Novel anti-hVEGFR2 antibodies

Abstract

Anti-hVEGFR2 antibodies or antigen-binding fragments thereof, isolated polynucleotides encoding same, pharmaceutical compositions comprising same, and uses thereof are provided.

Description

[Technical field]

[0001] FIELD OF THE DISCLOSURE

[0001] This disclosure relates generally to novel anti-hVEGFR2 antibodies that specifically bind to human VEGFR2 (hVEGFR2). [Background technology]

[0002] Vascular endothelial growth factor receptor 2 (VEGFR2) is a type III tyrosine kinase that can be stimulated by vascular endothelial growth factors (VEGFs) (e.g., VEGF-A, VEGF-C, and VEGF-D). Upon binding to VEGF-A, VEGFR2 increases its expression and becomes a dimerized form. Dimerization of VEGFR2 induces tyrosine phosphorylation of VEGFR2, which subsequently activates downstream pathways involved in proliferation, migration, differentiation, tube formation, maintaining vascular integrity, and increasing vascular permeability of endothelial cells. Abnormally high expression and / or activity of VEGFR2 disrupts the homeostasis of angiogenesis, resulting in various cancers and / or angiogenic diseases.

[0003]

[0003] Therefore, there is a serious need for novel anti-hVEGFR2 antibodies that can be used to treat diseases positive for hVEGFR2 expression, such as cancer as well as other angiogenic diseases. Summary of the Invention [Problem to be solved by the invention]

[0004]

[0004] Throughout this disclosure, the articles "a," "an," and "the" are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an antibody" means one antibody or more than one antibody.

[0005]

[0005] The present disclosure provides, inter alia, novel monoclonal anti-hVEGFR antibodies, nucleotide sequences encoding same, and uses thereof. [Means for solving the problem]

[0006] In one aspect, the disclosure provides an anti-hVEGFR antibody or antigen-binding fragment thereof, comprising a heavy chain HCDR1, HCDR2, and HCDR3, and / or a light chain LCDR1, LCDR2, and LCDR3 sequence, wherein: HCDR1 sequence comprises SSWMN (SEQ ID NO:1), DYYMS (SEQ ID NO:19), X1YGMS (SEQ ID NO:41), X4YWIM (SEQ ID NO:44), or a homologous sequence of at least 80% sequence identity thereof; The HCDR2 sequence is RIFPGDGDTYYNGKFQV (SEQ ID NO: 2), FIRNKANGYTTEYSASVKG (SEQ ID NO: 20), SISX2GGSYTYYADSVX 19 G (SEQ ID NO: 42), DIYPGX5GSTNYNEKFKS (SEQ ID NO: 45), or a homologous sequence of at least 80% sequence identity thereof; The HCDR3 sequence comprises FLDTSGRYVDY (SEQ ID NO:3), FDYYGSTYCFDY (SEQ ID NO:21), EX3DGNYDY (SEQ ID NO:43), DSNPDY (SEQ ID NO:46), or a homologous sequence of at least 80% sequence identity thereof; LCDR1 sequence includes KASQDVNTAVA (SEQ ID NO: 4), RASQSVSTSSSSFMH (SEQ ID NO: 22), RSSKSLLYKDGKTYLN (SEQ ID NO: 28), RASESVX6NSGISFMX7 (SEQ ID NO: 47), or a homologous sequence of at least 80% sequence identity thereof; The LCDR2 sequence comprises SASYRYI (SEQ ID NO:5), YASNLES (SEQ ID NO:23), LMSTRAS (SEQ ID NO:29), AASX8QX9S (SEQ ID NO:48), or a homologous sequence of at least 80% sequence identity thereof; LCDR3 sequences include QQHYRAPLT (SEQ ID NO:6), QHTWEIPLT (SEQ ID NO:24), QQLVEYPFT (SEQ ID NO:30), QQSKEVPYT (SEQ ID NO:49), or homologous sequences of at least 80% sequence identity thereof; where X1 is I or M, X2 is V or I, X3 is L or M, X4 is T or S, X5 is T or S, X6 is D or E, X7 is T or H, X8 is T or Y, X9 is G or R, and X 19 is E or K, Anti-hVEGFR antibodies or antigen-binding fragments thereof are provided.

[0007]

[0007] In one particular embodiment, HCDR1 comprises the amino acid sequence of SEQ ID NO: 41, HCDR2 comprises the amino acid sequence of SEQ ID NO: 42, HCDR3 comprises the amino acid sequence of SEQ ID NO: 43, LCDR1 comprises the sequence of SEQ ID NO: 28, LCDR2 comprises the sequence of SEQ ID NO: 29, and LCDR3 comprises the sequence of SEQ ID NO: 30.

