA extension sequence. A single-molecule guide RNA (sgRNA) in the type II system has, from the 5' to 3' end, an optional spacer extension sequence, a spacer sequence, a CRISPR minimal repeat sequence, a single-molecule guide linker, a tracrRNA minimal sequence, a 3'tracrRNA sequence, and an optional tracrRNA extension sequence. The optional tracrRNA extension sequence may have elements that confer additional functions (e.g., stability) to the guide RNA. The single-molecule guide linker links the CRISPR minimal repeat sequence and the tracrRNA minimal sequence to form a hairpin structure. The optional tracrRNA extension sequence has one or more hairpins. The single-molecule guide RNA (sgRNA) of the V-type system has the CRISPR minimal repeat sequence and a spacer sequence from the 5' end to the 3' end.

[0161] As an example, the guide RNAs used in the CRISPR / Cas / Cpf1 system, or other smaller RNAs, can be easily synthesized by chemical means known in the art, as described below. Although chemical synthesis procedures are continually expanding, the length of polynucleotides significantly exceeds about 100 nucleotides, so purification of said RNAs by procedures such as high performance liquid chromatography (HPLC without gels such as PAGE) tends to be difficult. One approach used to generate long RNAs is to generate two or more molecules and then link them together. Very long RNAs, such as RNAs encoding Cas9 or Cpf1 endonucleases, can be easily generated enzymatically. Various RNA modifications can be introduced during or after the process of chemical synthesis and / or enzymatic generation of RNA, including modifications that increase stability, reduce the likelihood or the extent of innate immune response, and / or enhance other attributes, as reported in the art.

[0162] Spacer extension sequence In some embodiments of genome-targeted nucleic acids, the spacer extension sequence can modulate activity, confer stability, and / or provide a location for modifying the genome-targeted nucleic acid. The spacer extension sequence can also modulate on-target or off-target activity or specificity. In some embodiments, a spacer extension sequence is provided. The length of the spacer extension sequence can be more than 1 nucleotide, more than 5 nucleotides, more than 10 nucleotides, more than 15 nucleotides, more than 20 nucleotides, more than 25 nucleotides, more than 30 nucleotides, more than 35 nucleotides, more than 40 nucleotides, more than 45 nucleotides, more than 50 nucleotides, more than 60 nucleotides, more than 70 nucleotides, more than 80 nucleotides, more than 90 nucleotides, more than 100 nucleotides, more than 120 nucleotides, more than 140 nucleotides, more than 160 nucleotides, more than 180 nucleotides, more than 200 nucleotides, more than 300 nucleotides, more than 350 nucleotides, more than 40 nucleotides, more than 45 nucleotides, more than 50 nucleotides, more than 60 nucleotides, more than 70 nucleotides, more than 80 nucleotides, more than 90 nucleotides, more than 100 nucleotides, more than 120 nucleotides, more than 140 nucleotides, more than 160 nucleotides, more than 180 nucleotides, more than 200 nucleotides, more than 3 ... The length of the spacer extension sequence may be greater than 1 nucleotide, greater than 220 nucleotides, greater than 240 nucleotides, greater than 260 nucleotides, greater than 280 nucleotides, greater than 300 nucleotides, greater than 320 nucleotides, greater than 340 nucleotides, greater than 360 nucleotides, greater than 380 nucleotides, greater than 400 nucleotides, greater than 1000 nucleotides, greater than 2000 nucleotides, greater than 3000 nucleotides, greater than 4000 nucleotides, greater than 5000 nucleotides, greater than 6000 nucleotides, or greater than 7000 nucleotides, or more. The length of the spacer extension sequence may be at or about 1 nucleotide, 5 nucleotides, 10 nucleotides, 15 nucleotides, 20 nucleotides,25 nucleotides or about 25 nucleotides long, 30 nucleotides or about 30 nucleotides long, 35 nucleotides or about 35 nucleotides long, 40 nucleotides or about 40 nucleotides long, 45 nucleotides or about 45 nucleotides long, 50 nucleotides or about 50 nucleotides long, 60 nucleotides or about 60 nucleotides long, 70 nucleotides or about 70 nucleotides long, 80 nucleotides or about 80 nucleotides long, 90 nucleotides or about 90 nucleotides long, 100 nucleotides or about 100 nucleotides long, 120 nucleotides or about 120 nucleotides long, 140 nucleotides or about 140 nucleotides long, 160 nucleotides or about 160 nucleotides long, 180 nucleotides or about 200 nucleotides long, 220 nucleotides or about 220 nucleotides long, 240 nucleotides or about 24 The amino acid sequence may be 0, 260, 280, 300, 320, 340, 360, 380, 400, 1000, 2000, 3000, 4000, 5000, 6000, or 7000 nucleotides long, or more. The length of the spacer extension sequence may be less than 1 nucleotide, less than 5 nucleotides, less than 10 nucleotides, less than 15 nucleotides, less than 20 nucleotides, less than 25 nucleotides, less than 30 nucleotides, less than 35 nucleotides, less than 40 nucleotides,The length of the spacer extension sequence may be less than 45, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380, 400, 1000, 2000, 3000, 4000, 5000, 6000, 7000, or more nucleotides. In some embodiments, the length of the spacer extension sequence is less than 10 nucleotides. In some embodiments, the length of the spacer extension sequence is between 10 and 30 nucleotides in length. In some embodiments, the length of the spacer extension sequence is between 30 and 70 nucleotides in length.

[0163] In some embodiments, the spacer extension sequence has another moiety (e.g., a stability control sequence, an endoribonuclease binding sequence, a ribozyme, etc.). In some embodiments, the another moiety decreases or increases the stability of the nucleic acid targeting nucleic acid. In some embodiments, the another moiety is a transcription terminator segment (e.g., a transcription termination sequence). In some embodiments, the another moiety functions in eukaryotic cells. In some embodiments, the another moiety functions in prokaryotic cells. In some embodiments, the another moiety functions in both eukaryotic and prokaryotic cells. Examples of suitable moieties include, but are not limited to, a 5'-end cap (e.g., a 7-methylguanylate cap (m7G)); a riboswitch sequence (e.g., that provides controlled stabilization and / or allows controlled access by a protein or protein complex); a sequence that forms a dsRNA duplex (e.g., a hairpin); a sequence that targets the RNA to a subcellular location (e.g., the nucleus, mitochondria, chloroplasts, etc.); a modification or sequence that allows for tracking (e.g., direct attachment to a fluorescent molecule, attachment to a moiety that facilitates fluorescent detection, a sequence that allows for fluorescent detection, etc.); and / or a modification or sequence that provides a binding site for a protein (e.g., a protein that acts on DNA, such as a transcriptional activator, transcriptional repressor, DNA methyltransferase, DNA methylase, histone acetyltransferase, histone deacetylase, etc.).

[0164] Spacer sequence The spacer sequence hybridizes to a sequence within the target nucleic acid of interest. The spacer of the genomic targeting nucleic acid interacts with the target nucleic acid in a sequence-specific manner through hybridization (e.g., base pairing). Thus, the nucleotide sequence of the spacer varies depending on the sequence of the target nucleic acid of interest.

[0165] In the CRISPR / Cas system described herein, the spacer sequence is designed to hybridize to the target nucleic acid located at the 5' end of the PAM in the Cas enzyme (e.g., Cas9 enzyme) used in this system. The spacer may perfectly match the target sequence or may have a mismatch. Each Cas enzyme has a specific PAM sequence that recognizes the target DNA. For example, Cas9 from Streptococcus pyogenes recognizes a PAM with the sequence 5'-NRG-3' (R represents A or G, and N is any nucleotide adjacent to the 3' end of the target nucleic acid sequence targeted by the spacer sequence) in the target nucleic acid.

[0166] In some embodiments, the target nucleic acid sequence has 20 nucleotides. In some embodiments, the target nucleic acid has fewer than 20 nucleotides. In some embodiments, the target nucleic acid has more than 20 nucleotides. In some embodiments, the target nucleic acid has at least 5, at least 10, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 30, or at least more nucleotides. In some embodiments, the target nucleic acid has at most 5, at most 10, at most 15, at most 16, at most 17, at most 18, at most 19, at most 20, at most 21, at most 22, at most 23, at most 24, at most 25, at most 30, or at most more nucleotides. In some embodiments, the target nucleic acid sequence has 20 bases adjacent to the 5' end of the first nucleotide of the PAM. For example, 5'-NNNNNNNNNNNNNNNNNNNN NRGIn the sequence with -3', the target nucleic acid has a sequence corresponding to these Ns, where N is any nucleotide, and the underlined sequence NRG (where R is G or A) is the Cas9 PAM from S. pyogenes. In some embodiments, the PAM sequence used in the compositions and methods of the disclosure as the sequence recognized by Cas9 from S. pyogenes (Sp) is NGG.

[0167] In some embodiments, the length of the spacer sequence that hybridizes to the target nucleic acid is at least 6 nucleotides (nt) or at least about 6 nucleotides (nt) in length. The length of the spacer sequence can be at least 6 nt, at least 10 nt, at least 15 nt, at least 18 nt, at least 19 nt, at least 20 nt, at least 25 nt, at least 30 nt, at least 35 nt, or at least about 35 nt. or at least about 40 nt, 6nt to 80 nt or about 6 nt to about 80 nt, 6nt to 50 nt or about 6 nt to about 50 nt, 6nt to 45 nt or about 6 nt to about 45 nt, 6nt to 40 nt or about 6 nt to about 40 nt, 6nt to 35 nt or about 6 nt to about 35 nt, 6nt to 30 nt or about 6 nt to about 30 nt, 6nt to 25 nt or about 6 nt to about 25 nt, 6nt to 20 nt or about 6 nt to about 20 nt, 6nt to 19 nt or about 6 nt to about 19nt, 10nt-50nt or about 10nt-about 50nt, 10nt-45nt or about 10nt-about 45nt, 10nt-40nt or about 10nt-about 40nt, 10nt-35nt or about 10nt-about 35nt, 10nt-30nt or about 10nt-about 30nt, 10nt-25nt or about 10nt-about 25nt, 10nt-20nt or about 10nt-about 20nt, 10nt-19nt or about 10nt-about 19nt, 19nt-25nt or about 19nt-about 25 nt, 19nt-30nt or about 19nt-about 30nt, 19nt-35nt or about 19nt-about 35nt, 19nt-40nt or about 19nt-about 40nt, 19nt-45nt or about 19nt-about 45nt, 19nt-50nt or about 19nt-about 50nt, 19nt-60nt or about 19nt-about 60nt, 20nt-25nt or about 20nt-about 25nt, 20nt-30nt or about 20nt-about 30nt, 20nt-35nt or about 20nt-about 35nt,It may be 20 nt to 40 nt or about 20 nt to about 40 nt, 20 nt to 45 nt or about 20 nt to about 45 nt, 20 nt to 50 nt or about 20 nt to about 50 nt, or 20 nt to 60 nt or about 20 nt to about 60 nt. In some embodiments, the spacer sequence is 20 nucleotides long. In some embodiments, the spacer is 19 nucleotides long. In some embodiments, the spacer is 18 nucleotides long. In some embodiments, the spacer is 17 nucleotides long. In some embodiments, the spacer is 16 nucleotides long. In some embodiments, the spacer is 15 nucleotides long.

[0168] In some embodiments, the percent complementarity between the spacer sequence and the target nucleic acid is at least or at least about 30%, at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or at least 100%. In some embodiments, the percent complementarity between the spacer sequence and the target nucleic acid is at most 30% or at most about 30%, at most 40% or at most about 40%, at most 50% or at most about 50%, at most 60% or at most about 60%, at most 65% or at most about 65%, at most 70% or at most about 70%, at most 75% or at most about 75%, at most 80% or at most about 80%, at most 85% or at most about 85%, at most 90% or at most about 90%, at most 95% or at most about 95%, at most 97% or at most about 97%, at most 98% or at most about 98%, at most 99% or at most about 99%, or at most about 100%. In some embodiments, the percent complementarity between the spacer sequence and the target nucleic acid is 100% over the 6 contiguous 5'-most nucleotides of the target sequence of the complementary strand of the target nucleic acid. In some embodiments, the percent complementarity between the spacer sequence and the target nucleic acid is at least 60% over 20 or about 20 contiguous nucleotides. In some embodiments, the length of the spacer sequence and the length of the target nucleic acid may differ by 1-6 nucleotides, which may be considered as one or more bulges.

[0169] In some embodiments, the spacer sequence is designed or selected using a computer program.The computer program can use variables, such as predicted melting temperature, formation of secondary structure, predicted annealing temperature, sequence identity, genomic context, chromatin accessibility, GC ratio (%), genomic occurrence frequency (e.g., changes at one or more positions in the same or similar sequence caused by mismatch, insertion or deletion, etc.), methylation status, the presence of SNPs, etc.

[0170] CRISPR minimal repeat sequence In some embodiments, a minimal repeat sequence of a CRISPR is a sequence having at least or at least about 30%, at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% sequence identity to a reference CRISPR repeat sequence (e.g., crRNA from S. pyogenes).

[0171] In some embodiments, the CRISPR minimal repeat sequence has nucleotides that can hybridize to the tracrRNA minimal sequence in a cell. The CRISPR minimal repeat sequence and the tracrRNA minimal sequence form a double strand, for example, form a base-paired double strand structure. The CRISPR minimal repeat sequence and the tracrRNA minimal sequence are combined to bind to a site-directed polypeptide. At least a part of the CRISPR minimal repeat sequence hybridizes to the tracrRNA minimal sequence. In some embodiments, at least a portion of the minimal repeat sequence of CRISPR has at least or at least about 30%, at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% complementarity to the minimal sequence of tracrRNA. In some embodiments, at least a portion of the minimal repeat sequence of CRISPR has at most 30% or at most about 30%, at most 40% or at most about 40%, 50% or at most about 50%, at most 60% or at most about 60%, at most 65% or at most about 65%, at most 70% or at most about 70%, at most 75% or at most about 75%, at most 80% or at most about 80%, at most 85% or at most about 85%, 90% or at most about 90%, at most 95% or at most about 95%, or at most 100% complementarity to the minimal sequence of tracrRNA.

[0172] The length of the minimum repeat sequence of CRISPR is 7 nucleotides to 100 nucleotides or about 7 nucleotides to about 100 nucleotides. For example, the length of the minimum repeat sequence of CRISPR is 7 nucleotides (nt) to 50 nt or about 7 nt to about 50 nt, 7 nt to 40 nt or about 7 nt to about 40 nt, 7 nt to 30 nt or about 7 nt to about 30 nt, 7 nt to 25 nt or about 7 nt to about 25 nt, 7 nt to 20 nt or about 7 nt to about 20 nt, 7 nt to 15 nt or about 7 nt to about 15 nt, 8 nt to 40 nt or about 8 nt to about 40 nt, 8 nt to 30 nt or about 8 nt to about 30 nt, 8 nt to 2 5nt or about 8nt to about 25nt, 8nt to 20nt or about 8nt to about 20nt, 8nt to 15nt or about 8nt to about 15nt, 15nt to 100nt or about 15nt to about 100nt, 15nt to 80nt or about 15nt to about 80nt, 15nt to 50nt or about 15nt to about 50nt, 15nt to 40nt or about 15nt to about 40nt, 15nt to 30nt or about 15nt to about 30nt, or 15nt to 25nt or about 15nt to about 25nt. In some embodiments, the length of the minimum repeat sequence of CRISPR is about 9 nucleotides. In some embodiments, the length of the minimum repeat sequence of CRISPR is about 12 nucleotides.

[0173] In some embodiments, the CRISPR minimal repeat sequence has at least 60% or at least about 60% identity to a reference CRISPR minimal repeat sequence (e.g., wild-type crRNA from S. pyogenes) over a sequence of at least 6, 7, or 8 consecutive nucleotides. For example, the CRISPR minimal repeat sequence has at least 65% or at least about 65% identity, at least 70% or at least about 70% identity, at least 75% or at least about 75% identity, at least 80% or at least about 80% identity, at least 85% or at least about 85% identity, at least 90% or at least about 90% identity, at least 95% or at least about 95% identity, at least 98% or at least about 98% identity, at least 99% or at least about 99% identity, or at least 100% identity to a reference CRISPR minimal repeat sequence over a sequence of at least 6, 7, or 8 consecutive nucleotides.

[0174] Minimal sequence of tracrRNA In some embodiments, the minimal sequence of a tracrRNA is a sequence that has at least or at least about 30%, at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% sequence identity to a reference tracrRNA sequence (e.g., a wild-type tracrRNA from S. pyogenes).

[0175] In some embodiments, the minimal sequence of tracrRNA has nucleotides that can hybridize to the minimal repeat sequence of CRISPR in a cell. The minimal sequence of tracrRNA and the minimal repeat sequence of CRISPR form a double strand, for example, form a base paired double strand structure. The minimal sequence of tracrRNA and the minimal repeat sequence of CRISPR together bind to a site-directed polypeptide. At least a part of the minimal sequence of tracrRNA can hybridize to the minimal repeat sequence of CRISPR. In some embodiments, the minimal sequence of tracrRNA has at least or at least about 30%, at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 95%, or at least 100% complementarity to the minimal repeat sequence of CRISPR.

[0176] The length of the minimum sequence of tracrRNA is 7 nucleotides to 100 nucleotides or about 7 nucleotides to about 100 nucleotides. For example, the length of the minimum sequence of tracrRNA is 7 nucleotides (nt) to 50 nt or about 7 nt to about 50 nt, 7 nt to 40 nt or about 7 nt to about 40 nt, 7 nt to 30 nt or about 7 nt to about 30 nt, 7 nt to 25 nt or about 7 nt to about 25 nt, 7 nt to 20 nt or about 7 nt to about 20 nt, 7 nt to 15 nt or about 7 nt to about 15 nt, 8 nt to 40 nt or about 8 nt to about 40 nt, 8 nt to 30 nt or about 8 nt to about 30 nt, 8 nt to 25 nt, or about 8nt to about 25nt, 8nt to 20nt or about 8nt to about 20nt, 8nt to 15nt or about 8nt to about 15nt, 15nt to 100nt or about 15nt to about 100nt, 15nt to 80nt or about 15nt to about 80nt, 15nt to 50nt or about 15nt to about 50nt, 15nt to 40nt or about 15nt to about 40nt, 15nt to 30nt or about 15nt to about 30nt, or 15nt to 25nt or about 15nt to about 25nt. In some embodiments, the minimum sequence length of the tracrRNA is about 9 nucleotides in length. In some embodiments, the minimum sequence length of the tracrRNA is about 12 nucleotides in length. In some embodiments, the minimal sequence of the tracrRNA consists of 23-48 nt of the tracrRNA described in Jinek, M. et al. (2012). Science, 337(6096):816-821.

[0177] In some embodiments, the minimal sequence of tracrRNA has at least 60% or at least about 60% identity over a sequence of at least 6, 7, or 8 consecutive nucleotides to a reference minimal sequence of tracrRNA (e.g., wild-type tracrRNA from S. pyogenes). For example, the minimal sequence of tracrRNA has at least 65% or at least about 65% identity, at least 70% or at least about 70% identity, at least 75% or at least about 75% identity, at least 80% or at least about 80% identity, at least 85% or at least about 85% identity, at least 90% or at least about 90% identity, at least 95% or at least about 95% identity, at least 98% or at least about 98% identity, at least 99% or at least about 99% identity, or at least 100% identity over a sequence of at least 6, 7, or 8 consecutive nucleotides to a reference minimal sequence of tracrRNA.

[0178] In some embodiments, the duplex formed by the CRISPR RNA minimal sequence and the tracrRNA minimal sequence has a double helix structure. In some embodiments, the duplex formed by the CRISPR RNA minimal sequence and the tracrRNA minimal sequence has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, or at least more than 10 nucleotides, or at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, or at least more than 10 nucleotides. In some embodiments, the duplex formed by the CRISPR RNA minimal sequence and the tracrRNA minimal sequence has at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10, or more nucleotides, or at most about 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10, or more nucleotides.

[0179] In some embodiments, the duplex has mismatches (e.g., the two strands in the duplex are not 100% complementary). In some embodiments, the duplex has at least 1, at least 2, at least 3, at least 4, or at least 5, or at least about 1, at least about 2, at least about 3, at least about 4, or at least about 5 mismatches. In some embodiments, the duplex has at most 1, at most 2, at most 3, at most 4, or at most 5 mismatches, or at most about 1, at most about 2, at most about 3, at most about 4, or at most about 5 mismatches. In some embodiments, the duplex has no more than 2 mismatches.

[0180] 3'tracrRNA sequence In some embodiments, the 3'tracrRNA sequence has a sequence that has at least or at least about 30%, at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% sequence identity to a reference tracrRNA sequence (e.g., a tracrRNA from S. pyogenes).

[0181] In some embodiments, the length of the 3'tracrRNA sequence is 6 nucleotides to 100 nucleotides or about 6 nucleotides to about 100 nucleotides. For example, the length of the 3'tracrRNA sequence is 6 nucleotides (nt) to 50 nt or about 6 nt to about 50 nt, 6 nt to 40 nt or about 6 nt to about 40 nt, 6 nt to 30 nt or about 6 nt to about 30 nt, 6 nt to 25 nt or about 6 nt to about 25 nt, 6 nt to 20 nt or about 6 nt to about 20 nt, 6 nt to 15 nt or about 6 nt to about 15 nt, 8 nt to 40 nt or about 8 nt to about 40 nt, 8 nt to 30 nt or about 8 nt to about 30 nt, 8 nt to 25 nt or about 8nt to about 25nt, 8nt to 20nt or about 8nt to about 20nt, 8nt to 15nt or about 8nt to about 15nt, 15nt to 100nt or about 15nt to about 100nt, 15nt to 80nt or about 15nt to about 80nt, 15nt to 50nt or about 15nt to about 50nt, 15nt to 40nt or about 15nt to about 40nt, 15nt to 30nt or about 15nt to about 30nt, or 15nt to 25nt or about 15nt to about 25nt. In some embodiments, the length of the 3'tracrRNA sequence is about 14 nucleotides in length.

[0182] In some embodiments, the 3'tracrRNA sequence has at least 60% or at least about 60% identity to a reference 3'tracrRNA sequence (e.g., a wild-type 3'tracrRNA sequence from S. pyogenes) over a sequence of at least 6, 7, or 8 consecutive nucleotides. For example, the 3'tracrRNA sequence has at least 60% or at least about 60% identity, at least 65% or at least about 65% identity, at least 70% or at least about 70% identity, at least 75% or at least about 75% identity, at least 80% or at least about 80% identity, at least 85% or at least about 85% identity, at least 90% or at least about 90% identity, at least 95% or at least about 95% identity, at least 98% or at least about 98% identity, at least 99% or at least about 99% identity, or at least 100% identity over a sequence of at least 6, 7, or 8 contiguous nucleotides to a reference 3'tracrRNA sequence (e.g., a wild-type 3'tracrRNA sequence from S. pyogenes).

[0183] In some embodiments, the 3'tracrRNA sequence has two or more double-stranded regions (e.g., hairpins, hybridized regions). In some embodiments, the 3'tracrRNA sequence has two double-stranded regions.

[0184] In some embodiments, the 3'tracrRNA sequence has a stem-loop structure. In some embodiments, the stem-loop structure of the 3'tracrRNA has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or at least more nucleotides. In some embodiments, the stem-loop structure of the 3'tracrRNA has at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10 or at most more nucleotides. In some embodiments, the stem-loop structure has a functional moiety. For example, the stem-loop structure may have an aptamer, a ribozyme, a hairpin that interacts with a protein, a CRISPR array, an intron, or an exon. In some embodiments, the stem loop structure has at least 1, at least 2, at least 3, at least 4, at least 5, or at least more than about 1, at least about 2, at least about 3, at least about 4, at least about 5, or at least more than about 1, 2, 3, 4, ...

[0185] In some embodiments, the hairpin of the 3'tracrRNA sequence has a P domain. In some embodiments, the P domain on the hairpin has a double-stranded region.

[0186] tracrRNA extension sequence In some embodiments, when the guide RNA is a unimolecular guide or a bimolecular guide, a tracrRNA extension sequence is provided. In some embodiments, the length of the tracrRNA extension sequence is 1 nucleotide to 400 nucleotides or about 1 nucleotide to about 400 nucleotides. In some embodiments, the length of the tracrRNA extension sequence is more than 1 nucleotide, more than 5 nucleotides, more than 10 nucleotides, more than 15 nucleotides, more than 20 nucleotides, more than 25 nucleotides, more than 30 nucleotides, more than 35 nucleotides, more than 40 nucleotides, more than 45 nucleotides, more than 50 nucleotides, more than 60 nucleotides, more than 70 nucleotides, more than 80 nucleotides, more than 90 nucleotides, more than 100 nucleotides, more than 120 nucleotides, more than 140 nucleotides, more than 160 nucleotides, more than 180 nucleotides, more than 200 nucleotides, more than 220 nucleotides, more than 240 nucleotides, more than 260 nucleotides, more than 280 nucleotides, more than 300 nucleotides, more than 320 nucleotides, more than 340 nucleotides, more than 360 nucleotides, more than 380 nucleotides, or more than 400 nucleotides long. In some embodiments, the length of the tracrRNA extension sequence is from 20 nucleotides to more than 5000 nucleotides in length or from about 20 nucleotides to more than about 5000 nucleotides in length. In some embodiments, the length of the tracrRNA extension sequence is more than 1000 nucleotides in length.In some embodiments, the length of the tracrRNA extension sequence is less than 1 nucleotide, less than 5 nucleotides, less than 10 nucleotides, less than 15 nucleotides, less than 20 nucleotides, less than 25 nucleotides, less than 30 nucleotides, less than 35 nucleotides, less than 40 nucleotides, less than 45 nucleotides, less than 50 nucleotides, less than 60 nucleotides, less than 70 nucleotides, less than 80 nucleotides, less than 90 nucleotides, less than 100 nucleotides, less than 120 nucleotides, less than 140 nucleotides, less than 160 nucleotides, less than 180 nucleotides, less than 200 nucleotides, less than 220 nucleotides, less than 240 nucleotides, less than 260 nucleotides, less than 280 nucleotides, less than 300 nucleotides, less than 320 nucleotides, less than 340 nucleotides, less than 360 nucleotides, less than 380 nucleotides, less than 400 nucleotides or more. In some embodiments, the length of the tracrRNA extension sequence may be less than 1000 nucleotides. In some embodiments, the length of the tracrRNA extension sequence is less than 10 nucleotides in length. In some embodiments, the length of the tracrRNA extension sequence is between 10 and 30 nucleotides in length. In some embodiments, the length of the tracrRNA extension sequence is between 30 and 70 nucleotides in length.

[0187] In some embodiments, the tracrRNA extension sequence has a functional moiety (e.g., a stability control sequence, a ribozyme, or an endoribonuclease binding sequence). In some embodiments, the functional moiety is a transcription terminator segment (e.g., a transcription termination sequence). In some embodiments, the total length of the functional moiety is 10 nucleotides (nt) to 100 nucleotides in length or about 10 nt to about 100 nt, 10 nt to 20 nt or about 10 nt to about 20 nt, 20 nt to 30 nt or about 20 nt to about 30 nt, 30 nt to 40 nt or about 30 nt to about 40 nt, 40 nt to 50 nt or about 40 nt to about 50 nt, 50 nt to 60 nt or about 50 nt to about 60 nt, 60 nt to 70 nt or about 60 nt to about 70nt, 70nt-80nt or about 70nt-about 80nt, 80nt-90nt or about 80nt-about 90nt, 90nt-100nt or about 90nt-about 100nt, 15nt-80nt or about 15nt-about 80nt, 15nt-50nt or about 15nt-about 50nt, 15nt-40nt or about 15nt-about 40nt, 15nt-30nt or about 15nt-about 30nt, or 15nt-25nt or about 15nt-about 25nt. In some embodiments, the functional moiety functions in eukaryotic cells. In some embodiments, the functional moiety functions in prokaryotic cells. In some embodiments, the functional moiety functions in both eukaryotic and prokaryotic cells.

[0188] Examples of suitable functional portions of the tracrRNA extension sequence include, but are not limited to, a 3'-terminal polyadenylation tail; a riboswitch sequence (e.g., one that provides controlled stabilization and / or allows controlled access by a protein or protein complex); a sequence that forms a dsRNA duplex (e.g., a hairpin); a sequence that targets the RNA to a subcellular location (e.g., the nucleus, mitochondria, chloroplasts, etc.); a modification or sequence that allows tracking (e.g., direct attachment to a fluorescent molecule, attachment to a moiety that facilitates fluorescent detection, a sequence that allows fluorescent detection, etc.); and / or a modification or sequence that provides a binding site for a protein (e.g., a protein that acts on DNA, such as a transcription activator, transcription repressor, DNA methyltransferase, DNA methylase, histone acetyltransferase, histone deacetylase, etc.). In some embodiments, the tracrRNA extension sequence has a primer binding site or a molecular index (e.g., a barcode sequence). In some embodiments, the tracrRNA extension sequence has one or more affinity tags.

[0189] Bulge In some embodiments, a "bulge" is present in the duplex formed by the CRISPR RNA minimal sequence and the tracrRNA minimal sequence. A bulge is a region of nucleotide unpairing within the duplex. In some embodiments, the bulge contributes to the binding of the duplex to a site-directed polypeptide. A bulge has an unpaired sequence 5'-XXXY-3' (where X is any purine base and Y has a nucleotide that can form a wobble base pair with a nucleotide in the opposite strand) on one strand of the duplex and an unpaired nucleotide region on the other strand of the duplex. The number of unpaired nucleotides on each strand of the duplex can be different.

[0190] In one example, the bulge has an unpaired purine base (e.g., adenine) on the CRISPR minimal repeat strand that forms the bulge. In some embodiments, the bulge has an unpaired sequence 5'-AAGY-3' on the tracrRNA minimal sequence strand that forms the bulge (wherein Y has a nucleotide that can wobble base pair with a nucleotide on the CRISPR minimal repeat strand).

[0191] In some embodiments, the bulge of the CRISPR minimal repeat strand that forms a double strand has at least 1, at least 2, at least 3, at least 4, at least 5, or at least more than 1 unpaired nucleotide.The bulge of the CRISPR minimal repeat strand that forms a double strand has at most 1, at most 2, at most 3, at most 4, at most 5, or at most more than 1 unpaired nucleotide.In some embodiments, the bulge of the CRISPR minimal repeat strand that forms a double strand has 1 unpaired nucleotide.

[0192] In some embodiments, the bulge on the duplex-forming tracrRNA minimal sequence side has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, or at least more unpaired nucleotides. In some embodiments, the bulge on the duplex-forming tracrRNA minimal sequence side has at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, or at most 10, or at most more unpaired nucleotides. In some embodiments, the bulge on the duplex-forming second strand (e.g., on the duplex-forming tracrRNA minimal sequence side) has 4 unpaired nucleotides.

[0193] In some embodiments, the bulge has at least one wobble base pair. In some embodiments, the bulge has no more than one wobble base pair. In some embodiments, the bulge has at least one purine nucleotide. In some embodiments, the bulge has at least three purine nucleotides. In some embodiments, the bulge sequence has at least five purine nucleotides. In some embodiments, the bulge sequence has at least one guanine nucleotide. In some embodiments, the bulge sequence has at least one adenine nucleotide.

[0194] hairpin In various embodiments, there are one or more hairpins in the 3' tracrRNA sequence at the 3' end of the tracrRNA minimal sequence.

[0195] In some embodiments, the hairpin begins at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or more nucleotides, or at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 15, at least about 20 or more nucleotides 3' from the last paired nucleotide of the duplex consisting of the CRISPR minimal repeat sequence and the tracrRNA minimal sequence. In some embodiments, the hairpin may begin at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10 or more nucleotides, or at most about 1, at most about 2, at most about 3, at most about 4, at most about 5, at most about 6, at most about 7, at most about 8, at most about 9, at most about 10 or more nucleotides 3' from the last paired nucleotide of the duplex consisting of the CRISPR minimal repeat sequence and the tracrRNA minimal sequence.

[0196] In some embodiments, the hairpin has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or more contiguous nucleotides, or at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 15, at least about 20 or more contiguous nucleotides. In some embodiments, the hairpin has at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, at most 8, at most 9, at most 10, or at most 15 or more consecutive nucleotides, or at most about 1, at most about 2, at most about 3, at most about 4, at most about 5, at most about 6, at most about 7, at most about 8, at most about 9, at most about 10, at most about 15 or more consecutive nucleotides.

[0197] In some embodiments, the hairpin has a CC dinucleotide (eg, two consecutive cytosine nucleotides).

[0198] In some embodiments, the hairpin has double-stranded nucleotides (e.g., hairpin nucleotides that hybridize to each other). For example, the hairpin has a CC dinucleotide that hybridizes to a GG dinucleotide in the hairpin duplex of the 3'tracrRNA sequence.

[0199] The one or more hairpins can interact with a guide RNA interacting region of the site-directed polypeptide.

[0200] In some embodiments, there is more than one hairpin, and in some embodiments, there is more than one hairpin.

[0201] Linker sequences of single molecule guides In some embodiments, the length of the linker sequence of the single molecule guide nucleic acid is 3 nucleotides to 100 nucleotides or about 3 nucleotides to about 100 nucleotides. Jinek, M. et al. (2012). Science, 337(6096):816-821, for example, used a simple "tetraloop" (-GAAA-) consisting of four nucleotides. The length of the linker is, for example, 3 nucleotides (nt) to 90 nt or about 3 nt to about 90 nt, 3 nt to 80 nt or about 3 nt to about 80 nt, 3 nt to 70 nt or about 3 nt to about 70 nt, 3 nt to 60 nt or about 3 nt to about 60 nt, 3 nt to 50 nt or about 3 nt to about 50 nt, 3 nt to 40 nt or about 3 nt to about 40 nt, 3 nt to 30 nt or about 3 nt to about 30 nt, 3 nt to 20 nt or about 3 nt to about 20 nt, or 3 nt to 10 nt or about 3 nt to about 10 nt. For example, the length of the linker is 3 nt to 5 nt or about 3 nt to about 5 nt, 5 nt to 10 nt or about 5 nt to about 10 nt, 10 nt to 15 nt or about 10 nt to about 15 nt, 15 nt to 20 nt or about 15 nt to about 20 nt, 20 nt to 25 nt or about 20 nt to about 25 nt, 25 nt to 30 nt or about 25 nt to about 30 nt, 30 nt to 35 nt or about 30 nt to about 35 nt, 3 It may be 5 nt to 40 nt or about 35 nt to about 40 nt, 40 nt to 50 nt or about 40 nt to about 50 nt, 50 nt to 60 nt or about 50 nt to about 60 nt, 60 nt to 70 nt or about 60 nt to about 70 nt, 70 nt to 80 nt or about 70 nt to about 80 nt, 80 nt to 90 nt or about 80 nt to about 90 nt, or 90 nt to 100 nt or about 90 nt to about 100 nt. In some embodiments, the length of the linker of the single molecule guide nucleic acid is 4 to 40 nucleotides in length.In some embodiments, the length of the linker is at least or at least about 100 nucleotides, at least or at least about 500 nucleotides, at least or at least about 1000 nucleotides, at least or at least about 1500 nucleotides, at least or at least about 2000 nucleotides, at least or at least about 2500 nucleotides, at least or at least about 3000 nucleotides, at least or at least about 3500 nucleotides. The nucleic acid sequence may be at least about 3500, at least 4000, at least 4500, at least 5000, at least 5500, at least 6000, at least 6500, or at least 7000, or at least more nucleotides in length.In some embodiments, the length of the linker is at most or at most about 100 nucleotides, at most or at most about 500 nucleotides, at most or at most about 1000 nucleotides, at most or at most about 1500 nucleotides, at most or at most about 2000 nucleotides, at most or at most about 2500 nucleotides, at most or at most about 3000 nucleotides, at most or at most about 3500 nucleotides, or The nucleic acid sequence may be at most about 3500, at most about 4000, at most about 4500, at most about 5000, at most about 5500, at most about 6000, at most about 6500, or at most about 7000, or more nucleotides in length.

[0202] The linker can have a variety of sequences, but in some embodiments, the linker does not have sequences with extensive regions of homology with other parts of the guide RNA, because such extensive regions of homology may result in intramolecular binding that may interfere with other functional regions of the guide RNA. In Jinek, et al. (2012). Science, 337(6096):816-821, a simple sequence of four nucleotides -GAAA- was used, but other various sequences, such as longer sequences, can be used as well.

[0203] In some embodiments, the linker sequence has a functional moiety. For example, the linker sequence may have one or more features, such as an aptamer, a ribozyme, a hairpin that interacts with a protein, a protein binding site, a CRISPR array, an intron, an exon, etc. In some embodiments, the linker sequence has at least 1, at least 2, at least 3, at least 4, at least 5, or at least more than 1, at least about 2, at least about 3, at least about 4, at least about 5, or at least more than 1, at least about ...

[0204] Donor DNA or donor template Site-directed polypeptides such as DNA endonucleases can introduce double-stranded or single-stranded breaks in nucleic acids (e.g., genomic DNA). The double-stranded breaks can stimulate endogenous DNA repair pathways in cells (e.g., homology-dependent repair (HDR), non-homologous end joining, alternative non-homologous end joining (A-NHEJ) or microhomology-mediated end joining (MMEJ)). NHEJ can repair the cut target nucleic acid without the need for a homologous template. This can result in small deletions or insertions (indels) in the target nucleic acid at the cut site, which can lead to disruption or alteration of gene expression. Homology-dependent repair (HDR), also known as homologous recombination (HR), can occur when a homologous repair template or donor is available.

[0205] A homologous donor template has a sequence that is homologous to the sequence adjacent to the cut site of the target nucleic acid. Generally, sister chromatids are used by cells as repair templates. Meanwhile, repair templates for genome editing are often provided as exogenous nucleic acids, such as plasmids, double-stranded oligonucleotides, single-stranded oligonucleotides, double-stranded oligonucleotides, or viral nucleic acids. Exogenous donor templates generally introduce additional nucleic acid sequences (such as transgenes) or modifications (such as one or more base changes or deletions) between adjacent homologous regions, allowing the additional or modified nucleic acid sequences to be integrated into the target locus. MMEJ achieves genetic outcomes similar to NHEJ in that small deletions and insertions can occur at the cut site. MMEJ utilizes homologous sequences consisting of several base pairs adjacent to the cut site to achieve the desired end-joining DNA repair results. In some cases, it may be possible to predict the likely repair results based on the analysis of short homologous sequences (microhomology) predicted in the target region of the nuclease.

[0206] Thus, in some cases, exogenous polynucleotide sequences are inserted into the cleavage site of target nucleic acid using homologous recombination. Herein, exogenous polynucleotide sequences are referred to as donor polynucleotides (or donors, donor sequences or donor templates). In some embodiments, donor polynucleotides, parts of donor polynucleotides, copies of donor polynucleotides or parts of copies of donor polynucleotides are inserted into the cleavage site of target nucleic acid. In some embodiments, donor polynucleotides are exogenous polynucleotide sequences, e.g., sequences that do not naturally exist at the cleavage site of target nucleic acid.

[0207] When a sufficient concentration of exogenous DNA molecules is provided in the nucleus of the cell where double-strand break occurs, the exogenous DNA can be inserted into the double-strand break site in the NHEJ repair process, and thus can be stably maintained in the genome, for example, can be permanently added to the genome. Such exogenous DNA molecules are referred to as donor templates in some embodiments. When donor templates include the coding sequence of a gene of interest or a genomic site of interest, optionally with associated regulatory sequences such as promoters, enhancers, polyA sequences and / or splice acceptor sequences, the gene of interest can be expressed from the copy integrated into the genome, and the gene can be permanently expressed during the life of the cell. Furthermore, the copy integrated from donor DNA template can be transmitted to daughter cells when the cell divides.

[0208] If a donor DNA template containing adjacent DNA sequences (called homology arms) that are homologous to the DNA sequences on either side of the double-strand break is present in sufficient concentration, the donor DNA template can be integrated via the HDR pathway. The homology arms act as substrates for homologous recombination between the donor template and the sequences on either side of the double-strand break. This allows for error-free insertion of the donor template, whose sequences on either side of the double-strand break are unchanged from those of the unmodified genome.

[0209] Donors provided for editing by HDR are highly variable, but generally contain the intended sequence for editing flanked by short or long homologous arms that allow annealing to genomic DNA. The homologous regions flanking the introduced genetic alteration site may be 30 bp or less, or as large as a multi-kilobase cassette that may contain promoters, cDNA, etc. Both single-stranded and double-stranded oligonucleotide donors can be used. These oligonucleotides range in size from less than 100 nt to several kb or more, although longer ssDNA can be generated and used. Double-stranded donors such as PCR amplicons, plasmids, and minicircles are often used. In general, AAV vectors (although the gene editing methods disclosed herein are not limited to AAV vectors) have proven to be very effective means of delivering donor templates, but the limit for packaging into individual donors is less than 5 kb. Active transcription of the donor has been shown to increase HDR rates by 3-fold, indicating that inclusion of a promoter can increase conversion. Conversely, donor CpG methylation can decrease gene expression and HDR rates.

[0210] In some embodiments, donor DNA can be introduced alone or together with nuclease by various methods, such as transfection, nanoparticle, microinjection, viral transduction, etc. In some embodiments, various methods of linking donor DNA and nuclease can be used to increase the availability of donor in HDR. Examples of such methods include binding donor to nuclease, binding to DNA binding protein that binds to the vicinity of donor and nuclease, or binding to protein involved in DNA end binding or DNA repair, etc.

[0211] In addition to genome editing by NHEJ or HDR, site-directed gene insertion using both the NHEJ pathway and HR can be performed. Such combined approaches are applicable in certain situations, which may involve intron / exon boundaries. NHEJ can prove effective for ligation at introns, whereas error-free HDR may be more suitable for coding regions.

[0212] Nucleic acid encoding a site-directed polypeptide or a DNA endonuclease In some embodiments, in light of the above, the genome editing method and the composition can use a nucleic acid sequence (or oligonucleotide) encoding a site-directed polypeptide or a DNA endonuclease. The nucleic acid sequence encoding the site-directed polypeptide can be DNA or RNA. If the nucleic acid sequence encoding the site-directed polypeptide is RNA, the RNA can be covalently linked to the gRNA sequence or can be present as a separate sequence. In some embodiments, the peptide sequence of the site-directed polypeptide or DNA endonuclease can be used instead of these nucleic acid sequences.

[0213] Gene editing vectors In another aspect, the present disclosure provides a nucleic acid having a nucleotide sequence encoding a genome-targeting nucleic acid of the present disclosure, a site-directed polypeptide of the present disclosure, and / or any nucleic acid or protein molecule necessary to carry out an embodiment of a method of the present disclosure. In some embodiments, such a nucleic acid is a vector (e.g., a recombinant expression vector).