[0008] In certain embodiments, the antibody or antigen-binding fragment thereof provided herein comprises: a) HCDR1 comprises the sequence of SEQ ID NO:25, HCDR2 comprises the sequence of SEQ ID NO:26 and HCDR3 comprises the sequence of SEQ ID NO:27; LCDR1 comprises the sequence of SEQ ID NO:28, LCDR2 comprises the sequence of SEQ ID NO:29 and LCDR3 comprises the sequence of SEQ ID NO:30; or b) HCDR1 comprises the sequence of SEQ ID NO: 31, HCDR2 comprises the sequence of SEQ ID NO: 32 or SEQ ID NO: 37, HCDR3 comprises the sequence of SEQ ID NO: 33, LCDR1 comprises the sequence of SEQ ID NO: 28, LCDR2 comprises the sequence of SEQ ID NO: 29 and LCDR3 comprises the sequence of SEQ ID NO: 30; or c) HCDR1 comprises the sequence of SEQ ID NO: 34, HCDR2 comprises the sequence of SEQ ID NO: 35 or SEQ ID NO: 37, HCDR3 comprises the sequence of SEQ ID NO: 36, LCDR1 comprises the sequence of SEQ ID NO: 28, LCDR2 comprises the sequence of SEQ ID NO: 29 and LCDR3 comprises the sequence of SEQ ID NO: 30.

[0009]

[0009] In certain embodiments, in the anti-hVEGFR antibody or antigen-binding fragment thereof provided herein, HCDR1 comprises the amino acid sequence of SEQ ID NO: 44, HCDR2 comprises the amino acid sequence of SEQ ID NO: 45, HCDR3 comprises the amino acid sequence of SEQ ID NO: 46, LCDR1 comprises the sequence of SEQ ID NO: 47, LCDR2 comprises the sequence of SEQ ID NO: 48, and LCDR3 comprises the sequence of SEQ ID NO: 49.

[0010] In certain embodiments, in the antibody or antigen-binding fragment thereof provided herein, a) HCDR1 comprises the sequence of SEQ ID NO:7, HCDR2 comprises the sequence of SEQ ID NO:8 and HCDR3 comprises the sequence of SEQ ID NO:9; LCDR1 comprises the sequence of SEQ ID NO:10, LCDR2 comprises the sequence of SEQ ID NO:11 and LCDR3 comprises the sequence of SEQ ID NO:12; or b) HCDR1 comprises the sequence of SEQ ID NO: 13, HCDR2 comprises the sequence of SEQ ID NO: 14, HCDR3 comprises the sequence of SEQ ID NO: 15, LCDR1 comprises the sequence of SEQ ID NO: 16, LCDR2 comprises the sequence of SEQ ID NO: 17 and LCDR3 comprises the sequence of SEQ ID NO: 18.

[0011] In certain embodiments, in the antibody or antigen-binding fragment thereof provided herein, a) HCDR1 comprises the sequence of SEQ ID NO:1, HCDR2 comprises the sequence of SEQ ID NO:2, HCDR3 comprises the sequence of SEQ ID NO:3, LCDR1 comprises the sequence of SEQ ID NO:4, LCDR2 comprises the sequence of SEQ ID NO:5 and LCDR3 comprises the sequence of SEQ ID NO:6; or b) HCDR1 comprises the sequence of SEQ ID NO: 19, HCDR2 comprises the sequence of SEQ ID NO: 20, HCDR3 comprises the sequence of SEQ ID NO: 21, LCDR1 comprises the sequence of SEQ ID NO: 22, LCDR2 comprises the sequence of SEQ ID NO: 23 and LCDR3 comprises the sequence of SEQ ID NO: 24.