[0214] Expression vectors contemplated in the present invention include, but are not limited to, viral vectors based on vaccinia virus, poliovirus, adenovirus, adeno-associated virus, simian virus 40 (SV40), herpes simplex virus, human immunodeficiency virus, retrovirus (e.g., murine leukemia virus; spleen necrosis virus; and vectors derived from retroviruses such as Rous sarcoma virus, Harvey sarcoma virus, avian leukemia virus, lentivirus, human immunodeficiency virus, myeloproliferative sarcoma virus, mammary tumor virus), and other recombinant vectors. Other vectors contemplated for use with eukaryotic target cells include, but are not limited to, pXT1 vector, pSG5 vector, pSVK3 vector, pBPV vector, pMSG vector, and pSVLSV40 vector (Pharmacia). Additional vectors contemplated for use with eukaryotic target cells include, but are not limited to, pCTx-1 vector, pCTx-2 vector, and pCTx-3 vector. Other vectors can be used as long as they are compatible with the host cell.

[0215] In some embodiments, vector has one or more transcriptional and / or translational control elements.Depending on the host / vector system used, various suitable transcriptional and translational control elements can be used in expression vector, such as constitutive promoter, inducible promoter, transcriptional enhancer element, transcriptional terminator, etc.In some embodiments, vector is a self-inactivating vector that inactivates viral sequence or CRISPR mechanism components or other elements.

[0216] Examples of suitable eukaryotic promoters (e.g., promoters functional in eukaryotic cells) include, but are not limited to, the cytomegalovirus (CMV) promoter, the immediate early thymidine kinase promoter of herpes simplex virus (HSV), early SV40, late SV40, long terminal repeats (LTRs) from retroviruses, the human elongation factor 1 promoter (EF1), a hybrid construct of the chicken beta actin promoter (CAG) fused to the cytomegalovirus (CMV) enhancer, the mouse stem cell virus promoter (MSCV), the phosphoglycerate kinase 1 locus promoter (PGK), and mouse metallothionein I. In further embodiments, the promoter is an MND promoter (e.g., an MND promoter comprising the nucleic acid sequence of SEQ ID NO: 33).

[0217] To express small RNAs, such as guide RNAs used with Cas endonucleases, various promoters may be useful, such as RNA polymerase III promoters, for example U6 and H1. Descriptions and parameters that facilitate the use of such promoters are known in the art, and new information and approaches are constantly being reported. See, for example, Ma, H. et al. (2014). Mol. Ther. - Nucleic Acids 3, e161, doi:10.1038 / mtna.2014.12.

[0218] The expression vector may further include a ribosome binding site for translation initiation and transcription termination. The expression vector may also include appropriate sequences for amplifying expression. In addition, the expression vector may include a nucleotide sequence encoding a non-native tag (e.g., a histidine tag, a hemagglutinin tag, green fluorescent protein, etc.) that is fused to the site-directed polypeptide and thus expressed as part of the fusion protein.

[0219] In some embodiments, the promoter is an inducible promoter (e.g., a heat shock promoter, a tetracycline-regulated promoter, a steroid-regulated promoter, a metal-regulated promoter, an estrogen receptor-regulated promoter, etc.). In some embodiments, the promoter is a constitutive promoter (e.g., a CMV promoter, or a UBC promoter). In some embodiments, the promoter is a spatially restricted promoter and / or a temporally restricted promoter (e.g., a tissue-specific promoter, a cell type-specific promoter, etc.). In some embodiments, the vector does not include a promoter for at least one gene to be expressed in the host cell, if the gene is expressed under the control of an endogenous promoter present in the genome after insertion into the genome.

[0220] In some embodiments, the vector comprises one or more nucleic acid sequences encoding one or more components of CISC (e.g., any of the CISC polypeptides disclosed herein, such as a CISC polypeptide comprising a truncated ILR2β intracellular signaling domain). The gene editing vectors disclosed herein may also comprise a nucleic acid sequence encoding any of the naked FRB domain polypeptides disclosed herein. In some embodiments, the vector comprises the nucleic acid sequence of SEQ ID NO:3. In further embodiments, the vector comprises the nucleic acid sequence of SEQ ID NO:8.

[0221] Complex of genome-targeting nucleic acid and site-directed polypeptide The genome-targeting nucleic acid interacts with a site-directed polypeptide (e.g., a nucleic acid-guided nuclease such as Cas9) to form a complex. The genome-targeting nucleic acid (e.g., a gRNA) guides the site-directed polypeptide to the target nucleic acid.

[0222] As mentioned above, in some embodiments, the site-directed polypeptide and the genome-targeting nucleic acid can be administered separately to a cell or a subject. Meanwhile, in some other embodiments, the site-directed polypeptide can be pre-complexed with one or more guideRNAs, or the site-directed polypeptide can be pre-complexed with a tracrRNA and one or more crRNAs. Pre-complexed materials can be administered to a cell or a subject. Such pre-complexed materials are known as ribonucleoprotein particles (RNPs).

[0223] Methods for producing cells expressing naked FRB domain polypeptides and / or CISC components In some of the embodiments described herein, it may be desirable to induce rapamycin-regulated cytokine signaling and / or selectively expand cells expressing dimerized CISC components and naked FRB domain polypeptides expressed in the cells by introducing a protein sequence or expression vector into a host cell, such as a mammalian cell (e.g., a lymphocyte). For example, dimerized CISC, upon contact with a ligand, can transmit a signal inside the cell (e.g., a mammalian cell) to enable cytokine signaling in the cell in which the CISC components have been introduced, whereas naked FRB domain polypeptides expressed in the cell can confer resistance to the deleterious effects of rapamycin to the cell. Furthermore, selective expansion of cells (e.g., mammalian cells) can be controlled such that only cells that have undergone two specific genetic recombination events (e.g., genetic recombination events mediated by the CRISPR / Cas system) as described herein are selected. Preparation of such cells can be performed according to known techniques that will be readily apparent to those of skill in the art in light of the present disclosure.

[0224] In some embodiments, a method of producing a cell (such as a mammalian cell) having a CISC is provided, the cell expressing a dimerized CISC and a naked FRB domain polypeptide expressed intracellularly. The method can include delivering a protein sequence according to any one of the embodiments described herein or an expression vector according to the embodiments described herein to a cell (such as a mammalian cell). In some embodiments, the protein sequence includes a first sequence and a second sequence. In another embodiment, the protein sequence includes a first sequence, a second sequence, a third sequence, and a fourth sequence. In some embodiments, the first sequence encodes a first CISC component comprising a first extracellular binding domain, a hinge domain, a length-optimized predetermined length linker, a transmembrane domain, and a signaling domain. In some embodiments, the second sequence encodes a second CISC component comprising a second extracellular binding domain, a hinge domain, a length-optimized predetermined length linker, a transmembrane domain, and a signaling domain. In some embodiments, the spacer is 1 amino acid long, 2 amino acids long, 3 amino acids long, 4 amino acids long, 5 amino acids long, 6 amino acids long, 7 amino acids long, 8 amino acids long, 9 amino acids long, 10 amino acids long, 11 amino acids long, 12 amino acids long, 13 amino acids long, 14 amino acids long, or 15 amino acids long, or a length within a range defined by any two of these lengths. In some embodiments, the signaling domain comprises a signaling domain of interleukin-2, e.g., an IL2Rβ (such as a truncated IL2Rβ) or an IL2Rγ domain. In some embodiments, the extracellular binding domain is a binding domain that binds to rapamycin or a rapalog, e.g., FKBP or FRB or a functional derivative thereof. In some embodiments, the cell is a CD8+ cell or a CD4+ cell. In some embodiments, the cell is a CD8+ cytotoxic T lymphocyte selected from the group consisting of naive CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells, and bulk CD8+ T cells.In some embodiments, the cell is a CD4+ helper T lymphocyte selected from the group consisting of a naive CD4+ T cell, a central memory CD4+ T cell, an effector memory CD4+ T cell, and a bulk CD4+ T cell. In some embodiments, the cell is a progenitor T cell. In some embodiments, the cell is a stem cell. In some embodiments, the cell is a hematopoietic stem cell. In some embodiments, the cell is a B cell. In some embodiments, the cell is a neural stem cell. In some embodiments, the cell is a NK cell.

[0225] Transgenic Cells and Transgenic Cell Populations In one aspect, the disclosure provides a method for editing the genome of a cell to generate a genetically modified cell. In some aspects, a genetically modified cell population is provided. Thus, the genetically modified cell comprises a cell having at least one genetic modification introduced by genome editing (e.g., genome editing using CRISPR / Cas system). In some embodiments, the genetically modified cell is a genetically modified lymphocyte, e.g., a T cell, such as a human CD4+ T cell. A genetically modified cell is herein contemplated that incorporates a nucleic acid encoding a naked FRB domain polypeptide and optionally encoding CISC.

[0226] The compositions described herein provide a genetically engineered host cell (e.g., a mammalian cell) comprising a protein sequence or expression vector described herein. Thus, a cell (e.g., a mammalian cell) for expressing a dimerized CISC and a naked FRB domain expressed intracellularly is provided, the cell comprising a protein sequence according to any one of the embodiments described herein or an expression vector according to any one of the embodiments described herein. In some embodiments, the cell is a bacterial cell or a mammalian cell, e.g., a lymphocyte. In some embodiments, the cell is E. coli. In some embodiments, the cell is an insect cell capable of expressing a protein. In some embodiments, the cell is a lymphocyte.

[0227] In some embodiments, the host cell is a progenitor T cell or a regulatory T cell. In some embodiments, the cell is a stem cell, e.g., a hematopoietic stem cell. In some embodiments, the cell is a NK cell. In some embodiments, the cell is a CD34+ T lymphocyte, a CD8+ T lymphocyte and / or a CD4+ T lymphocyte. In some embodiments, the cell is a B cell. In some embodiments, the cell is a neural stem cell.

[0228] In some embodiments, the host cells are CD8+ T cytotoxic lymphocytes and may include naive CD8+ T cells, central memory CD8+ T cells, effector memory CD8+ T cells, or bulk CD8+ T cells. In some embodiments, the cells are CD4+ helper T lymphocytes and may include naive CD4+ T cells, central memory CD4+ T cells, effector memory CD4+ T cells, or bulk CD4+ T cells.

[0229] The lymphocytes (T lymphocytes) can be collected by known techniques and enriched or depleted by known techniques such as affinity binding with antibodies, such as flow cytometry and / or immunomagnetic selection. After the enrichment and / or depletion steps, the desired T lymphocytes can be expanded in vitro by known techniques or modifications thereof that would be readily understood by one of skill in the art. In some embodiments, the T cells are autologous T cells obtained from the subject.

[0230] For example, a desired T cell population or T cell subpopulation can be expanded by adding a pre-expanded T lymphocyte population to an in vitro culture medium, then adding feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMCs) to the medium (e.g., adding feeder cells at a ratio such that the post-expansion cell population contains at least 5, 10, 20, or 40 or more PBMC feeder cells for every T lymphocyte in the initial population at the start of the expansion culture), and incubating the medium (e.g., for a period of time sufficient to expand the number of T cells). The non-dividing feeder cells can include PBMC feeder cells that have been γ-irradiated. In some embodiments, the PBMCs are irradiated with 3000-3600 rad of γ-rays to prevent cell division. In some embodiments, the PBMCs are irradiated with 3000 rad, 3100 rad, 3200 rad, 3300 rad, 3400 rad, 3500 rad, or 3600 rad gamma radiation, or any radiation value between any two endpoints of any of these values, to prevent cell division of the PBMCs. The order in which T cells or feeder cells are added to the medium may be reversed as necessary. Typically, the culture can be incubated under conditions such as temperature suitable for the proliferation of T lymphocytes. For example, the temperature for proliferation of human T lymphocytes is typically at least or at least about 25°C, at least or at least about 30°C, or at least or at least about 37°C. In some embodiments, the temperature for proliferation of human T lymphocytes is about 22°C, about 24°C, about 26°C, about 28°C, about 30°C, about 32°C, about 34°C, about 36°C, or about 37°C, or any other temperature between any two endpoints of any of these values.

[0231] T lymphocytes can be isolated and, prior to or after expansion, sorted into naive, memory, and effector T cell subpopulations of cytotoxic and helper T lymphocytes, respectively.

[0232] CD8+ cells can be obtained using standard methods. In some embodiments, CD8+ cells are further sorted into naive CD8+ cells, central memory CD8+ cells, and effector memory CD8+ cells by identifying cell surface antigens associated with each of these CD8+ cells. In some embodiments, memory T cells are present in both CD62L+ and CD62L- subsets from CD8+ peripheral blood lymphocytes. PBMCs are sorted into CD62L-CD8+ and CD62L+CD8+ fractions after staining with anti-CD8 and anti-CD62L antibodies. In some embodiments, central memory T CM Expression of phenotypic markers of CD45RO, CD62L, CCR7, CD28, CD3, and / or CD127 includes negative or low expression of granzyme B. In some embodiments, central memory T cells are CD45RO+, CD62L+, and / or CD8+ T cells. In some embodiments, effector T E are negative for CD62L, CCR7, CD28, and / or CD127, and positive for granzyme B and / or perforin. In some embodiments, naive CD8+ T lymphocytes are characterized by expression of phenotypic markers of naive T cells, including CD62L, CCR7, CD28, CD3, CD127, and / or CD45RA.

[0233] CD4+ helper T cells are sorted into naive cells, central memory cells, and effector cells by identifying cell populations with cell surface antigens. CD4+ lymphocytes can be obtained by standard methods. In some embodiments, naive CD4+ T lymphocytes are CD45RO-, CD45RA+, CD62L+, and / or CD4+ T cells. In some embodiments, central memory CD4+ cells are CD62L+ and / or CD45RO+. In some embodiments, effector CD4+ cells are CD62L- and / or CD45RO-.

[0234] Cells, such as mammalian cells, and cell populations, such as mammalian cell populations, are selected for expansion based on whether the cells or cell populations have undergone two different genetic recombination events. In some embodiments, the genetic recombination events are mediated by a CRISPR / Cas system. In some embodiments, the genetic recombination events are mediated by a CRISPR / Cas9 system. If a cell, such as a mammalian cell, or cell population, such as a mammalian cell population, has undergone one or fewer genetic recombination events, addition of a ligand will not result in dimerization. However, if a cell, such as a mammalian cell, or cell population, such as a mammalian cell population, has undergone two genetic recombination events, addition of a ligand will result in dimerization of the CISC components and subsequent signaling cascades. Thus, cells, such as mammalian cells, or cell populations, such as mammalian cell populations, may be selected based on their responsiveness to contact with a ligand. In some embodiments, the amount of ligand added is 0.01 nM, 0.02 nM, 0.03 nM, 0.04 nM, 0.05 nM, 0.06 nM, 0.07 nM, 0.08 nM, 0.09 nM, 0.1 nM, 0.2 nM, 0.3 nM, 0.4 nM, 0.5 nM, 0.6 nM, 0.7 nM, 0.8 nM, 0.9 nM, 1.0 nM, 1.5 nM, 2.0 nM, 2.5 nM, 3.0 nM, 3.5 nM, 4.0 nM, 4.5 nM, 5.0 nM, 5.5 nM, 6.0 nM, 7.0 nM, 8.0 nM, 9.0 nM, 10.0 nM, 11.0 nM, 12.0 nM, 13.0 nM, 14.0 nM, 15.0 nM, 16.0 nM, 17.0 nM, 18.0 nM, 19.0 nM, 20.0 nM, 21.0 nM, 22.0 nM, 23.0 nM, 24.0 nM, 25.0 nM, 26.0 nM, 27.0 nM, 28.0 nM, 29.0 nM, 30.0 nM, 31.0 nM, 32.0 nM, 33.0 nM, 34.0 nM, 35.0 nM, 36.0 nM, 37.0 nM, 38.0 nM, 39.0 nM, 40.0 nM, 41.0 nM, 42.0 nM, 43. The concentration may be 100 nM, 6.5 nM, 7.0 nM, 7.5 nM, 8.0 nM, 8.5 nM, 9.0 nM, 9.5 nM, 10 nM, 11 nM, 12 nM, 13 nM, 14 nM, 15 nM, 20 nM, 25 nM, 30 nM, 35 nM, 40 nM, 45 nM, 50 nM, 55 nM, 60 nM, 65 nM, 70 nM, 75 nM, 80 nM, 85 nM, 90 nM, 95 nM, or 100 nM, or a range defined by any two of these values.

[0235] In some embodiments, a cell, such as a mammalian cell, or a cell population, such as a mammalian cell population, may be determined to be positive for dimerized CISC and positive for naked FRB domain polypeptide expressed in the cells based on a marker expressed as a result of a signal transduction pathway. Thus, whether a cell population is positive for dimerized CISC may be determined by flow cytometry using staining with an antibody specific for a surface marker and an isotype-matched control antibody. In some embodiments, the marker is a fluorescent or luminescent protein, such as GFP or mCherry. In some embodiments, the marker is a low affinity nerve growth factor receptor (LNGFR).

[0236] In some embodiments, the cells are not germ cells.

[0237] Method for activating a signal inside a cell In some embodiments, a method of activating a signal inside a cell, such as a mammalian cell, is provided. The method can include providing a cell, such as a mammalian cell, comprising a protein sequence described herein or an expression vector described herein. In some embodiments, the method further includes expressing a protein sequence encoding a dimerized CISC, as described herein, or an expression vector described herein. In some embodiments, the method includes contacting the cell, such as a mammalian cell, with a ligand, which induces dimerization of a first CISC component and a second CISC component, thereby transmitting a signal to the interior of the cell. In some embodiments, the ligand is rapamycin or a rapalog. In some embodiments, an effective amount of ligand to induce dimerization is 0.01 nM, 0.02 nM, 0.03 nM, 0.04 nM, 0.05 nM, 0.06 nM, 0.07 nM, 0.08 nM, 0.09 nM, 0.1 nM, 0.2 nM, 0.3 nM, 0.4 nM, 0.5 nM, 0.6 nM, 0.7 nM, 0.8 nM, 0.9 nM, 1.0 nM, 1.5 nM, 2.0 nM, 2.5 nM, 3.0 nM, 3.5 nM, 4.0 nM, 4.5 nM, 5.0 nM, 5.5 nM, 6.0 nM, 7.0 nM, 8.0 nM, 9.0 nM, 10.0 nM, 11.0 nM, 12.0 nM, 13.0 nM, 14.0 nM, 15.0 nM, 16.0 nM, 17.0 nM, 18.0 nM, 19.0 nM, 20.0 nM, 21.0 nM, 22.0 nM, 23.0 nM, 24.0 nM, 25.0 nM, 26.0 nM, 27.0 nM, 28.0 nM, 29.0 nM, 30.0 nM, 31.0 nM, 32.0 nM, 33.0 nM, 34.0 nM, 35.0 nM, 36.0 nM, 37.0 nM, 38.0 nM, 39.0 nM, 40.0 nM, 41.0 nM, 42.0 nM Ligands are provided at concentrations of M, 6.0nM, 6.5nM, 7.0nM, 7.5nM, 8.0nM, 8.5nM, 9.0nM, 9.5nM, 10nM, 11nM, 12nM, 13nM, 14nM, 15nM, 20nM, 25nM, 30nM, 35nM, 40nM, 45nM, 50nM, 55nM, 60nM, 65nM, 70nM, 75nM, 80nM, 85nM, 90nM, 95nM, or 100nM, or within a range defined by any two of these values.

[0238] In some embodiments, the ligand or agent used in the methods described herein for chemical induction of signaling complexes includes rapamycin (including its analogs, derivatives and pharma- ceutically acceptable salts). Rapamycins include sirolimus (Rapamune®), (3S,6R,7E,9R,10R,12R,14S,15E,17E,19E,21S,23S,26R,27R,34aS)-9,10,12,13,14,21,22,23,24,25,26,27,32,33,34,34a-hexadecahydro-9,27-dihydroxy-3-[(1R)- 2-[(1S,3R,4R)-4-hydroxy-3-methoxycyclohexyl]-1-methylethyl]-10,21-dimethoxy-6,8,12,14,20,26-hexamethyl-23,27-epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontin-1,5,11,28,29(4H,6H,31H)-pentone) can be mentioned. Also included is everolimus, including its analogs, derivatives and pharma- ceutical acceptable salts. Everolimus includes RAD001, Zortress, Certican, Afinitor, Votubia, 42-O-(2-hydroxyethyl)rapamycin, (1R,9S,12S,15R,16E,18R,19R,21R,23S,24E,26E,28E,30S,32S,35R)-1,18-dihydroxy-12-[(2R)-1-[(1S,3R,4R)-4-(2-hydroxyethoxy)-3-methoxycyclohexyl]propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[3.0.1.0] 4 , 9] Hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone. Also included is merilimus, including its analogs, derivatives and pharma- ceutically acceptable salts. Merilimus can include SAR943, 42-O-(tetrahydrofuran-3-yl)rapamycin (Merilimus-1); 42-O-(oxetan-3-yl)rapamycin (Merilimus-2), 42-O-(tetrahydropyran-3-yl)rapamycin (Merilimus-3), 42-O-(4-methyl, tetrahydrofuran-3-yl)rapamycin, 42-O-(2,5,5-trimethyl, tetrahydrofuran-3-yl)rapamycin, 42-O-(2,5-diethyl-2-methyl, tetrahydrofuran-3-yl)rapamycin, 42-O-(2H-pyran-3-yl, tetrahydro-6-methoxy-2-methyl)rapamycin, or 42-O-(2H-pyran-3-yl, tetrahydro-2,2-dimethyl-6-phenyl)rapamycin). Also included are novolimus, including its analogs, derivatives and pharmaceutically acceptable salts.Novolimus can include 16-O-demethylrapamycin.Also included are pimecrolimus, including its analogs, derivatives and pharmaceutically acceptable salts. Pimecrolimus can include Elidel®, (3S,4R,5S,8R,9E,12S,14S,15R,16S,18R,19R,26aS)-3-((E)-2-((1R,3R,4S)-4-chloro-3-methoxycyclohexyl)-1-methylvinyl)-8-ethyl-5,6,8,11,12,13,14,15,16,17,18,19,24,26,26a-hexadecahydro-5,19-epoxy-3H-pyrido(2,1-c)(1,4)oxaazacyclotricosin-1,17,20,21(4H,23H)-tetrone, and 33-epi-chloro-33-desoxyascomycin. Also included is ridaforolimus, including its analogues, derivatives and pharma- ceutically acceptable salts.Ridaforolimus includes AP23573, MK-8669, deforolimus, (1R,9S,12S,15R,16E,18R,19R,21R,23S,24E,26E,28E,30S,32S,35R)-12-((1R)-2-((1S,3R,4R)-4-((dimethylphosphinoyl)oxy)-3-methoxycyclohexyl)-1-methylethyl)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo(30.3.1.0). 4 , 9) Hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone. Also included is tacrolimus, including its analogs, derivatives and pharma- ceutical acceptable salts. Tacrolimus includes FK-506, Fujimycin, Prograf (registered trademark), Advagraf (registered trademark), Protopic, 3S-[3R*[E(1S*,3S*,4S*)],4S*,5R*,8S*,9E,12R*,14R*,15S*,16R*,18S*,19S*,26aR*5,6,8,11,12,13,14,15,16,17,18,19,24,25,26,26a-hexatriaconta-16,24 ... Sadecahydro-5,19-dihydroxy-3-[2-(4-hydroxy-3-methoxycyclohexyl)-1-methylethenyl]-14,16-dimethoxy-4,10,12,18-tetramethyl-8-(2-propenyl)-15,19-epoxy-3H-pyrido[2,1-c][1,4]oxazacyclotricosine-1,7,20,21(4H,23H)-tetrone monohydrate may be mentioned. Also included is temsirolimus, including its analogs, derivatives and pharma- ceutical acceptable salts. Temsirolimus includes CCI-779, CCL-779, Torisel (registered trademark), (1R,2R,4S)-4-{(2R)-2-[(3S,6R,7E,9R,10R,12R,14S,15E,17E,19E,21S,23S,26R,27R,34aS)-9,27-dihydroxy-10,21-dimethoxy-6,8,12,14,20,26-hexamethyl -1,5,11,28,29-pentaoxo-1,4,5,6,9,10,11,12,13,14,21,22,23,24,25,26,27,28,29,31,32,33,34,34a-tetracosahydro-3H-23,27-epoxypyrido[2,1-c][1,4]oxaazacyclohentriacontin-3-yl]propyl}-2-methoxycyclohexyl 3-hydroxy-2-(hydroxymethyl)-2-methylpropanoate. Also included is umirolimus, including its analogs, derivatives and pharma- ceutical acceptable salts.Umirolimus can include Biolimus, Biolimus A9, BA9, TRM-986, 42-O-(2-ethoxyethyl)rapamycin. Also includes zotarolimus, including its analogs, derivatives and pharmaceutically acceptable salts. Zotarolimus can include ABT-578, (42S)-42-deoxy-42-(1H-tetrazol-1-yl)-rapamycin. Also includes C20-methallylrapamycin, including its analogs, derivatives and pharmaceutically acceptable salts. C20-methallylrapamycin can include C20-Marap. Also includes C16-(S)-3-methylindolerapamycin, including its analogs, derivatives and pharmaceutically acceptable salts. C16-(S)-3-methylindole rapamycin can include C16-iRap. Also includes AP21967, including analogs, derivatives, and pharmaceutically acceptable salts thereof. AP21967 can include C-16-(S)-7-methylindole rapamycin. Also includes mycophenolate sodium, including analogs, derivatives, and pharmaceutically acceptable salts thereof. Mycophenolate sodium can include Cellcept®, Myfortic, (4E)-6-(4-hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydro-2-benzofuran-5-yl)-4-methylhex-4-enoic acid. Also includes benidipine hydrochloride, including analogs, derivatives, and pharmaceutically acceptable salts thereof. Benidipine hydrochloride can include Coniel. Also included is AP1903, including its analogues, derivatives and pharma- ceutically acceptable salts.AP1903 can include rimiducid, [(1R)-3-(3,4-dimethoxyphenyl)-1-[3-[2-[2-[[2-[3-[(1R)-3-(3,4-dimethoxyphenyl)-1-[(2S)-1-[(2S)-2-(3,4,5-trimethoxyphenyl)butanoyl]piperidine-2-carbonyl]oxypropyl]phenoxy]acetyl]amino]ethylamino]-2-oxoethoxy]phenyl]propyl] (2S)-1-[(2S)-2-(3,4,5-trimethoxyphenyl)butanoyl]piperidine-2-carboxylate. Additionally, any combination thereof can be included.

[0239] In some embodiments, the ligand used in the method is a rapamycin or a rapalog, such as everolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP23573 or AP1903, or metabolites, derivatives and / or any combination thereof. Further useful rapalogs include variants of rapamycin in which rapamycin has been modified by one or more of the following: demethylation, removal or substitution of methoxy at C7, C42 and / or C29; removal, derivatization or substitution of hydroxy at C13, C43 and / or C28; reduction, removal or derivatization of ketone at C14, C24 and / or C30; replacement of the 6-membered pipecolate ring with a 5-membered prolyl ring; and / or replacement of the cyclohexyl ring with another substitution or a substituted cyclopentyl ring. Further useful rapalogs include novolimus, pimecrolimus, ridaforolimus, tacrolimus, temsirolimus, umirolimus or zotarolimus, or derivatives, metabolites and / or any combination thereof. In some embodiments, the ligand is an IMID drug (eg, thalidomide, pomalidomide, lenalidomide, or related analogs thereof).

[0240] In some embodiments, detection of a signal inside a cell (such as a mammalian cell) can be accomplished by a method of detecting a marker that is the result of a signal transduction pathway. Thus, a signal may be detected by measuring the amount of Akt or other signal transduction markers in a cell (such as a mammalian cell) by, for example, Western blot, flow cytometry, or other protein detection or quantification methods. Markers for detection can include, for example, JAK, Akt, STAT, NF-κ, MAPK, PI3K, JNK, ERK, or Ras, or other cell signal transduction markers that are indicative of cell signal transduction events.

[0241] In some embodiments, the signal transduction affects cytokine signaling. In some embodiments, the signal transduction affects IL2R signaling. In some embodiments, the signal transduction affects phosphorylation of downstream targets of the cytokine receptor. In some embodiments, the method of activating the signal induces proliferation of CISC-expressing cells (such as mammalian cells) and concomitantly inhibits proliferation of non-CISC-expressing cells.

[0242] For signal transduction in cells, not only must cytokine receptors dimerize or heterodimerize, but these cytokine receptors must be in the correct configuration to undergo a conformational change (Kim, MJ et al. (2007). J. Biol. Chem., 282(19):14253-14261). Thus, for proper signal transduction to occur, it is desirable for the signaling domains to dimerize in the correct conformational configuration, because simply dimerizing or heterodimerizing a receptor is not enough to activate the receptor. The chemically induced signaling complexes described herein are typically in the correct orientation for downstream signaling events to occur.

[0243] Method for selectively expanding a cell population In some embodiments, a method for selectively expanding a population of cells, such as mammalian cells, is provided. In some embodiments, the method can include providing a cell, such as a mammalian cell, comprising a protein sequence described herein or an expression vector described herein. In some embodiments, the method further includes expressing a protein sequence encoding a naked FRB domain polypeptide and / or a dimerized CISC, as described herein, or an expression vector described herein. In some embodiments, the method includes contacting a cell, such as a mammalian cell, with a ligand, which induces dimerization of a first CISC component and a second CISC component, thereby transmitting a signal to the interior of the cell. In some embodiments, the ligand is a rapamycin or a rapalog (e.g., any of the rapamycin or rapalog compounds disclosed herein). In some embodiments, the effective amount of ligand provided to induce dimerization is 0.01 nM, 0.02 nM, 0.03 nM, 0.04 nM, 0.05 nM, 0.06 nM, 0.07 nM, 0.08 nM, 0.09 nM, 0.1 nM, 0.2 nM, 0.3 nM, 0.4 nM, 0.5 nM, 0.6 nM, 0.7 nM, 0.8 nM, 0.9 nM, 1.0 nM, 1.5 nM, 2.0 nM, 2.5 nM, 3.0 nM, 3.5 nM, 4.0 nM, 4.5 nM, 5.0 nM, 6.0 nM, 7.0 nM, 8.0 nM, 9.0 nM, 10.0 nM, 11.0 nM, 12.0 nM, 13.0 nM, 14.0 nM, 15.0 nM, 16.0 nM, 17.0 nM, 18.0 nM, 19.0 nM, 20.0 nM, 21.0 nM, 22.0 nM, 23.0 nM, 24.0 nM, 25.0 nM, 26.0 nM, 27.0 nM, 28.0 nM, 29.0 nM, 30.0 nM, 31.0 nM, 32.0 nM, 33.0 nM, 34.0 nM, 35.0 nM, 36.0 nM, 37.0 nM, 38.0 nM, 39.0 nM, 40.0 nM, 41.0 nM, 42.0 nM, 43.0 M, 5.5nM, 6.0nM, 6.5nM, 7.0nM, 7.5nM, 8.0nM, 8.5nM, 9.0nM, 9.5nM, 10nM, 11nM, 12nM, 13nM, 14nM, 15nM, 20nM, 25nM, 30nM, 35nM, 40nM, 45nM, 50nM, 55nM, 60nM, 65nM, 70nM, 75nM, 80nM, 85nM, 90nM, 95nM, or 100nM, or a concentration within a range defined by any two of these values.

[0244] In some embodiments, the ligand used is a rapamycin or a rapalog, such as everolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP23573 or AP1903, or metabolites, derivatives and / or any combination thereof. Further useful rapalogs include variants of rapamycin in which rapamycin has been modified by one or more of the following: demethylation, removal or substitution of methoxy at C7, C42 and / or C29; removal, derivatization or substitution of hydroxy at C13, C43 and / or C28; reduction, removal or derivatization of ketone at C14, C24 and / or C30; replacement of the 6-membered pipecolate ring with a 5-membered prolyl ring; and / or replacement of the cyclohexyl ring with another substitution or a substituted cyclopentyl ring. Further useful rapalogs include novolimus, pimecrolimus, ridaforolimus, tacrolimus, temsirolimus, umirolimus or zotarolimus, or derivatives, metabolites and / or any combination thereof.

[0245] In some embodiments, selective expansion of a population of cells, such as mammalian cells, occurs only when two different recombination events (e.g., recombination via the CRISPR / Cas9 system) occur. One of these recombination events is one component of a dimeric chemical-induced signaling complex, and the other recombination event is the other component of the dimeric chemical-induced signaling complex. When both of these events occur in a cell population, such as a mammalian cell population, the components of the chemical-induced signaling complex dimerize in the presence of a ligand, resulting in an active chemical-induced signaling complex, which generates a signal inside the cell.

[0246] How to edit a genome In some embodiments, a method for editing the genome of a cell is provided, more specifically, a method for editing the genome of a cell to i) express a naked FRB domain polypeptide in the cytoplasm of the cell, and optionally ii) express one or more polypeptide components of a dimerization-activated chemical-induced signaling complex (CISC), characterized in that the signaling-competent CISC is capable of generating a stimulatory signal in a signaling pathway that promotes cell survival and / or proliferation.

[0247] In one embodiment, there is provided a method for editing the genome of a cell, comprising: i) a deoxyribonucleic acid (DNA) endonuclease, or a nucleic acid encoding said DNA endonuclease; ii) a guide RNA (gRNA) comprising a spacer sequence complementary to a target sequence within a target genomic locus of the cell, or a nucleic acid encoding the gRNA; and iii) a donor template comprising a donor cassette comprising a nucleic acid sequence encoding a naked FKBP-rapamycin binding (FRB) domain polypeptide. providing to a cell The method is characterized in that the DNA endonuclease, the gRNA and the donor template are configured such that a complex formed by association of the DNA endonuclease with the gRNA promotes targeted integration of the donor cassette into the target genomic locus of a cell to generate a genetically modified cell capable of expressing the naked FRB domain polypeptide.

[0248] In one aspect, a method for editing the genome of a cell is provided, comprising: providing a cell with one or more donor templates comprising a) a gRNA directed to a gene or genomic sequence of interest; b) an RNA-guided nuclease (RGEN) according to any of the embodiments described herein or a nucleic acid encoding the RGEN; c) a nucleic acid encoding a naked FRB domain; and d) a nucleic acid encoding i) a first CISC component comprising a first extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof; and i) a second CISC component comprising a second extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof, wherein the first CISC component and the second CISC component are configured (e.g., arranged) to dimerize in the presence of a ligand (e.g., rapamycin) when expressed by a T cell to generate a signaling-competent CISC that can generate a downstream signal (e.g., a survival signal or a proliferation signal). In some embodiments, one of the CISC components comprises a truncated IL2Rβ intracellular signaling domain.

[0249] In some embodiments, the method of editing the genome of a cell described herein comprises one or more nucleic acids encoding a first CISC component comprising a first extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof; and i) a second CISC component comprising a second extracellular binding domain or a functional derivative thereof, a hinge domain, a transmembrane domain, and a signaling domain or a functional derivative thereof, and the one or more nucleic acids encoding the first CISC component and the second CISC component are expressed in one or more vectors. The extracellular binding domain further comprises an endoplasmic reticulum signal sequence that targets the protein to the extracellular space. In some embodiments, the vector comprises a nucleic acid sequence as set forth in one or more of SEQ ID NOs: 3, 8, 28, 29, and 30.

[0250] In some embodiments, according to the method of editing the genome of a cell described herein, the RNA-guided nuclease (RGEN) is selected from the group consisting of Cas1 endonuclease, Cas1B endonuclease, Cas2 endonuclease, Cas3 endonuclease, Cas4 endonuclease, Cas5 endonuclease, Cas6 endonuclease, Cas7 endonuclease, Cas8 endonuclease, Cas9 endonuclease (also known as Csn1 and Csx12), Cas100 endonuclease, Csy1 endonuclease, Csy2 endonuclease, Csy3 endonuclease, Cse1 endonuclease, Cse2 endonuclease, Csc1 endonuclease, Csc2 endonuclease, Csa5 endonuclease, Csn2 endonuclease, Csm2 endonuclease, Css1 endonuclease, Cs ... sm3 endonuclease, Csm4 endonuclease, Csm5 endonuclease, Csm6 endonuclease, Cmr1 endonuclease, Cmr3 endonuclease, Cmr4 endonuclease, Cmr5 endonuclease, Cmr6 endonuclease, Csb1 endonuclease, Csb2 endonuclease, Csb3 endonuclease, Csx17 endonuclease, Csx14 endonuclease The RGEN is selected from the group consisting of clease, Csx10 endonuclease, Csx16 endonuclease, CsaX endonuclease, Csx3 endonuclease, Csx1 endonuclease, Csx15 endonuclease, Csf1 endonuclease, Csf2 endonuclease, Csf3 endonuclease, Csf4 endonuclease, and Cpf1 endonuclease, and functional derivatives thereof. In some embodiments, the RGEN is Cas 9. In some embodiments, the nucleic acid encoding the RGEN is a ribonucleic acid (RNA) sequence. In some embodiments, the RNA sequence encoding the RGEN is linked to the first gRNA or the second gRNA via a covalent bond. In some embodiments, the RGEN is pre-complexed with the first gRNA and / or the second gRNA to form an RNP complex before being provided to the cell.In some embodiments, the molar ratio of the RGEN to the first gRNA and / or the second gRNA in advance is 1:1 to 20:1.

[0251] Targeted integration In some embodiments, the method provided herein can integrate a sequence encoding a naked FRB domain polypeptide or its functional derivative into a specific location in a host genome, and this method is referred to as "targeted integration". In some embodiments, targeted integration can generate a double-strand break in genomic DNA using a sequence-specific nuclease, such as a site-specific polypeptide, such as a DNA endonuclease (e.g., a nucleic acid-guided nuclease such as Cas9).

[0252] The CRISPR-Cas system used in some embodiments has the advantage that the optimal CRISPR-Cas design can be identified by rapidly screening a large number of genomic targets. The CRISPR-Cas system uses an RNA molecule called a single-stranded guide RNA (sgRNA) that can target the associated Cas nuclease (e.g., Cas9 nuclease) to a specific sequence in DNA. This targeting occurs by forming Watson-Crick base pairing between the targeting sequence of the sgRNA, which is about 20 bp, and the sequence of the genome. When the sgRNA binds to the target site, the Cas nuclease cleaves both strands of the genomic DNA to create a double-stranded break. The only requirement for designing an sgRNA to target a specific DNA sequence is that the target sequence must contain a protospacer adjacent motif (PAM) sequence at the 3' end of the sgRNA sequence that is complementary to the genomic sequence. For Cas9 nuclease, the PAM sequence is NRG (R is A or G, and N is any base), or the more restrictive PAM sequence NGG. Thus, sgRNA molecules can be designed to target any region of the genome by designing in silico 20 bp sequences flanking the PAM motif. PAM motifs in eukaryotic genomes occur on average at only 15 bp. However, sgRNAs designed by in silico methods create double-stranded breaks with varying efficiency in cells, so the cleavage efficiency of a set of sgRNA molecules created using in silico methods cannot be predicted. Because sgRNAs can be rapidly synthesized in vitro, it is possible to rapidly screen all possible sgRNA sequences in a particular genomic region to identify the sgRNA that results in the most efficient cleavage. In general, when a set of sgRNAs in a particular genomic region is tested in cells, cleavage efficiencies range from 0 to 90%. Using the algorithms used in silico and laboratory experiments, the off-target effects of a particular sgRNA can be measured.In most eukaryotic genomes, a perfect match of the sgRNA to the 20 bp recognition sequence will most likely occur only once, but there are many other sites in the genome that produce one or more base pair mismatches for the sgRNA. These sites are cleaved at various frequencies, and it is difficult to predict the frequency based on the number of mismatches or their location. Cleavage may occur at additional off-target sites not identified by in silico analysis. Screening a large number of sgRNAs in relevant cell types to identify sgRNAs with the most favorable off-target profile is therefore crucial in selecting the best sgRNAs for therapeutic use. A favorable off-target profile is determined not only by the number of actual off-target sites and the frequency of cleavage at these sites, but also by the location of these sites in the genome. For example, off-target sites located near or within functionally important genes (especially oncogenes or tumor suppressor genes) are likely to be less favorable than sites in intragenic regions with no known function. Thus, identification of optimal sgRNAs cannot be predicted solely by in silico analysis of an organism's genomic sequence and requires experimentation. While in silico analysis is useful in narrowing down the guides to be tested, it does not predict which guides will produce high on-target cleavage or which are desirable guides with low off-target effects. Experimental data show that the cleavage efficiency of sgRNAs perfectly matching a genomic region of interest (e.g., intron 1 of fibrinogen alpha) can vary from no cleavage to over 90% cleavage and cannot be predicted by any known algorithm. The ability of a particular sgRNA to promote cleavage by Cas enzymes is related to the accessibility of a particular site in genomic DNA, which can be determined by the chromatin structure of that site. The majority of genomic DNA in differentiated, quiescent cells resides in highly condensed heterochromatin, while actively transcribed regions reside in a more open chromatin state that is known to be easily accessible to large molecules, such as proteins like Cas proteins.Some specific regions of DNA are more accessible than others, even within actively transcribed genes, due to the presence or absence of binding of transcription factors or other regulatory proteins. It is not possible to predict specific sites within a genome, within a specific genomic locus, or within a specific region of a genomic locus, and therefore must be determined experimentally in relevant cell types. If a specific site is selected as a possible insertion site, some modifications can be made to the selected site, for example, by moving a few nucleotides upstream or downstream of the selected site, with or without experimentation.

[0253] In some embodiments, gRNAs that can be used in the methods disclosed herein include a spacer sequence that is complementary to a sequence in the FOXP3 locus, AAVS1 locus, or TCRa (TRAC) locus of a cell. In some embodiments, gRNAs that can be used in the methods disclosed herein include one or more spacer sequences set forth in any one of SEQ ID NOs: 40-57, or a derivative of a spacer sequence having at least 85% or at least about 85% nucleotide sequence identity to any one of SEQ ID NOs: 40-57.

[0254] Nucleic acid modification In some embodiments, as described in detail herein and known in the art, the polynucleotide introduced into the cell has one or more modifications that can be used individually or in combination, e.g., to enhance activity, stability or specificity, alter delivery, reduce or otherwise enhance the innate immune response of the host cell.

[0255] In certain embodiments, modified polynucleotides are used in the CRISPR / Cas9 / Cpf1 system, where the guide RNA (single-molecule guide or bi-molecule guide) and / or DNA or RNA encoding the Cas endonuclease or Cpf1 endonuclease introduced into the cell can be modified as described and illustrated below. Such modified polynucleotides can be used in the CRISPR / Cas9 / Cpf1 system to edit one or more genomic loci.

[0256] When using the CRISPR / Cas9 / Cpf1 system for such exemplary (but not limited to) applications, the guide RNA can be modified to improve the formation or stability of the CRISPR / Cas9 / Cpf1 genome editing complex comprising the guide RNA, which may be formed from a single-molecule guide or a bimolecular guide and a Cas endonuclease or a Cpf1 endonuclease. Alternatively, the guide RNA can be modified to improve the initiation, stability or kinetics of the interaction between the genome editing complex and the target sequence in the genome, which can be used, for example, to enhance on-target activity. Alternatively, the guide RNA can be modified to improve specificity, for example, to improve the relative genome editing rate at the on-target site compared to the effect at other sites (off-target).

[0257] Alternatively or additionally, the stability of the guide RNA can be improved, for example by modifying it to make it more resistant to degradation by ribonucleases (RNases) present in the cell, thereby increasing the half-life of the guide RNA in the cell. Modifications that increase the half-life of the guide RNA can be particularly useful in embodiments in which editing is performed by introducing a Cas endonuclease or Cpf1 endonuclease into the cell using an RNA that needs to be translated to produce the endonuclease, since the increased half-life of the guide RNA introduced at the same time as the RNA encoding the endonuclease can be used to increase the time that the guide RNA and the encoded Cas or Cpf1 endonuclease coexist in the cell.

[0258] Alternatively, or in addition, modifications can be used to reduce the likelihood or extent to which RNA introduced into cells induces natural immune responses. As described herein below and known in the art, such immune responses have been well-characterized with respect to RNA interference (RNAi), such as small interfering RNA (siRNA), and tend to be associated with shortening the half-life of RNA and / or induction of cytokines or other factors associated with immune responses.

[0259] The RNA encoding the endonuclease that is introduced into a cell can also be modified in one or more ways, including, but not limited to, a modification that improves the stability of the RNA (such as increasing its degradation by RNAses present in the cell), enhances translation of the product (e.g., the endonuclease), and / or reduces the likelihood or extent to which the RNA introduced into a cell will induce an innate immune response.

[0260] Various modifications, such as those mentioned above or other modifications, can be used in combination as well, for example, in the case of CRISPR / Cas9 / Cpf1, one or more modifications can be made to the guide RNA (including those exemplified above) and / or one or more modifications can be made to the RNA encoding the Cas endonuclease (including those exemplified above).

[0261] As an example, the guide RNAs used in the CRISPR / Cas9 / Cpf1 system, or other smaller RNAs, can be easily synthesized by chemical means, as known in the art and described below, and thus can easily incorporate various modifications. Although chemical synthesis procedures are continually expanding, the length of polynucleotides tends to be significantly greater than about 100 nucleotides, making purification of said RNAs by procedures such as high performance liquid chromatography (HPLC without gels such as PAGE) difficult. One approach used to generate chemically modified long RNAs is to generate two or more molecules and then link them together. Very long RNAs, such as RNAs encoding Cas9 endonuclease, can be easily generated enzymatically. Enzymatically generated RNAs usually have a smaller variety of modifications available, but still can be used, for example, modifications that increase stability, reduce the likelihood or the extent of innate immune response, and / or enhance other attributes, as reported in the art and described below, and new types of modifications are constantly being developed.

[0262] As an example, various types of modifications, particularly those frequently used in the chemical synthesis of smaller RNAs, may be one or more nucleotides modified at the 2' position of the sugar, which in some embodiments may be 2'-O-alkyl modified nucleotides, 2'-O-alkyl-O-alkyl modified nucleotides, or 2'-fluoro modified nucleotides. In some embodiments, the RNA modifications include 2'-fluoro, 2'-amino or 2'O-methyl modifications of the ribose of pyrimidines, abasic residues, or inverted bases at the 3' end of the RNA. Such modifications are routinely incorporated into oligonucleotides, and these oligonucleotides have been shown to have higher Tm (e.g., higher target binding affinity) for certain targets than 2'-deoxyoligonucleotides.

[0263] It has been shown that various nucleotide and nucleoside modifications can be incorporated into oligonucleotides to make them more resistant to nuclease digestion than natural oligonucleotides.These modified oligonucleotides remain intact for longer than unmodified oligonucleotides.Specific examples of modified oligonucleotides include modified oligonucleotides with modified backbones, such as modified oligonucleotides with phosphorothioates, phosphotriesters, methylphosphonates, short alkyl or cycloalkyl intersugar bonds, or short heteroatom or heterocyclic intersugar bonds. Some oligonucleotides include oligonucleotides having phosphorothioate backbones and those having heteroatom backbones, particularly CH2-NH-O-CH2 backbones, CH backbones, -N(CH3)-O-CH2 backbones (known as the methylene (methylimino) backbone or MMI backbone), CH2-ON(CH3)-CH2 backbones, CH2-N(CH3)-N(CH3)-CH2 backbones and ON(CH3)-CH2-CH2 backbones (the natural phosphodiester backbone is represented as OPO-CH); amide backbones (see De Mesmaeker, A. et al. (1995). Acc. Chem. Res., 28:366-374); morpholino backbone structures (see Summerton and Weller, U.S. Pat. No. 5,034,506); peptide nucleic acid (PNA) backbones (wherein the phosphodiester backbone of the oligonucleotide is replaced by a polyamide backbone and the nucleotides are attached directly or indirectly to the aza nitrogen atoms of the polyamide backbone; Nielsen, P.E. et al., J. Am. Soc. Soc., 1999). al. (1991). Science, 254(5037):1497-1500).Phosphorus-containing linkages include, but are not limited to, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkyl phosphotriesters, methyl alkyl phosphonates and other alkyl phosphonates with 3' alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates with 3'-amino phosphoramidates and aminoalkyl phosphoramidates, thionophosphoramidates, thionoalkyl phosphonates, thionoalkyl phosphotriesters, boranophosphates with normal 3'-5' linkages, 2'-5' linked analogs of these, as well as those with reversed polarity where adjacent pairs of nucleoside units are linked by 3'-5' and 5'-3' or 2'-5' and 5'-2' linkages. U.S. Patent No. 3,687,808; U.S. Patent No. 4,469,863; U.S. Patent No. 4,476,301; U.S. Patent No. 5,023,243; U.S. Patent No. 5,177,196; U.S. Patent No. 5,188,897; U.S. Patent No. 5,264,423; U.S. Patent No. 5,276,019; U.S. Patent No. 5,278,302; U.S. Patent No. 5,286,717; U.S. Patent No. 5,321,131; U.S. Patent No. 5,399,676; U.S. Patent No. 5,405,9 39; U.S. Patent No. 5,453,496; U.S. Patent No. 5,455,233; U.S. Patent No. 5,466,677; U.S. Patent No. 5,476,925; U.S. Patent No. 5,519,126; U.S. Patent No. 5,536,821; U.S. Patent No. 5,541,306; U.S. Patent No. 5,550,111; U.S. Patent No. 5,563,253; U.S. Patent No. 5,571,799; U.S. Patent No. 5,587,361; and U.S. Patent No. 5,625,050.

[0264] Morpholino-based oligomeric compounds are described in Braasch, DA et al. (2002). Biochemistry, 41(14):4503-4510; Genesis, Volume 30, Issue 3, (2001); Heasman, J. (2002). Dev. Biol., 243(2):209-214; Nasevicius, A. et al. (2000). Nat. Genet., 26(2):216-220; Lacerra, G. et al. (2000). Proc. Natl. Acad. Sci. USA, 97(17):9591-9596; and U.S. Patent No. 5,034,506, issued July 23, 1991.

[0265] Oligonucleotide mimetics containing cyclohexenyl nucleic acids are described in Wang, J. et al. (2000). J. Am. Chem. Soc., 122(36):8595-8602.

[0266] Modified oligonucleotide backbones that do not contain phosphorus atoms include backbones formed by short alkyl or cycloalkyl internucleoside linkages, alkyl or cycloalkyl internucleoside linkages with different heteroatoms, or one or more short heteroatom or short heterocyclic internucleoside linkages. These backbones further include backbones with monophosphoric linkages (some of which are formed from the sugar moiety of the nucleoside), siloxane backbones, sulfide, sulfoxide and sulfone backbones, formacetyl and thioformacetyl backbones, methyleneformacetyl and methylenethioformacetyl backbones, alkene-containing backbones, sulfamate backbones, methyleneimino and methylenehydrazino backbones, sulfonate and sulfonamide backbones, amide backbones, and other backbones with a mixture of N, O, S and CH2 as building blocks. U.S. Patent No. 5,034,506; U.S. Patent No. 5,166,315; U.S. Patent No. 5,185,444; U.S. Patent No. 5,214,134; U.S. Patent No. 5,216,141; U.S. Patent No. 5,235,033; U.S. Patent No. 5,264,562; U.S. Patent No. 5,264,564; U.S. Patent No. 5,405,938; U.S. Patent No. 5,434,257; U.S. Patent No. 5,466,677; U.S. Patent No. 5,470,967; U.S. Patent No. 5,489,677; U.S. Patent No. 5,541,307; U.S. Patent No. 5,56 See U.S. Patent Nos. 5,1225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046; 5,610,289; 5,618,704; 5,623,070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439, which are incorporated herein by reference.

[0267] One or more substituted sugar moieties may be included, such as, for example, OH, SH, SCH3, F, OCN, OCH3, OCH3O(CH2)nCH3, O(CH2)nNH2, or O(CH2)nCH3 (n is 1-10 or 1-about 10); 10 The 2'-position may contain one of the following: lower alkyl, alkoxyalkoxy, substituted lower alkyl, alkaryl, or aralkyl; Cl; Br; CN; CF3; OCF3; O-, S-, or N-alkyl; O-, S-, or N-alkenyl; SOCH3; SO2CH3; ONO2; NO2; N3; NH2; heterocycloalkyl; heterocycloalkaryl; aminoalkylamino; polyalkylamino; substituted silyl; RNA cleaving group; reporter group; intercalator; group that improves the pharmacokinetic properties of oligonucleotides; or groups that improve the pharmacokinetic properties of oligonucleotides and other substituents with similar properties. In some embodiments, the modification includes 2'-methoxyethoxy (2'-O-CH2CH2OCH3, also known as 2'-O-(2-methoxyethyl)) (Martin, P. et al. (1995). Helv. Chim. Acta, 78(2):486-504). Other modifications include 2'-methoxy (2'-O-CH3), 2'-propoxy (2'-OCH2CH2CH3), and 2'-fluoro (2'-F). Similar modifications can be made at other positions on the oligonucleotide, particularly the 3' position of the sugar on the 3' terminal nucleotide and the 5' position of the 5' terminal nucleotide. Oligonucleotides can also have sugar mimetics, such as cyclobutyls in place of pentofuranosyl groups.

[0268] In some embodiments, both the sugar and the internucleoside linkage (such as the backbone) of the nucleotide unit are replaced with new groups. The base unit is retained for hybridization with the appropriate nucleic acid target compound. One such oligomeric compound, an oligonucleotide mimetic that has been shown to have good hybridization properties, is called peptide nucleic acid (PNA). In PNA compounds, the sugar backbone of the oligonucleotide is replaced with an amide-containing backbone, such as an aminoethylglycine backbone. The nucleobase is retained and is directly or indirectly linked to the aza nitrogen atom of the amide portion of the backbone. Representative U.S. patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Patent No. 5,539,082; U.S. Patent No. 5,714,331; and U.S. Patent No. 5,719,262. Further teachings on PNA compounds are described in Nielsen, PE et al. (1991). Science, 254(5037):1497-1500.

[0269] In some embodiments, a guide RNA may also or alternatively include modifications or substitutions with nucleobases (often referred to in the art simply as "bases"). As used herein, "unmodified" or "natural" nucleobases include adenine (A), guanine (G), thymine (T), cytosine (C), and uracil (U). Modified nucleobases include nucleobases that are found rarely or only occasionally in natural nucleic acids, such as hypoxanthine, 6-methyladenine, 5-methylpyrimidines, particularly 5-methylcytosine (also called 5-methyl-2'deoxycytosine and often written in the art as 5-Me-C), 5-hydroxymethylcytosine (HMC), glycosyl HMC and gentobiosyl HMC; as well as synthetic nucleobases such as 2-aminoadenine, 2-(methylamino)adenine, 2-(imidazolylalkyl)adenine, 2-(aminoalkylamino)adenine, or other hetero-substituted alkyl adenines, 2-thiouracil, 2-thiothymine, 5-bromouracil, 5-hydroxymethyluracil, 8-azaguanine, 7-deazaguanine, N 6 (6-aminohexyl)adenine, and 2,6-diaminopurine. Kornberg, A. et al. (1980). DNA Replication (2 nd ed., pp.75-77). San Francisco, CA: WH Freeman & Co.; Gebeyehu, G. et al. (1987). Nucl Acids Res. , 15(11):4513-4534. "Universal" bases known in the art, such as inosine, may be included. Substitution with 5-Me-C has been shown to increase nucleic acid duplex stability by 0.6-1.2°C (Sanghvi, YS (1993). Antisense Research and Applications, (pp. 276-278). Crooke, S. T. and Lebleu, B., (Eds.), Boca Raton, FL: CRC Press) and is an embodiment of base substitution.

[0270] In some embodiments, modified nucleobases include other synthetic and natural nucleobases, such as 5-methylcytosine (5-me-C), 5-hydroxymethylcytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine, 5-halouracil and cytosine, 5-propynyluracil and cytosine, 6-azouracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-haloadenine and guanine. uracil and cytosine, in particular 5-bromouracil and cytosine, 5-trifluoromethyluracil and cytosine, 7-methylguanine and adenine, 8-azaguanine and adenine, 7-deazaguanine and adenine, and 3-deazaadenine.

[0271] Further, nucleobases include those disclosed in U.S. Patent No. 3,687,808; those disclosed in Kroschwitz, J. (1990). Concise Encyclopedia of Polymer Science And Engineering, (pp. 858-859) New York, NY: Wiley; those disclosed in Englisch, U. et al. (1991). Angewandte Chemie International Edition, 30(6):613-722; and those disclosed in Sanghvi, YS (1993). Chapter 15, Antisense Research and Applications, (pp. 289-302), Crooke, ST and Lebleu, B. (Eds), Boca Raton, FL: CRC Press. Certain of these nucleobases are particularly useful for improving the binding affinity of the oligomeric compounds of the present disclosure. Such nucleobases include 5-substituted pyrimidines, 6-azapyrimidines, N-2 substituted purines, N-6 substituted purines and O-6 substituted purines, nucleobases with 2-aminopropyladenine, nucleobases with 5-propynyluracil and nucleobases with 5-propynylcytosine. Substitution with 5-methylcytosine has been shown to increase the stability of nucleic acid duplexes by 0.6-1.2°C (Sanghvi, YS (1993). Antisense Research and Applications, (pp. 276-278). Crooke, S. T. and Lebleu, B., (Eds.), Boca Raton, FL: CRC Press), and is an embodiment of base substitution that further increases the stability of nucleic acid duplexes, especially when combined with 2'-O-methoxyethyl sugar modifications.Modified nucleobases are disclosed in U.S. Pat. Nos. 3,687,808; 4,845,205; 5,130,302; 5,134,066; 5,175,273; 5,367,066; 5,432,272; 5,457,187; 5,459,255; 5,484,908; 5,502,177; and U.S. Pat. Nos. 5,525,711; 5,552,540; 5,587,469; 5,596,091; 5,614,617; 5,681,941; 5,750,692; 5,763,588; 5,830,653; 6,005,096; and U.S. Patent Application No. 2003 / 0158403.

[0272] In some embodiments, the mRNA (or DNA) encoding the endonuclease and / or the guide RNA are chemically linked to one or more moieties or conjugates that enhance the activity, intracellular distribution or cellular uptake of the oligonucleotide. Such moieties include lipid moieties such as cholesterol moieties (Letsinger, RL et al. (1989). Proc. Natl. Acad. Sci. USA, 86(17):6553-6556); cholic acid (Manoharan, M. et al. (1994). Bioorg. Med. Chem. Let., 4(8):1053-1060); thioethers such as hexyl-S-tritylthiol (Manoharan, M. et al. (1992). Ann. NY Acad. Sci., 660(1):306-309; and Manoharan, M. et al. (1993). Bioorg. Med. Chem. Let., 3(12):2765-2770); thiocholesterol (Oberhauser, B. et al. (1992). Nucl. Acids Res., 20(3):533-538); fatty chains such as dodecanediol residues, undecyl residues (Kabanov, AV et al. (1990). FEBS Lett. , 259(2):327-330 and Svinarchuk, FP et al. (1993). Biochimie, 75(1-2):49-54)); phospholipids such as di-hexadecyl-rac-glycerol, triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al. (1995). Tetrahedron Lett. , 36(21):3651-3654 and Shea, RG et al. (1990). Nucl. Acids Res., 18(13):3777-3783); polyamine or polyethylene glycol chains (Manohoran, M. et al. (1995). Tetrahedron Lett. , 36(21):3651-3654 and Shea, RG et al. (1990). Nucl. Acids Res., 18(13):3777-3783). al. (1995). Nucleos. Nucleot. Nucl., 14(3-5): 969-973); adamantane acetic acid (Manoharan, M. et al. (1995). Tetrahedron Lett., 36(21):3651-3654); a palmityl moiety (Mishra, RK et al. (1995). Biochim. Biophys. Acta, 1264(2):229-237); or an octadecylamine or hexylamino-carbonyl-t-oxycholesterol moiety (Crooke, ST et al. (1996). J. Pharmacol. Exp. Ther., 277(2):923-937). In addition, U.S. Patent Nos. 4,828,979; 4,948,882; 5,218,105; 5,525,465; 5,541,313; 5,545,730; 5,552,538; 5,578,717; 5,580,731; 5,580,731; 5,591,584; 5,109,124; 5,118,802; 5,138,045; 5,414, 077;U.S. Patent No. 5,486,603;U.S. Patent No. 5,512,439;U.S. Patent No. 5,578,718;U.S. Patent No. 5,608,046;U.S. Patent No. 4,587,044;U.S. Patent No. 4,605,735;U.S. Patent No. 4,667,025;U.S. Patent No. 4,762,779;U.S. Patent No. 4,789,737;U.S. Patent No. 4,824,941;U.S. Patent No. 4,835,263;U.S. Patent No. 4,876,335;U.S. Patent No. 4,904,582;U.S. Patent No. 4,958,013;U.S. Patent No. 5,082, 830;U.S. Patent No. 5,112,963;U.S. Patent No. 5,214,136;U.S. Patent No. 5,082,830;U.S. Patent No. 5,112,963;U.S. Patent No. 5,214,136;U.S. Patent No. 5,245,022;U.S. Patent No. 5,254,469;U.S. Patent No. 5,258,506;U.S. Patent No. 5,262,536;U.S. Patent No. 5,272,250;U.S. Patent No. 5,292,873;U.S. Patent No. 5,317,098;U.S. Patent No. 5,371,241;U.S. Patent No. 5,391,723;U.S. Patent No. 5,416 See also U.S. Patent No. 5,203; U.S. Patent No. 5,451,463; U.S. Patent No. 5,510,475; U.S. Patent No. 5,512,667; U.S. Patent No. 5,514,785; U.S. Patent No. 5,565,552; U.S. Patent No. 5,567,810; U.S. Patent No. 5,574,142; U.S. Patent No. 5,585,481; U.S. Patent No. 5,587,371; U.S. Patent No. 5,595,726; U.S. Patent No. 5,597,696; U.S. Patent No. 5,599,923; U.S. Patent No. 5,599,928; and U.S. Patent No. 5,688,941.

[0273] In some embodiments, sugars and other moieties can be used to target protein and nucleotide-containing complexes (e.g., cationic polysomes and liposomes) to specific sites. For example, hepatocytes can be targeted for import via the asialoglycoprotein receptor (ASGPR). See, for example, Hu, J. et al. (2014). Protein Pept. Lett., 21(10):1025-1030. Biomolecules and / or complexes used in the present invention can be targeted to specific target cells of interest using systems known in the art and other systems continually being developed.

[0274] In some embodiments, these targeting moieties or conjugates may include conjugate groups covalently attached to functional groups such as primary or secondary hydroxyl groups. Conjugate groups of the present disclosure include intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, polyethers, groups that enhance the pharmacokinetic properties of oligomers, and groups that enhance the pharmacokinetic properties of oligomers. Exemplary conjugate groups include cholesterol, lipids, phospholipids, biotin, phenazine, folates, phenanthridine, anthraquinone, acridine, fluorescein, rhodamine, coumarin, and dyes. Groups that enhance the pharmacokinetic properties of the present disclosure include groups that improve uptake, enhance resistance to degradation, and / or enhance sequence-specific hybridization with target nucleic acids. Groups that enhance the pharmacokinetic properties of the present disclosure include groups that improve uptake, distribution, metabolism, or excretion of the compounds of the present disclosure. Representative conjugate groups are disclosed in International Patent Application PCT / US92 / 09196, filed October 23, 1992, and U.S. Patent No. 6,287,860, both of which are incorporated herein by reference. Conjugate moieties include, but are not limited to, lipid moieties such as cholesterol moieties or cholic acid; thioethers such as hexyl-5-tritylthiol or thiocholesterol; aliphatic chains such as dodecanediol or undecyl residues; phospholipids such as di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate; polyamines or polyethylene glycol chains; or adamantane acetic acid, palmityl moieties, or octadecylamine or hexylamino-carbonyl-oxycholesterol moieties.See, for example, U.S. Patent No. 4,828,979; U.S. Patent No. 4,948,882; U.S. Patent No. 5,218,105; U.S. Patent No. 5,525,465; U.S. Patent No. 5,541,313; U.S. Patent No. 5,545,730; U.S. Patent No. 5,552,538; U.S. Patent No. 5,578,717; U.S. Patent No. 5,580,731; U.S. Patent No. 5,580,731; U.S. Patent No. 5,591,584; U.S. Patent No. 5,109,124; U.S. Patent No. 5,118,802; U.S. Patent No. 5,138,045; U.S. Patent No. 5,414 ,077;U.S. Patent No. 5,486,603;U.S. Patent No. 5,512,439;U.S. Patent No. 5,578,718;U.S. Patent No. 5,608,046;U.S. Patent No. 4,587,044;U.S. Patent No. 4,605,735;U.S. Patent No. 4,667,025;U.S. Patent No. 4,762,779;U.S. Patent No. 4,789,737;U.S. Patent No. 4,824,941;U.S. Patent No. 4,835,263;U.S. Patent No. 4,876,335;U.S. Patent No. 4,904,582;U.S. Patent No. 4,958,013;U.S. Patent No. 5,082 ,830;U.S. Patent No. 5,112,963;U.S. Patent No. 5,214,136;U.S. Patent No. 5,082,830;U.S. Patent No. 5,112,963;U.S. Patent No. 5,214,136;U.S. Patent No. 5,245,022;U.S. Patent No. 5,254,469;U.S. Patent No. 5,258,506;U.S. Patent No. 5,262,536;U.S. Patent No. 5,272,250;U.S. Patent No. 5,292,873;U.S. Patent No. 5,317,098;U.S. Patent No. 5,371,241;U.S. Patent No. 5,391,723;U.S. Patent No. 5,41 See U.S. Patent Nos. 6,203; 5,451,463; 5,510,475; 5,512,667; 5,514,785; 5,565,552; 5,567,810; 5,574,142; 5,585,481; 5,587,371; 5,595,726; 5,597,696; 5,599,923; 5,599,928 and 5,688,941.

[0275] Long polynucleotides that are not so easily chemically synthesized and are generally produced by enzymatic synthesis can also be modified by various means. Such modifications include, for example, the introduction of specific nucleotide analogues, the incorporation of specific sequences or other moieties at the 5' or 3' ends of the molecule, and other modifications. As an example, the mRNA encoding Cas9 is about 4 kb in length and can be synthesized by in vitro transcription. Modifications to the mRNA can be applied, for example, to increase its translation or stability (e.g., by increasing resistance to degradation in cells) or to reduce the tendency to elicit an innate immune response, which is often observed in cells after the introduction of foreign RNA, especially after the introduction of long RNA such as foreign RNA encoding Cas9.

[0276] Many such modifications have been reported in the art, including, for example, polyA tails, 5' cap analogs (e.g., Anti Reverse Cap Analog (ARCA) or m7G(5')ppp(5')G (mCAP)), modifications of the 5' or 3' untranslated regions (UTRs), use of modified bases (e.g., pseudo-UTP, 2-thio-UTP, 5-methylcytidine-5'-triphosphate (5-methyl-CTP) or N-terminal nucleotides). 6 -methyl-ATP), and phosphatase treatment to remove the 5'-terminal phosphate. These and other modifications are known in the art, and new modifications of RNA are constantly being developed.

[0277] There are many commercial suppliers offering modified RNAs, including TriLink Biotech, AxoLabs, Bio-Synthesis, and Dharmacon. As described by TriLink, for example, 5-methyl-CTP can be used to impart desirable characteristics such as increased nuclease stability, increased translation, or reduced interaction of innate immune receptors with in vitro transcribed RNA. 5-Methylcytidine-5'-triphosphate (5-methyl-CTP), N 6-Methyl-ATP, as well as pseudo-UTP and 2-thio-UTP, have also been shown to be able to reduce innate immune stimulation while enhancing translation in culture and in vivo, as shown in publications by Kormann et al. (2011) and Warren et al. (2010), cited below.

[0278] It has been shown that chemically modified mRNA delivered in vivo can be used to achieve improved therapeutic efficacy. See, e.g., Kormann, MSD et al. (2011). Nat. Biotechnol., 29:154-157. Such modifications can be used, for example, to increase the stability of the RNA molecule and / or reduce its immunogenicity. Pseudo-U, N 6 Regarding the use of chemical modifications such as 2-methyl-A, 2-thio-U, and 5-methyl-C, it was found that by replacing only a quarter of the uridine and cytidine residues with 2-thio-U and 5-methyl-C, respectively, the recognition of mRNAs via toll-like receptors (TLRs) in mice could be significantly reduced. These modifications can be used to effectively improve the stability and longevity of mRNAs in vivo by reducing the activation of the innate immune system. See, for example, Kormann et al. (2011).

[0279] It has also been shown that repeated administration of synthetic messenger RNA incorporating modifications designed to circumvent the natural response to viruses can reprogram differentiated human cells to pluripotency. See, for example, Warren, L. et al. (2010). Cell Stem Cell, 7(5):618-630. Such modified mRNAs, acting primarily as reprogramming proteins, can be an efficient means of reprogramming various types of human cells. Such cells are called induced pluripotent stem cells (iPSCs), and it has been found that enzymatically synthesized RNA incorporating 5-methyl-CTP, pseudo-UTP, or Anti Reverse Cap Analog (ARCA) can be used to effectively circumvent the cellular antiviral response. See, for example, Warren et al. (2010).

[0280] Other modifications of polynucleotides that have been reported in the art include, for example, the use of a polyA tail, the addition of a 5' cap analog (e.g., m7G(5')ppp(5')G (mCAP)), modifications of the 5' or 3' untranslated region (UTR), and phosphatase treatment to remove the 5' terminal phosphate, and new approaches are constantly being developed.

[0281] Various compositions and techniques applicable to the creation of modified RNA used herein have been developed in the context of RNA interference (RNAi) modifications, such as small interfering RNA (siRNA). The effect of siRNA on gene silencing via mRNA interference is usually transient, which may require repeated administration, which is particularly problematic in vivo. Furthermore, siRNA is double-stranded RNA (dsRNA), and mammalian cells have evolved immune responses to detect and neutralize dsRNA, which often occurs as a by-product of viral infection. Thus, there are mammalian enzymes such as PKR (dsRNA-responsive kinase), including retinoic acid-inducible gene I (RIG-I), which can mediate cellular responses to dsRNA, and Toll-like receptors (e.g., TLR3, TLR7, and TLR8), which can trigger cytokine induction in response to dsRNA. See, e.g., the reviews by Angart, P. et al. (2013). Pharmaceuticals, 6(4):440-468; Kanasty, RL et al. (2012). Mol. Ther., 20(3):513-524; Burnett, JC et al. (2011). Biotechnol. J., 6(9):1130-1146; Judge, AD (2008). Hum. Gene Ther., 19(2):111-124, and references cited therein.

[0282] As reported in the following publications, a wide variety of modifications have been developed and applied to enhance RNA stability, suppress innate immune responses, and / or achieve other advantages that may be useful in connection with the introduction of polynucleotides into human cells: For example, Whitehead, KA et al. (2011). Ann. Rev. Chem. Biomolec. Eng., 2:77-96; Gaglione, M. et al. (2010). Mini Rev. Med. Chem., 10(7):578-595; Chernolovskaya, EL et al. 12(2):158-167;Deleavey, GG et al. (2009). Curr. Protoc. Nucleic Acid Chem., 39(1):16.3.1-16.3.22;Behlke, MA (2008). Oligonucleotides, 18(4):305-319;Fucini, RV et al. (2012). Nucleic Acid Ther., 22(3):205-210;Bremsen, See review by JB et al. (2012). Front. Genet., 3:154.

[0283] As mentioned above, there are many commercial suppliers offering modified RNA, many of which specialize in modifications designed to improve the efficacy of siRNA. Various approaches are offered based on various findings reported in the literature. For example, Dharmacon has stated that they have extensively used the replacement of non-bridging oxygens with sulfur (phosphorothioate (PS)) to improve the nuclease resistance of siRNA, as reported by Kole, R. (2012). Nat. Rev. Drug Disc., 11(2):125-140. Modification of the 2' position of ribose has also been reported to improve the nuclease resistance of the internucleotide phosphate bond while increasing the stability (Tm) of the duplex, and this modification has also been shown to provide protection from immune activation. 2'-substitution with small, well-tolerated substituents (2'-O-methyl, 2'-fluoro, 2'-hydro) combined with moderate PS backbone modification results in highly stable siRNAs for in vivo applications, as reported by Soutschek, J. et al. (2004). Nature, 432:173-178. 2'-O-methyl modification has been reported to be effective in improving stability, as reported by Volkov, AA et al. (2009). Oligonucleotides, 19:191-202. With regard to reducing the induction of innate immune responses, it has been reported that modification of specific sequences with 2'-O-methyl, 2'-fluoro, and 2'-hydro suppresses interaction with TLR7 / TLR8 while largely retaining silencing activity. See, e.g., Judge, AD et al. (2006). Mol. Ther., 13:494-505; and Cekaite, L. et al. (2007). J. Mol. Biol., 365(1):90-108. 2-thiouracil, pseudouracil, 5-methylcytosine, 5-methyluracil, and N 6Other modifications, such as -methyladenosine, have also been shown to minimize immune effects mediated by TLR3, TLR7, and TLR8. See, e.g., Kariko, K. et al. (2005). Immunity, 23(2):165-175.

[0284] Various conjugates known in the art and commercially available can be used to enhance the delivery and / or cellular uptake of polynucleotides (such as RNA) used herein, including, for example, cholesterol, tocopherol and folate, lipids, peptides, polymers, linkers, and aptamers.See, for example, the review by Winkler, J. (2013). Ther. Deliv., 4(7):791-809, and references cited therein.

[0285] delivery In some embodiments, the nucleic acid molecule used in the methods provided herein, for example, the genome targeting nucleic acid and / or the nucleic acid encoding the site-directing polypeptide of the present disclosure, is packaged in or on the surface of a delivery carrier for delivery to cells.Conceivable delivery carriers include, but are not limited to, nanospheres, liposomes, quantum dots, nanoparticles, polyethylene glycol particles, hydrogels, and micelles.As reported in the art, various targeting moieties can be used to enhance the selective interaction of such carriers with desired cell types or locations.

[0286] Introduction of the complexes, polypeptides or nucleic acids of the present disclosure into cells can be achieved by virus or bacteriophage infection, transfection, conjugation, protoplast fusion, lipofection, electroporation, nucleofection, calcium phosphate precipitation, polyethylenimine (PEI)-mediated transfection, DEAE-dextran-mediated transfection, liposome-mediated transfection, particle gun technology, calcium phosphate precipitation, direct microinjection, or nanoparticle-mediated nucleic acid delivery, and the like.

[0287] In embodiments, the guide RNA polynucleotide (RNA or DNA) and / or the endonuclease polynucleotide (RNA or DNA) can be delivered by viral or non-viral delivery vehicles known in the art. Alternatively, single or multiple endonuclease polypeptides can be delivered by viral or non-viral delivery vehicles known in the art, such as electroporation or lipid nanoparticles. In some embodiments, the DNA endonuclease can be delivered as one or more polypeptides alone, or pre-complexed with one or more guide RNAs, or pre-complexed with tracrRNA and one or more crRNAs.

[0288] In embodiments, polynucleotide can be delivered by non-viral delivery carriers, such as non-viral delivery carriers include but are not limited to nanoparticles, liposomes, ribonucleoproteins, positively charged peptides, small RNA conjugates, aptamer-RNA chimeras, and RNA fusion protein complexes.Some specific examples of non-viral delivery carriers are described in Peer, D. et al. (2011). Gene Ther., 18: 1127-1133 (this document focuses on the non-viral delivery carriers for siRNA, which are also useful for the delivery of other polynucleotides).

[0289] In embodiments, polynucleotides such as guide RNAs, sgRNAs, and mRNAs encoding endonucleases can be delivered to cells or subjects by lipid nanoparticles (LNPs).

[0290] Although non-viral nucleic acid delivery methods have been tested in both animal models and humans, the most well-developed system is the lipid nanoparticle. Lipid nanoparticles (LNPs) are generally composed of ionizable cationic lipids and three or more additional components, usually cholesterol, DOPE, and lipid-containing polyethylene glycol (PEG). The cationic lipids can bind to positively charged nucleic acids to form dense complexes that protect the nucleic acid from degradation. During passage through a microfluidic system, the components self-assemble to form particles of 50-150 nM size, with the nucleic acid encapsulated in the core complexed with the cationic lipid and surrounded by a lipid bilayer-like structure. After endocytosis, the LNPs reside in endosomes. The encapsulated nucleic acid escapes the endosome due to the ionizable nature of the cationic lipid. This allows the nucleic acid to be delivered to the cytoplasm, where the mRNA is translated into the encoded protein. Thus, in some embodiments, mRNA and gRNA encoding Cas9 are encapsulated in LNPs and injected intravenously to efficiently deliver both components to cells. After escape from the endosome, Cas9 mRNA can be translated into Cas9 protein and complexed with gRNA. In some embodiments, the inclusion of a nuclear localization signal in the Cas9 protein sequence promotes nuclear translocation of Cas9 protein / gRNA complex. Alternatively, the small gRNA can pass through the nuclear pore complex and complex with Cas9 protein in the nucleus. Once the gRNA / Cas9 complex is in the nucleus, it scans the genome for homologous target sites and selectively creates double-strand breaks at the desired target site in the genome. The half-life of RNA molecules in vivo is generally short, on the order of hours to days. Similarly, the half-life of proteins also tends to be short, on the order of hours to days. Thus, in some embodiments, delivery of gRNA and Cas9 mRNA using LNPs can result in only transient expression and activity of gRNA / Cas9 complex. This can provide the advantage of reducing the frequency of off-target cleavage, thus minimizing the risk of genotoxicity in some embodiments.LNPs are generally less immunogenic than viral particles. While many humans have pre-existing immunity to AAV, there is no pre-existing immunity to LNPs. Furthermore, an adaptive immune response to LNPs is unlikely to develop, allowing repeated administration of LNPs.

[0291] Several types of ionizable cationic lipids have been developed for use in LNPs. These include C12-200 (Love, KT et al. (2010). Proc. Nat. Acad. Sci. USA, 107(5):1864-1869), MC3, LN16, MD1, and others. In one type of LNP, a GalNac moiety is added to the outside of the LNP, which serves as a ligand for uptake via the asialoglycoprotein receptor. Any of these cationic lipids are used to formulate LNPs for delivery of gRNA and Cas9 mRNA into cells.

[0292] In some embodiments, LNP refers to particles having a diameter of less than 1000 nm, less than 500 nm, less than 250 nm, less than 200 nm, less than 150 nm, less than 100 nm, less than 75 nm, less than 50 nm, or less than 25 nm. Alternatively, the size of the nanoparticles may range from 1-1000 nm, 1-500 nm, 1-250 nm, 25-200 nm, 25-100 nm, 35-75 nm, or 25-60 nm.

[0293] LNPs can be made from cationic, anionic, or neutral lipids. Neutral lipids such as DOPE, a fusogenic phospholipid, and cholesterol, a membrane component, can be included in LNPs as "helper lipids" to enhance transfection activity and nanoparticle stability. The limitations of cationic lipids include low efficacy due to poor stability and rapid clearance, and the generation of inflammatory or anti-inflammatory responses. LNPs can also have hydrophobic, hydrophilic, or both hydrophobic and hydrophilic lipids.

[0294] Any lipid or combination thereof known in the art can be used to make LNPs. Examples of lipids used to make LNPs include DOTMA, DOSPA, DOTAP, DMRIE, DC-cholesterol, DOTAP-cholesterol, GAP-DMORIE-DPyPE and GL67A-DOPE-DMPE-polyethylene glycol (PEG). Examples of cationic lipids include 98N12-5, C12-200, DLin-KC2-DMA (KC2), DLin-MC3-DMA (MC3), XTC, MD1 and 7C1. Examples of neutral lipids include DPSC, DPPC, POPC, DOPE and SM. Examples of PEG-modified lipids include PEG-DMG, PEG-CerC14 and PEG-CerC20.

[0295] In embodiments, LNPs can be made by combining multiple lipids in any molar ratio, and further, LNPs can be made by combining single or multiple polynucleotides with single or multiple lipids in various molar ratios.

[0296] In embodiments, the site-directed polypeptide and the genome-targeting nucleic acid can be administered separately to cells or subjects. Alternatively, the site-directed polypeptide can be pre-complexed with one or more guideRNAs, or pre-complexed with tracrRNA and one or more crRNAs. The pre-complexed material can then be administered to cells or subjects. Such pre-complexed material is known as ribonucleoprotein particle (RNP).

[0297] RNA can form specific interactions with other RNA or DNA. This property is exploited in many biological processes, but it also carries the risk of promiscuous interactions in the nucleic acid-rich cellular environment. One solution to this problem is to form ribonucleoprotein particles (RNPs) in which RNA is precomplexed with endonucleases. Another advantage of RNPs is the protection of RNA from degradation.

[0298] In some embodiments, the endonuclease contained in RNP can be modified or unmodified.Similarly, gRNA, crRNA, tracrRNA or sgRNA can be modified or unmodified.Various modifications are known in the art and can be used.

[0299] The endonuclease and sgRNA can be combined in a molar ratio of usually 1:1. Alternatively, the endonuclease, crRNA and tracrRNA can be combined in a molar ratio of usually 1:1:1. However, various molar ratios can be used to generate RNPs.

[0300] Gene editing elements can be delivered to the nucleus of cells through several mechanisms. These mechanisms can generally be classified into viral delivery and non-viral delivery. In various applications, a combination of viral and non-viral delivery can be used.

[0301] In some embodiments, delivery can be achieved using recombinant adeno-associated virus (AAV) vectors. Methods, techniques and systems suitable for producing rAAV particles to provide cells with the polynucleotide to be delivered, the AAV genome packaged to include rep and cap genes, and the function of a helper virus are known in the art. rAAV production typically requires the presence of a rAAV genome, the AAV rep and cap genes separated from (e.g., not contained within) the rAAV genome, and the function of a helper virus in a single cell (herein referred to as a packaging cell). Common approaches for producing rAAV include transient transfection, double infection with insect baculovirus, and single infection with insect baculovirus. Further information on these can be found, for example, in Ayuso, E. et al. (2010). Curr. Gene Ther., 10(6):423-436; Mietzsch, M. et al. (2014). Hum. Gene Ther., 25(3):212-222; Mietzsch, M. et al. (2015). Hum. Gene Ther., 26(10):688-697; and Mietzsch, M. et al. (2017). Hum. Gene Ther. Method, 28(1):15-22.

[0302] Typically, the AAV rep and cap genes may be from any serotype of AAV capable of generating recombinant virus, or from an AAV serotype different from the ITRs in the genome of the rAAV, including, but not limited to, AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-7, AAV-8, AAV-9, AAV-10, AAV-11, AAV-12, AAV-13, and AAV rh.74. Additionally, viruses of various natural and / or synthetic serotypes may be used to target specific types of tissues. The generation of pseudotyped rAAVs is disclosed, for example, in International Patent Application WO01 / 83692. Table 1A lists the AAV serotypes and Genbank accession numbers of some selected AAVs. [Table 1]

[0303] In some embodiments, the method for producing packaging cells includes producing a cell line that stably expresses all components required for the production of AAV particles. For example, a single plasmid (or multiple plasmids) containing a rAAV genome without AAV rep and cap genes, a separate AAV rep and cap gene from the rAAV genome, and a selection marker such as a neomycin resistance gene is integrated into the genome of the cell. The AAV genome is introduced into a bacterial plasmid by techniques such as GC tailing (Samulski, RJ et al. (1982). Proc. Natl. Acad. Sci. USA, 79(6):2077-2081), addition of a synthetic linker containing a restriction endonuclease cleavage site (Laughlin, CA et al. (1983). Gene, 23(1):65-73), or direct blunt-end ligation (Senapathy, P. (1984). J. Biol. Chem., 259:4661-4666). The packaging cell line is then infected with a helper virus, such as adenovirus.The advantage of this method is that the cells can be selected and are suitable for mass production of rAAV.Another suitable method is to use adenovirus or baculovirus instead of plasmid to introduce rAAV genome and / or rep and cap genes into packaging cells.

[0304] General principles of rAAV production are reviewed in, for example, Carter, BJ (1992). Curr. Opin. Biotechnol., 3(5):533-539; and Muzyczka, M. (1992). Curr. Topics Microbial. Immunol., 158:97-129.Various approaches are described in Tratschin, JD et al. (1984). Mol. Cell. Biol., 4(10):2072-2081; Hermonat, PL et al. (1984). Proc. Natl. Acad. Sci. USA, 81(2):6466-6470; Tratschin, JD et al. (1985). Mo1. Cell. Biol., 5(11):3251-3260;McLaughlin, SK et al. (1988). J. Virol., 62(6):1963-1973;Lebkowski, JS et al. (1988). Mol. Cell. Biol., 8(10):3988-3996. Samulski, RJ et al. (1989). J. Virol., 63(9):3822-3828); U.S. Pat. No. 5,173,414; WO 95 / 13365 and corresponding U.S. Pat. No. 5,658.776; WO 95 / 13392; WO 96 / 17947; PCT / US98 / 18600; WO 97 / 09441 (PCT / US96 / 14423); WO 97 / 08298 (PCT / US96 / 13872); WO 97 / 21825 (PCT / US96 / 20777); WO 97 / 06243 (PCT / FR96 / 01064); WO 99 / 11764; Perrin, P. et al. (1995) Vaccine, 13(13):1244-1250; Paul, RW et al. (1993). Hum. Gene Ther., 4(5):609-615; Clark, KR et al. (1996) Gene Ther., 3(12):1124-1132; U.S. Patent No. 5,786,211; U.S. Patent No. 5,871,982; and U.S. Patent No. 6,258,595.

[0305] The serotype of AAV vector can be matched to the target cell type.For example, the typical cell types described below can be transduced with the AAV serotypes described herein.For example, the serotypes of AAV vector suitable for liver tissue / liver cells include, but are not limited to, AAV3, AAV5, AAV8 and AAV9.In some cases, the serotype of AAV that is less immunogenic in the population or individual to be treated is selected.

[0306] In addition to adeno-associated viral vectors, other viral vectors can be used, including, but not limited to, lentiviruses, alphaviruses, enteroviruses, pestiviruses, baculoviruses, herpes viruses, Epstein-Barr viruses, papovaviruses, pox viruses, vaccinia viruses, and herpes simplex viruses.

[0307] In some embodiments, the Cas9 mRNA, the sgRNA targeting one or two loci of the fibrinogen alpha gene, and the donor DNA are each formulated separately by encapsulation in a lipid nanoparticle, all of them are formulated together by encapsulation in one lipid nanoparticle, or all of them are formulated together by encapsulation in two or more lipid nanoparticles.

[0308] In some embodiments, Cas9 mRNA is formulated by encapsulation in lipid nanoparticles, while sgRNA and donor DNA are delivered in AAV vectors. In some embodiments, Cas9 mRNA and sgRNA are formulated together by encapsulation in lipid nanoparticles, while donor DNA is delivered in AAV vectors.

[0309] Cas9 nuclease can also be delivered as a DNA plasmid, as an mRNA, or as a protein. Guide RNA can be expressed from the same DNA or can be delivered as RNA. The RNA can be chemically modified to alter or improve its half-life and / or reduce the likelihood or severity of an immune response. Endonuclease protein can also be complexed with gRNA prior to delivery. Viral vectors allow efficient delivery. Split Cas9 and smaller orthologues of Cas9 can be packaged into AAV, as can donors for HDR. There are also various non-viral delivery methods that can deliver each of these components, and non-viral and viral delivery methods can be used in combination. For example, nanoparticles can be used to deliver proteins and guide RNA, and AAV can be used to deliver donor DNA.

[0310] In some embodiments related to delivery of genome editing components for therapeutic treatment, at least two components are delivered into the nucleus of a cell (e.g., lymphocyte) to be transformed: a sequence-specific nuclease (e.g., a site-directed polypeptide, e.g., a DNA endonuclease, e.g., a nucleic acid-induced nuclease) and a DNA donor template. In some embodiments, the donor DNA template is packaged in a lymphotropic adeno-associated virus (AAV). In some embodiments, the AAV is selected from the serotypes AAV8, AAV9, AAVrhlO, AAV5, AAV6 and AAV-DJ. In some embodiments, the DNA donor template packaged in AAV is first administered to a subject (e.g., a patient) by peripheral intravenous injection, followed by administration of the sequence-specific nuclease (e.g., a DNA endonuclease). The advantage of first delivering the donor DNA template packaged in AAV is that the delivered donor DNA template is stably maintained in the nucleus of the transduced cell, which allows subsequent administration of a sequence-specific nuclease (e.g., a DNA endonuclease) to create a double-strand break in the genome and integrate the DNA donor by HDR or NHEJ. In some embodiments, it is desirable for the sequence-specific nuclease (e.g., a DNA endonuclease) to remain active in the target cell for the time required to promote the targeted integration of the transgene at a level sufficient to exert the desired therapeutic effect. If the sequence-specific nuclease (e.g., a DNA endonuclease) remains active in the cell for a long period of time, this will increase the frequency of double-strand breaks at off-target sites. Usually, the frequency of off-target cleavage is a function of the off-target cleavage efficiency multiplied by the time the nuclease is active. Because mRNA and the proteins translated from it are short-lived within the cell, delivery of a sequence-specific nuclease (e.g., a DNA endonuclease) in the form of mRNA results in a short duration of nuclease activity, ranging from a few hours to a few days.Thus, delivery of sequence-specific nucleases (e.g., DNA endonucleases) to cells that already contain a donor template is expected to maximize the ratio of targeted to off-target integration. Furthermore, delivery of the donor DNA template into the nucleus of a cell after peripheral intravenous injection via AAV is time-consuming, typically taking about 1-14 days, because the virus must infect the cell, escape endosomes, translocate to the nucleus, and be converted from a single-stranded AAV genome into a double-stranded DNA molecule by host cell components. Thus, in at least some embodiments, delivery of the donor DNA template into the nucleus is completed before providing the CRISPR-Cas elements, since the nuclease elements are typically active for about 1-3 days.

[0311] In some embodiments, the sequence-specific nuclease (e.g., DNA endonuclease) is CRISPR-Cas9, which is composed of an sgRNA directed to a DNA sequence within intron 1 of the fibrinogen alpha gene and a Cas9 nuclease. In some embodiments, the Cas9 nuclease is delivered as an mRNA encoding a Cas9 protein operably fused to one or more nuclear localization signals (NLS). In some embodiments, the sgRNA and Cas9 mRNA are packaged in lipid nanoparticles and delivered to cells. In some embodiments, the lipid nanoparticles comprise C12-200 lipids (Love, KT et al. (2010). Proc. Nat. Acad. Sci. USA, 107(5):1864-1869). In some embodiments, the ratio of sgRNA to Cas9 mRNA packaged in the LNP is 1:1 (by mass) to maximize DNA cleavage in vivo in mice. In another embodiment, the mass ratio of sgRNA to Cas9 mRNA packaged in the LNP can be varied, for example, 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, or 2:1, or vice versa. In some embodiments, the Cas9 mRNA and sgRNA are packaged in separate LNP formulations, and the Cas9 mRNA-containing LNPs are delivered to the subject about 1 hour to about 8 hours prior to delivery of the sgRNA-containing LNPs, thereby optimizing the time for translation of the Cas9 mRNA prior to delivery of the sgRNA.

[0312] In some embodiments, the LNP formulation encapsulating gRNA and Cas9 mRNA ("LNP-nuclease formulation") is administered to a subject (e.g., a patient) who has already been administered an AAV-packaged DNA donor template. In some embodiments, the LNP-nuclease formulation is administered to the subject within 1 to 28 days, 7 to 28 days, or 7 to 14 days after administration of the AAV-donor DNA template. Effective timing for delivery of the LNP-nuclease formulation after administration of the AAV-donor DNA template can be determined using techniques known in the art, for example, studies conducted in animal models such as mice and monkeys.

[0313] In some embodiments, the DNA donor template is delivered to cells of a subject (e.g., a patient) using a non-viral delivery method. Although some subjects (approximately 30%) already have neutralizing antibodies against the most commonly used serotypes of AAV, preventing effective gene delivery by AAV, more subjects can be treated by using a non-viral delivery method. Several non-viral delivery methods are known in the art. In particular, it is known that lipid nanoparticles (LNPs) can efficiently deliver encapsulated cargo to the cytoplasm of cells by intravenous injection in animals and humans. These LNPs are actively taken up by cells by receptor-mediated endocytosis.

[0314] In some embodiments, to facilitate nuclear localization of the donor template, a DNA sequence capable of facilitating nuclear localization of the plasmid, for example, a 366 bp region consisting of the Simian Virus 40 (SV40) origin of replication and early promoter, can be added to the donor template. Other DNA sequences that bind to cellular proteins can also be used to enhance nuclear import of DNA.

[0315] In some embodiments, the expression level or activity of the introduced sequence encoding the protein of interest (e.g., FVIII) is measured in the blood of the subject (e.g., patient) after administration of the AAV-donor DNA template and after a first administration of the LNP-nuclease formulation (e.g., including gRNA and Cas9 nuclease or mRNA encoding Cas9 nuclease). If the amount of the protein of interest is insufficient to cure the disease, e.g., if the amount of the protein of interest is at least 5-50% of normal, especially if the amount of the protein of interest is at least 5-20% of normal, a second or third administration of the LNP-nuclease formulation may be administered to promote further targeted integration into the intron 1 site of the fibrinogen alpha gene. The feasibility of administering multiple doses of the LNP-nuclease formulation to achieve the desired therapeutic amount of the protein of interest may be tested and optimized using techniques known in the art, e.g., tests using animal models such as mouse models or monkey models.

[0316] In some embodiments, according to any of the methods described herein that include administering to a subject i) an AAV-donor DNA template comprising a donor cassette and ii) an LNP-nuclease formulation, the initial administration of the LNP-nuclease formulation to the subject occurs within 1 to 28 days after the AAV-donor DNA template is administered to the subject. In some embodiments, the initial administration of the LNP-nuclease formulation to the subject occurs after a sufficient amount of time has passed for the donor DNA template to be delivered into the nucleus of the target cell. In some embodiments, the initial administration of the LNP-nuclease formulation to the subject occurs after a sufficient amount of time has passed for the single-stranded AAV genome to be converted into a double-stranded DNA molecule in the nucleus of the target cell. In some embodiments, the initial administration of the LNP-nuclease formulation is followed by one or more additional administrations of the LNP-nuclease formulation (e.g., 2, 3, 4, 5 or more times). In some embodiments, the LNP-nuclease formulation is administered to the subject one or more times until the targeted integration of the donor cassette reaches a target amount and / or the expression of the donor cassette reaches a target amount. In some embodiments, the method further comprises measuring the amount of targeted integration of the donor cassette and / or the expression of the donor cassette after each administration of the LNP-nuclease formulation, and administering one or more additional doses of the LNP-nuclease formulation if the targeted integration of the donor cassette has not reached a target amount and / or the expression of the donor cassette has not been achieved. In some embodiments, at least one of the one or more additional doses of the LNP-nuclease formulation is the same as the initial dose. In some embodiments, at least one of the one or more additional doses of the LNP-nuclease formulation is less than the initial dose. In some embodiments, at least one of the one or more additional doses of the LNP-nuclease formulation is more than the initial dose.

[0317] Therapeutic approach In one aspect, a gene therapy approach is provided for treating a subject by adoptive cell therapy using cells edited according to any of the methods described herein. For example, in some embodiments, the disorder or condition is an autoimmune disease (e.g., IPEX syndrome) or a disorder resulting from organ transplantation (e.g., GVHD), and the edited cells have a Treg phenotype. In some embodiments, the gene therapy approach incorporates a nucleic acid comprising a sequence encoding a naked FRB domain polypeptide and CISC into the genome of a relevant type of cell of the subject, thereby providing a stable treatment, e.g., alleviating one or more symptoms of the disorder or condition over a long period of time, and / or providing a cure or alleviation of the disorder or condition. In some embodiments, the cell type of interest in the gene therapy approach in which a sequence encoding a naked FRB domain polypeptide and CISC is incorporated is a lymphoid cell, e.g., a CD4+ T cell.

[0318] In some embodiments, ex vivo cell therapy is performed using lymphocyte cells isolated from a subject, for example, autologous CD4+ T cells derived from umbilical cord blood.Then, the chromosomal DNA of the cells is edited using the systems, compositions and methods described herein.Finally, the edited cells are transplanted into the subject.

[0319] One advantage of ex vivo cell therapy approach is that it allows comprehensive analysis of therapeutic agents before administration. Nuclease-based therapy always has some degree of off-target effects. Ex vivo gene correction allows comprehensive characterization of corrected cell population before transplantation. Aspects of the present disclosure include sequencing the entire genome of corrected cells to confirm that off-target breaks, if any, are in genomic locations that pose minimal risk to the subject. Furthermore, specific populations of cells, such as clonal populations, can be isolated before transplantation.

[0320] Another embodiment of such method is an in vivo therapy. In this method, the chromosomal DNA of a cell in a subject is modified using the system, composition and method described herein. In some embodiments, the cell is a lymphocyte cell, for example a CD4+ cell, for example a T cell.

[0321] One advantage of in vivo gene therapy is that the therapeutic agent is easy to manufacture and administer. The same therapeutic approach and treatment method can be used to treat more than one subject, for example, multiple subjects with the same or similar genotype or allele. In contrast, ex vivo cell therapy usually uses the subject's own cells, which are isolated, genetically engineered, and then returned to the same subject.

[0322] Another embodiment relates to a genetically modified cell that has been genome edited by any one of the methods described herein for use in suppressing or treating a FOXP3-associated disease or condition, such as an inflammatory disease or an autoimmune disease. A further embodiment relates to the use of a genetically modified cell that has been genome edited by any one of the methods described herein as a pharmaceutical.

[0323] Transplantation of cells into a subject In some embodiments, the ex vivo methods of the present disclosure include transplanting genome-edited cells into a subject in need of such methods. This transplantation step can be performed using any transplantation method known in the art. For example, the genetically modified cells can be directly injected into the blood of the subject or can be administered to the subject in other ways.

[0324] In some embodiments, the methods disclosed herein include "administration," which may be used interchangeably with "introduction" and "implantation," and the methods disclosed herein include administering genetically modified therapeutic cells to a subject by a method or route that allows at least a portion of the introduced cells to localize to a desired site so as to achieve a desired effect or effects. The therapeutic cells or their differentiated progeny can be administered via a suitable route that allows delivery to a desired site in the subject's body where at least a portion of the transplanted cells or at least a portion of its components can remain viable. The viability of the cells after administration to a subject can be as short as a few hours (e.g., 24 hours to a few days) to several years or even the lifetime of the subject (e.g., long-term engraftment).

[0325] When the therapeutic cells described herein are provided for prophylactic purposes, the therapeutic cells can be administered to a subject prior to the onset of any symptoms of the disease or condition being treated. Thus, in some embodiments, prophylactic administration of the genetically modified stem cell population is used to prevent the onset of symptoms of said disease or condition.

[0326] In some embodiments, when the genetically modified stem cells are provided for therapeutic purposes, the genetically modified stem cells are provided upon (or after) the onset of a symptom or sign of a disease or condition, e.g., at the onset of the disease or condition.

[0327] An effective amount of therapeutic cells (e.g., genome-edited stem cells) used in various embodiments described herein is at least 10 2 Pieces, at least 5 × 10 2 Pieces, at least 10 3 Pieces, at least 5 × 10 3 Pieces, at least 10 4 Pieces, at least 5 × 10 4 Pieces, at least 10 5 Pieces, at least 2 x 10 5 Pieces, at least 3 × 10 5 Pieces, at least 4 × 105 Pieces, at least 5 × 10 5 Pieces, at least 6 x 10 5 Pieces, at least 7 x 10 5 Pieces, at least 8 x 10 5 Pieces, at least 9 x 10 5 Pieces, at least 1 × 10 6 Pieces, at least 2 x 10 6 Pieces, at least 3 × 10 6 Pieces, at least 4 × 10 6 Pieces, at least 5 × 10 6 Pieces, at least 6 × 10 6 Pieces, at least 7 x 10 6 Pieces, at least 8 x 10 6 Pieces, at least 9 x 10 6 The therapeutic cells may be from one or more donors, or may be autologous. In some of the embodiments described herein, the therapeutic cells are expanded in culture prior to administration to a subject in need thereof.

[0328] In embodiments, a therapeutic cell composition (e.g., a composition comprising a plurality of cells, any of the cells described herein) can be delivered to a subject by a particular method or route, thereby allowing at least a portion of the cell composition to localize to a desired site. The cell composition can be administered by any suitable route that results in an effective treatment in the subject, for example, administration of the cell composition can result in at least a portion of the composition (e.g., at least 1×10 4The cells can be delivered to a desired site in the subject over a period of time. Methods of administration include injection, infusion, infusion, and oral ingestion. "Injection" includes, but is not limited to, intravenous injection, intramuscular injection, intraarterial injection, intrathecal injection, intraventricular injection, intracapsular injection, intraorbital injection, intracardiac injection, intradermal injection, intraperitoneal injection, transtracheal injection, subcutaneous injection, subcuticular injection, intraarticular injection, subcapsular injection, subarachnoid injection, intraspinal injection, intracerebrospinal injection, and intrasternal injection and infusion. In some embodiments, the route of administration is intravenous. Delivery of cells can be by injection or infusion.

[0329] In one embodiment, the cells are administered systemically, in other words, the therapeutic cell population is not administered directly to a target site, tissue or organ, but rather enters the subject's circulatory system and undergoes metabolic and other similar processes.

[0330] The efficacy of a treatment using a composition for treating a disease or condition can be determined by a skilled clinician. However, a treatment is considered effective if any one or all of the signs, symptoms, or markers of the disease are improved or alleviated. Efficacy can also be measured by determining that an individual has stopped getting worse (e.g., the progression of the disease is stopped or at least slowed) as assessed by the need for hospitalization or medical intervention. Methods for measuring these indicators are known to those skilled in the art and / or described herein. Treatment includes any treatment of a disease in an individual or animal (including, but not limited to, a human or mammal), including (1) suppressing the disease, e.g., stopping or slowing the progression of the condition, or (2) alleviating the disease, e.g., inducing regression of the condition, and (3) preventing the onset of the condition or reducing the likelihood of the onset of the condition.

[0331] composition In one embodiment, the present disclosure provides a composition for carrying out the methods disclosed herein.The composition can include one or more of the following: a genome-targeting nucleic acid (e.g., gRNA); a site-directed polypeptide (e.g., DNA endonuclease) or a nucleotide sequence encoding the site-directed polypeptide; and a polynucleotide (e.g., donor template) that is inserted to achieve the desired genetic recombination by the methods disclosed herein.

[0332] In some embodiments, the composition comprises a nucleotide sequence encoding a genome-targeting nucleic acid (e.g., a gRNA).

[0333] In some embodiments, the composition comprises a site-directed polypeptide (e.g., a DNA endonuclease). In some embodiments, the composition comprises a nucleotide sequence encoding the site-directed polypeptide.

[0334] In some embodiments, the composition includes a polynucleotide (eg, a donor template) to be inserted into the genome.

[0335] In some embodiments, the composition comprises (i) a nucleotide sequence encoding a genome-targeting nucleic acid (e.g., a gRNA), and (ii) a site-directed polypeptide (e.g., a DNA endonuclease), or a nucleotide sequence encoding the site-directed polypeptide.

[0336] In some embodiments, the composition includes (i) a nucleotide sequence encoding a nucleic acid (e.g., a gRNA) that targets a genome, and (ii) a polynucleotide (e.g., a donor template) to be inserted into the genome.

[0337] In some embodiments, the composition comprises (i) a site-directed polypeptide (e.g., a DNA endonuclease), or a nucleotide sequence encoding the site-directed polypeptide, and (ii) a polynucleotide to be inserted into the genome (e.g., a donor template).

[0338] In some embodiments, the composition includes (i) a nucleotide sequence encoding a genome-targeting nucleic acid (e.g., a gRNA), (ii) a site-directed polypeptide (e.g., a DNA endonuclease) or a nucleotide sequence encoding the site-directed polypeptide, and (iii) a polynucleotide to be inserted into the genome (e.g., a donor template).

[0339] In some of the embodiments of any of the compositions, the composition comprises a genome-targeting nucleic acid using a single molecular guide. In some of the embodiments of any of the compositions, the composition comprises a genome-targeting nucleic acid using a bimolecular guide. In some of the embodiments of any of the compositions, the composition comprises two or more bimolecular or single molecular guides. In some embodiments, the composition comprises a vector encoding a nucleic acid that targets a nucleic acid. In some embodiments, the genome-targeting nucleic acid is a DNA endonuclease, particularly Cas9.

[0340] In some embodiments, the composition can comprise one or more gRNAs that can be used for genome editing, particularly for inserting the sequence encoding naked FRB domain polypeptide and CISC into the genome of a cell.The one or more gRNAs can target a genomic site on endogenous FOXP3 gene, a genomic site in endogenous FOXP3 gene, or a genomic site near endogenous FOXP3 gene.Thus, in some embodiments, the one or more gRNAs can have a spacer sequence that is complementary to a genomic sequence on FOXP3 gene, a spacer sequence that is complementary to a genomic sequence in FOXP3 gene, or a spacer sequence that is complementary to a genomic sequence near FOXP3 gene.

[0341] In some embodiments, the gRNA for the composition comprises a spacer sequence selected from any one of the spacer sequences shown in SEQ ID NOs: 40-57, and variants having at least 50% or at least about 50%, at least 55% or at least about 55%, at least 60% or at least about 60%, at least 65% or at least about 65%, at least 70% or at least about 70%, at least 75% or at least about 75%, at least 80% or at least about 80%, at least 85% or at least about 85%, at least 90% or at least about 90%, or at least 95% or at least about 95% identity or homology to any one of SEQ ID NOs: 40-57. In some embodiments, the variant of the gRNA for the kit comprises a spacer sequence having at least 85% or at least about 85% homology to any one of SEQ ID NOs: 40-57.

[0342] In some embodiments, the gRNA for the composition has a spacer sequence that is complementary to a target site in a genome. In some embodiments, the spacer sequence is 15-20 bases long. In some embodiments, the complementarity between the spacer sequence and the genome sequence is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 100%.

[0343] In some embodiments, the composition may have a donor template having a DNA endonuclease or a nucleic acid encoding the DNA endonuclease, and / or a nucleic acid sequence encoding a naked FRB domain polypeptide and a CISC. In some embodiments, the nucleic acid sequences encoding naked FRB domain polypeptides and CISCs have at least 70% or at least about 70% sequence identity to the sequences set forth in SEQ ID NOs: 3-4, 8, 28-30, 32 and 37-39, e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more, or at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or more. In some embodiments, the nucleic acid sequence encoding the naked FRB domain polypeptide and CISC has at least 70% or at least about 70% sequence identity with the sequence shown in SEQ ID NO: 32, such as at least 75%, at least 80%, at least 85%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or at least more sequence identity, or at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least more sequence identity. In some embodiments, the DNA endonuclease is Cas9. In some embodiments, the nucleic acid encoding the DNA endonuclease is DNA or RNA.

[0344] In some embodiments, one or more of the nucleic acids for the kit can be encoded in an adeno-associated virus (AAV) vector. Thus, in some embodiments, the gRNA can be encoded in an AAV vector. In some embodiments, the nucleic acid encoding the DNA endonuclease can be encoded in an AAV vector. In some embodiments, the donor template can be encoded in an AAV vector. In some embodiments, two or more nucleic acids can be encoded in a single AAV vector. Thus, in some embodiments, the nucleic acid encoding the DNA endonuclease and the gRNA sequence can be encoded in a single AAV vector.

[0345] In some embodiments, the composition may have liposomes or lipid nanoparticles. Thus, in some embodiments, any compound of the composition (e.g., DNA endonuclease or nucleic acid encoding the DNA endonuclease, gRNA and donor template) may be formulated to be encapsulated in liposomes or lipid nanoparticles. In some embodiments, one or more of such compounds are bound to liposomes or lipid nanoparticles via covalent or non-covalent bonds. In some embodiments, any of the compounds may be encapsulated in liposomes or lipid nanoparticles separately or together. Thus, in some embodiments, each of the DNA endonuclease or nucleic acid encoding the DNA endonuclease, gRNA and donor template is formulated to be encapsulated in liposomes or lipid nanoparticles separately. In some embodiments, the DNA endonuclease is formulated to be encapsulated in liposomes or lipid nanoparticles together with gRNA. In some embodiments, the DNA endonuclease or nucleic acid encoding the DNA endonuclease, gRNA and donor template are formulated to be encapsulated in liposomes or lipid nanoparticles together.

[0346] In some embodiments, the composition further comprises one or more additional reagents, such additional reagents being selected from buffers, buffers for introducing polypeptides or polynucleotides into cells, wash buffers, control reagents, control vectors, control RNA polynucleotides, reagents for generating polypeptides from DNA in vitro, adaptors for sequencing, etc. The buffers may be stabilization buffers, reconstitution buffers, dilution buffers, etc. In some embodiments, the composition may further comprise one or more components used to promote or enhance on-target binding, cleave DNA with an endonuclease, or improve targeting specificity.

[0347] In some embodiments, any of the components of the composition are formulated with pharma- ceutically acceptable additives, such as carriers, solvents, stabilizers, adjuvants, diluents, etc., depending on the particular method of administration and dosage form. In embodiments, the guide RNA composition is typically formulated to achieve a physiologically compatible pH, which may range from 3 to 11 or about 3 to about 11, or from 3 to 7 or about 3 to about 7, depending on the formulation and route of administration. In some embodiments, the pH is adjusted to a range of pH 5.0 to pH 8 or a range of about pH 5.0 to about pH 8. In some embodiments, the composition has a therapeutically effective amount of at least one compound described herein and one or more pharma- ceutically acceptable additives. In some cases, the composition can have a combination of compounds described herein, or can include a second active ingredient useful for treating or preventing bacterial growth (e.g., but not limited to, an antibacterial or antimicrobial agent), or can include a combination of reagents of the present disclosure. In some embodiments, the gRNA is formulated with one or more additional nucleic acids, such as a nucleic acid encoding a DNA endonuclease and / or a donor template. Alternatively, the nucleic acid encoding a DNA endonuclease and the donor template are each formulated separately or in combination with another nucleic acid, as described above for gRNA formulations.

[0348] Suitable additives include, for example, carrier molecules including slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, inactive virus particles, etc. Other typical additives include antioxidants (such as, but not limited to, ascorbic acid), chelating agents (such as, but not limited to, EDTA), carbohydrates (such as, but not limited to, dextrin, hydroxyalkylcellulose, and hydroxyalkylmethylcellulose), stearic acid, liquids (such as, but not limited to, oils, water, saline, glycerol, and ethanol), wetting or emulsifying agents, or pH buffering substances, etc.

[0349] In some embodiments, any of the components of the composition (e.g., the DNA endonuclease or a nucleic acid encoding the DNA endonuclease, the gRNA, and the donor template) can be delivered to the cell by transfection, such as chemical transfection (e.g., lipofection) or electroporation. In some embodiments, the DNA endonuclease can be pre-complexed with the gRNA to form a ribonucleoprotein (RNP) complex prior to providing to the cell. In some embodiments, the RNP complex is delivered to the cell by transfection. In such embodiments, the donor template is delivered to the cell by transfection.

[0350] In some embodiments, "composition" refers to a therapeutic composition comprising therapeutic cells for use in an ex vivo therapy.

[0351] In embodiments, a therapeutic composition comprises a cell composition and a physiologically acceptable carrier, and optionally at least one additional bioactive agent as described herein dissolved or dispersed in the composition as an active ingredient. In some embodiments, a therapeutic composition is substantially non-immunogenic when administered to a mammalian or human subject for therapeutic purposes, except where immunogenicity is desired.

[0352] Typically, the genetically modified therapeutic cells described herein are administered as a suspension comprising a pharma- ceutically acceptable carrier. One skilled in the art will understand that the pharma- ceutical acceptable carrier used in the cell composition does not contain an amount of buffers, compounds, cryopreservatives, preservatives or other agents that would substantially inhibit the viability of the cells delivered to the subject. The cell-containing formulation may, for example, comprise an osmotic buffer that maintains the integrity of the cell membrane, and may optionally comprise nutrients to maintain cell viability or enhance cell engraftment upon administration. Such formulations and suspensions are known to those skilled in the art and / or can be adapted for use with progenitor cells as described herein using routine experimentation.

[0353] In some embodiments, the cell compositions can be emulsified or provided as liposomal compositions, so long as the emulsification procedure does not adversely affect the viability of the cells. The cells and other active ingredients can be mixed with one or more additives that are pharma- ceutically acceptable and compatible with the active ingredients, in amounts suitable for use in the therapeutic methods described herein.

[0354] Additional agents contained in the cell composition include pharmaceutically acceptable salts of the components in the cell composition.Pharmaceutically acceptable salts include acid addition salts (formed with free amino groups of polypeptides) formed with inorganic acids such as hydrochloric acid and phosphoric acid, or organic acids such as acetic acid, tartaric acid, mandelic acid, etc. Also, salts formed with free carboxyl groups can be derived from inorganic bases such as sodium, potassium, ammonium, calcium, and iron hydroxides, and organic bases such as isopropylamine, trimethylamine, 2-ethylaminoethanol, histidine, and procaine.

[0355] Physiologically acceptable carriers are well known in the art. Exemplary liquid carriers are sterile aqueous solutions that contain no other material than the active ingredient and water, or sterile aqueous solutions that contain a buffer such as sodium phosphate or saline at a physiological pH value, or both (such as phosphate-buffered saline). Additionally, aqueous carriers can contain one or more buffer salts, salts such as sodium chloride or potassium chloride, dextrose, or polyethylene glycol, or other solutes. Liquid compositions can also contain other liquid phases in addition to water, or to the exclusion of water. Examples of such other liquid phases include glycerin, vegetable oils such as cottonseed oil, and water-oil emulsions. The amount of active compound used in a cell composition that is effective in treating a particular disorder or condition will vary depending on the characteristics of the disorder or condition, and can be determined by known clinical techniques.

[0356] Kits and Systems Kits and systems are provided that include the cells, expression vectors and protein sequences provided and described herein, and instructions for producing and using them.Thus, for example, kits are provided that include one or more of the protein sequences described herein, the expression vectors described herein, and / or the cells described herein.Also provided is a system for selectively activating a signal into rapamycin-resistant cells, comprising the cells described herein, the cells comprising the expression vectors described herein, and the expression vectors comprising nucleic acids encoding the protein sequences described herein.

[0357] Some embodiments provide kits that include one or more components of the CRISPR / Cas systems for genome editing described herein.

[0358] In some embodiments, the kit may have one or more additional therapeutic agents that can be administered simultaneously or sequentially with another composition in the kit for a desired purpose, such as, for example, genome editing or cell therapy.

[0359] In some embodiments, the kit may further include instructions for carrying out the method using each of the components of the kit. The instructions for carrying out the method are typically recorded on a suitable recording medium. For example, the instructions may be printed on a substrate such as paper or plastic. The instructions may be included in the kit as a package insert on the label of the container containing the kit or its components (e.g., a label affixed to the packaging or subpackaging). The instructions may also be included as an electronic storage data file on a suitable computer-readable storage medium (e.g., a CD-ROM, a diskette, a flash drive, etc.). In some cases, the actual instructions are not included in the kit, and a means for obtaining the instructions from a remote source (e.g., via the Internet) may be provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and / or downloaded. As with the instructions, the means for obtaining the instructions may be recorded on a suitable substrate.

[0360] The plural and / or singular terms used herein may be construed as singular and / or plural, as appropriate for the description and / or application of the present specification, by one of ordinary skill in the art. The various singular / plural terms have been intentionally used to provide clarity to the present invention.

[0361] Those of ordinary skill in the art will appreciate that the terms used herein, particularly in the appended claims (e.g., the body of the appended claims), are typically "open-ended" terms (e.g., the term "including" should be interpreted as "including, but not limited to," the term "having" should be interpreted as "having at least," and the term "include" should be interpreted as "including, but not limited to").

[0362] Any of the features of the embodiments described in the first to eleventh aspects are applicable to any of the aspects and embodiments described herein. Moreover, any of the features of the embodiments described in the first to eleventh aspects may be combined in any way, either in part or in whole, independently with other embodiments described herein, for example, in whole or in part with one, two, three or more embodiments. Moreover, any of the features of the embodiments described in the first to eleventh aspects may be employed as any feature in other aspects or embodiments. Although various features, aspects and functions have been described with respect to various exemplary embodiments and examples, the various features, aspects and functions described in each embodiment are not limited to their application in the specific embodiment described, and the various features, aspects and functions described in each embodiment may be used alone or in various combinations to apply to one or more of the other embodiments of the present application, regardless of whether a specific embodiment is described or whether a specific feature is presented as part of an embodiment of the present invention. Thus, the scope of the present invention is not limited by the exemplary embodiments described above.

[0363] The examples and embodiments described herein are for illustrative purposes only. Various modifications and changes to these examples and embodiments are suggested to those skilled in the art, and these modifications and changes are within the spirit and scope of this application and the scope of the appended claims. All publications, patents, and patent applications cited herein are incorporated herein by reference in their entirety for all purposes.

[0364] Certain embodiments of the disclosure provided herein are further illustrated by the following non-limiting examples. EXAMPLES

[0365] Unless otherwise indicated, the present invention is practiced using conventional techniques in molecular biology, microbiology, cell biology, biochemistry, nucleic acid chemistry and immunology that are well known to those of skill in the art. Such techniques may be practiced as described in Sambrook, J., & Russell, DW (2012).; Molecular Cloning: A Laboratory Manual (4 th ed.). Cold Spring Harbor, NY: Cold Spring Harbor Laboratory and Sambrook, J., & Russel, DW (2001).;Molecular Cloning: A Laboratory Manual (3 rd Cold Spring Harbor, NY: Cold Spring Harbor Laboratory (jointly referred to herein as "Sambrook"); Ausubel, FM (1987).Current Protocols in Molecular Biology New York, NY: Wiley (including supplements through 2014);Mullis, KB, Ferre, F. & Gibbs, R. (1994).PCR: The Polymerase Chain Reaction, Boston: Birkhauser Publisher; Harlow, E., & Lane, D. (1999).Antibodies: A Laboratory Manual (2 nded.). New York, NY: Cold Spring Harbor Laboratory Press; Beaucage, SL et al. (2000).Current Protocols in Nucleic Acid Chemistry, New York, NY: Wiley, (including supplements through 2014); and Makrides, SC (2003).Gene Transfer and Expression in Mammalian Cells Amsterdam, NL: Elsevier Sciences BV).

[0366] Example 1: Generation and characterization of DISC constructs This example describes the generation and testing of lentiviral constructs encoding CISC for intracellular expression of a naked "decoy" FRB domain in the cytoplasm of host cells.

[0367] The CISC-containing lentiviral construct for regulating IL-2 signaling was modified with an additional naked FRB* domain located at the 3'-side of the CISC chimeric receptor protein (Figure 1). The construct expressing the naked FRB* domain together with CISC was named "decoy-CISC" or "DISC". Without wishing to be bound by a particular theory, it is believed that the naked FRB domain competes with the endogenous FRB domain of mTOR for binding to rapamycin, resulting in rapamycin-mediated intracellular signaling via CISC without causing cytotoxicity to host cells associated with the action of rapamycin, thereby overcoming the problem of suppressing cell proliferation.

[0368] As shown in Figure 2, FKBP domain-containing proteins are naturally expressed in the cytoplasm of cells, and mTOR contains an FRB domain. In the absence of rapamycin, CISC subunits do not dimerize and intracellular mTOR signals normally (left panel). In the presence of rapamycin, CISC subunits dimerize and transmit intracellular signals, but mTOR signaling is suppressed and cell proliferation is restricted (middle panel). In DISC cells in which naked FRB domains are coexpressed, intracellular signals are also transmitted by rapamycin-induced dimerization, but many of the mTOR proteins can signal normally because the intracellularly expressed naked FRB polypeptides and endogenous FKBP polypeptides bind intracellular rapamycin.

[0369] Next, we tested how the novel DISC constructs functioned in maintaining host cell proliferation and viability compared to CISC constructs that do not express the naked intracellular FRB domain. Briefly, isolated CD4+ T cells were activated for 61 hours and the total number of isolated cells was 1.9 × 10 7The cells were then expanded to 100 cells / well. Lentiviral transduction was then performed in 24-well dishes in the absence of beads with 4 μg / ml protamine sulfate (1 million cells in 500 μL per well, 10 μl construct #1272 (CISC-only construct) or 10 μl DN-1272 (DISC-containing construct)) (2 wells / LV). Spinoculation was performed at 800×g for 30 min at 32°C. After 5 h of incubation, medium (1.5 mL) was added. Transduced T cells were incubated for 48 h at 37°C in the presence of cytokines (IL-2 50 ng / ml, IL-7 5 ng / ml and IL-15 5 ng / ml) to verify transduction efficiency. They were then seeded at a density of 1 million cells / well in 2 mL of medium in 24-well dishes. We then treated T cells with rapamycin (0.1 nM, 1 nM, or 10 nM), the rapalog AP21967 (100 nM), or IL-2 (50 ng / mL) and replaced the medium every 2 days. A "no treatment" group was also included in this experiment, which received medium only. We then assessed T cell viability and positive mCherry signal.

[0370] As shown in Figure 3, in the presence of rapamycin, DISC-expressing T cells expanded better than CISC-expressing T cells at all doses. This demonstrated that the DISC construct can mitigate the negative effects of rapamycin or rapamycin-related compounds on host cell proliferation and viability, providing a proof of concept for the DISC construct. Both the CISC and DISC constructs expanded equally well in the presence of the rapalog AP21967, as the rapalog does not bind to endogenous mTor.

[0371] Example 2: Modified CISC component of DISC In this example, we describe the creation of modified receptor proteins in the CISC component of the DISC construct. Computational protein modeling predicts that the spacing between the two receptor proteins in the CISC component of the DISC construct may not be optimal. Therefore, we created several additional constructs to test whether the length of a specific section of the chimeric receptor protein (e.g., the boundary between the extracellular domain and the transmembrane domain) can increase the growth signal.

[0372] Various amino acids were added to generate versions 4 to 7 (V4–V7) to determine whether they would improve T cell expansion in the presence of rapamycin. Four pairs of FRB-IL2Rβ / FKBP-IL2Rγ receptor proteins (V4–V7) were further generated. These V4–V7 contained one or more of the amino acid sequences of the PAAL spacer and / or the GGS linker or GGSP linker. The amino acid sequences of the additional spacer and linker were placed at the boundary between the extracellular FRB / FKBP domain and the IL2Rβ / IL2Rγ domain, or within the IL2Rβ domain (Figure 4). V3, the canonical DISC, has FRB, FKBP, IL2Rβ, and IL2Rγ. V4 has FRB, FKBP, IL2Rβ, and IL2Rγ, and has the PAAL spacer at the N-terminus of IL2Rβ. V5 has FRB, FKBP, IL2Rβ, IL2Rγ, a GGS linker and a PAAL spacer, with the linker and PAAL spacer located at the N-terminus of IL2Rβ. V6 has FRB, FKBP, IL2Rβ, IL2Rγ, a PAAL spacer and a GGSP linker, with the PAAL spacer located at the N-terminus of IL2Rβ and the GGSP linker located at the N-terminus of IL2Rγ. V7 has FRB, FKBP, IL2Rβ and IL2Rγ, with IL2Rβ having a GGS linker and a PAAL spacer, and IL2Rγ containing a GGSP linker.

[0373] After constructing the new DISC constructs (V4-V7), tests were performed to determine whether these DISC constructs improve cell proliferation and viability in the presence of rapamycin compared to the first DISC constructs described in Example 1. The timeline of procedures used to test these new DISC structures in primary human T cells is as follows: PBMC3 were thawed, followed approximately 24 hours later by CD4 cell isolation and stimulation with CD3 / CD28 beads. The beads were removed approximately 61 hours later. Spinoculation with lentivirus was performed at 800 x g in a total volume of 500 μL, and 1.5 mL of medium supplemented with cytokines was added. Transduced cells were divided into four treatment cohorts: (1) 1 nM rapamycin, (2) 50 ng / mL IL-2, (3) 100 nM AP21967, and (4) no treatment, and proliferation of transduced cells was monitored by co-expression of mCherry and total cell counting by flow cytometry after 2, 4, 11, 15, and 20 days.

[0374] The results of flow cytometry assays measuring T cell expansion 48 hours after treatment with rapamycin are shown in Table 1 below. The percentage of cells that co-expressed mCherry is shown, and the results indicate that the transduction efficiency of the constructs in each cohort was comparable. As shown in Table 1B below, all of the modified DISC constructs showed comp...

Claims

1. An in vitro or ex vivo method comprising contacting a mammalian cell with a viral vector comprising a nucleotide sequence encoding a naked FK506 binding protein-rapamycin binding (FRB) domain polypeptide, wherein the naked FRB domain polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence set forth in SEQ ID NO:

1.

2. The method of claim 1, wherein the naked FRB domain polypeptide consists of an amino acid sequence having at least 95% sequence identity to the amino acid sequence set forth in SEQ ID NO:

1.

3. The method of claim 1 , wherein the naked FRB domain polypeptide comprises the amino acid sequence set forth in SEQ ID NO:

1.

4. The method of claim 1, wherein the naked FRB domain polypeptide consists of the amino acid sequence set forth in SEQ ID NO:

1.

5. The method of claim 1 , wherein the naked FRB domain polypeptide comprises the amino acid sequence set forth in SEQ ID NO:

2.

6. The method of claim 1, wherein the naked FRB domain polypeptide consists of the amino acid sequence set forth in SEQ ID NO:

2.

7. The method of any one of claims 1 to 6, wherein the viral vector further comprises a promoter, the promoter being operably linked to the nucleotide sequence encoding the naked FRB domain polypeptide.

8. 8. The method of claim 7, wherein the viral vector is inserted into the genome of the mammalian cell such that the promoter is operably linked to the first exon of the FOXP3 gene in the genome of the mammalian cell.

9. The method of claim 7 or 8, wherein the promoter is a constitutive promoter.

10. The method according to any one of claims 7 to 9, wherein the promoter is an MND promoter.

11. the nucleotide sequence encodes a first chemical-induced signaling complex (CISC) component and / or a second CISC component; the first CISC component comprises a first extracellular binding domain, a first transmembrane domain, and a first cytoplasmic signaling domain; the second CISC component comprises a second extracellular binding domain, a second transmembrane domain, and a second cytoplasmic signaling domain; 11. The method of any one of claims 1 to 10, wherein the first CISC component and the second CISC component dimerize in the presence of rapamycin, a rapalog or a rapamycin metabolite to form a signaling-competent CISC.

12. 12. The method of claim 11, wherein the rapalog is everolimus, CCI-779, C20-methallylrapamycin, C16-(S)-3-methylindolerapamycin, C16-iRap, AP21967, mycophenolate sodium, benidipine hydrochloride, AP1903 or AP23573.

13. 13. The method of claim 11 or 12, wherein the first cytoplasmic signaling domain comprises an IL-2 receptor subunit gamma (IL2Rγ) cytoplasmic domain and the second cytoplasmic signaling domain comprises an IL-2 receptor subunit beta (IL2Rβ) cytoplasmic domain.

14. The method of any one of claims 11 to 13, wherein the first transmembrane domain comprises an IL2Rγ transmembrane domain and the second transmembrane domain comprises an IL2Rβ transmembrane domain.

15. The method of any one of claims 11 to 14, wherein the first extracellular binding domain comprises an FK506 binding protein (FKBP) domain and the second extracellular binding domain comprises an FRB domain.

16. the first CISC component comprises a first hinge domain and the second CISC component comprises a second hinge domain; the first hinge domain is located between the first extracellular binding domain and the first transmembrane domain; The method according to any one of claims 11 to 15, characterized in that the second hinge domain is located between the second extracellular binding domain and the second transmembrane domain.

17. The method of any one of claims 11 to 16, wherein the first CISC component comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence set forth in SEQ ID NO: 12, and / or the second CISC component comprises an amino acid sequence having at least 95% sequence identity with the amino acid sequence set forth in SEQ ID NO:

13.

18. The method according to any one of claims 1 to 17, wherein the viral vector is a lentiviral vector.

19. The method according to any one of claims 1 to 17, wherein the viral vector is an adeno-associated viral vector.

20. 20. The method of any one of claims 1 to 19, further comprising contacting the mammalian cell with (i) a DNA endonuclease or a nucleic acid encoding the DNA endonuclease and (ii) a guide RNA (gRNA) or a nucleic acid encoding the gRNA, the guide RNA comprising a spacer sequence complementary to a sequence in the genome of the mammalian cell.

21. The method of claim 20, wherein the DNA endonuclease or a nucleic acid encoding the DNA endonuclease and the gRNA or a nucleic acid encoding the gRNA are contained in a lipid nanoparticle.

22. 22. The method of any one of claims 1 to 21, further comprising contacting said mammalian cells with rapamycin.

23. A genetically modified mammalian cell prepared by the method of any one of claims 1 to 22.

24. 24. The genetically modified mammalian cell of claim 23, which is a T lymphocyte or a precursor T cell.

25. 25. The genetically modified mammalian cell of claim 23 or 24, which is a CD4+ T cell or a CD8+ T cell.

26. The genetically modified mammalian cell according to any one of claims 23 to 25, which is a regulatory T cell.

27. The genetically modified mammalian cell according to any one of claims 23 to 26, which is a FOXP3+ regulatory T cell.

28. 28. The genetically modified mammalian cell of any one of claims 23 to 27 for use in a method for treating or alleviating a disease or disorder in a subject in need thereof.

29. 29. The genetically modified mammalian cell for use according to claim 28, wherein the disease or disorder is an inflammatory disease, an autoimmune disease, a FOXP3-associated disease or condition, or a disorder resulting from organ transplantation.