[0012] In certain embodiments, the antibodies or antigen-binding fragments thereof provided herein further comprise one or more of heavy chains HFR1, HFR2, HFR3, and HFR4, and / or one or more of light chains LFR1, LFR2, LFR3, and LFR4, wherein: HFR1 is EVQLVESGGGLVKPGGSLX 10 LSCAASGFTFS (SEQ ID NO: 84), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; HFR2 is WVRQX 11 PGKRLEWVA (SEQ ID NO: 85), or a homologous sequence having at least 80% (or at least 90%) sequence identity thereto; The HFR3 sequence is RFTISRDNAKNTLYLQMNSLX. 12 AEDTAVYYCAR (SEQ ID NO: 86), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; HFR4 is WGX 13 GTTLTVSS (SEQ ID NO: 87) or a homologous sequence of at least 80% sequence identity thereto; LFR1 is DIVITQX 14 X 15 LSLPVTX 16 GESVSISC (SEQ ID NO: 88), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; LFR2 comprises WFLQRPGQSPQLLIY (SEQ ID NO: 89), or a homologous sequence thereof of at least 80% (or at least 85%, 90%) sequence identity; LFR3 is GVX 17 DRFSGGSGTDFTLKISRVEAEDVGX 18 YYC (SEQ ID NO: 90), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; LFR4 comprises FGSGTKLEIK (SEQ ID NO:91), or a homologous sequence thereof with at least 80% (or at least 90%) sequence identity; Where X 10 is R or K, and X 11 is A or T, and X 12 is R or K, and X 13 is Q or H, and X 14 is D or T, and X 15 is E or P, and X 16 is F or P, and X 17 is S or P, and X 18 is V or I.

[0013] In certain embodiments, in the antibody or antigen-binding fragment thereof provided herein, HFR1 comprises a sequence selected from the group consisting of SEQ ID NOs: 64, 68 and 72; HFR2 comprises a sequence selected from the group consisting of SEQ ID NOs: 65, 69 and 73; HFR3 comprises a sequence selected from the group consisting of SEQ ID NOs: 66, 70 and 74; HFR4 comprises a sequence selected from the group consisting of SEQ ID NOs: 67, 71 and 75; LFR1 comprises a sequence selected from the group consisting of SEQ ID NOs: 76 and 80; LFR2 comprises a sequence selected from the group consisting of SEQ ID NOs: 77 and 81; LFR3 comprises a sequence selected from the group consisting of SEQ ID NOs: 78 and 82; LFR4 comprises a sequence selected from the group consisting of SEQ ID NOs:79 and 83.

[0014]

[0014] In certain embodiments, in the antibody or antigen-binding fragment thereof provided herein, the heavy chain variable region comprises a sequence selected from the group consisting of SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:98, and homologous sequences thereof having at least 80% sequence identity while still retaining specific binding affinity to hVEGFR2.

[0015]

[0015] In certain embodiments, in the antibody or antigen-binding fragment thereof provided herein, the light chain variable region comprises a sequence selected from the group consisting of SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:96, SEQ ID NO:97, and homologous sequences thereof having at least 80% sequence identity while still retaining specific binding affinity to hVEGFR2.

[0016] In certain embodiments, in the antibody or antigen-binding fragment thereof provided herein, a) a heavy chain variable region comprising the sequence of SEQ ID NO: 50 and a light chain variable region comprising the sequence of SEQ ID NO: 51; b) the heavy chain variable region comprises the sequence of SEQ ID NO:52 and the light chain variable region comprises the sequence of SEQ ID NO:53; c) the heavy chain variable region comprises the sequence of SEQ ID NO:54 and the light chain variable region comprises the sequence of SEQ ID NO:55; d) the heavy chain variable region comprises the sequence of SEQ ID NO:56 and the light chain variable region comprises the sequence of SEQ ID NO:57; e) the heavy chain variable region comprises the sequence of SEQ ID NO:58 and the light chain variable region comprises the sequence of SEQ ID NO:59; f) the heavy chain variable region comprises the sequence of SEQ ID NO: 60 and the light chain variable region comprises the sequence of SEQ ID NO: 61; g) the heavy chain variable region comprises the sequence of SEQ ID NO: 62 and the light chain variable region comprises the sequence of SEQ ID NO: 63; or h) the heavy chain variable region comprises the sequence of SEQ ID NO:93 or SEQ ID NO:94 or SEQ ID NO:98 and the light chain variable region comprises the sequence of SEQ ID NO:96 or SEQ ID NO:97.

[0017]

[0017] In certain embodiments, the antibodies or antigen-binding fragments thereof provided herein further comprise one or more amino acid residue substitutions or modifications that still retain specific binding affinity to hVEGFR2.

[0018]

[0018] In certain embodiments, at least one of the substitutions or modifications is in one or more CDR sequences and / or in one or more non-CDR regions of the VH or VL sequences.

[0019]

[0019] In certain embodiments, the antibodies or antigen-binding fragments provided herein further comprise an immunoglobulin constant region, optionally a human Ig constant region, or optionally a human IgG constant region.

[0020]

[0020] In certain embodiments, the constant region comprises a human IgG1, IgG2, IgG3, or IgG4 constant region.

[0021]

[0021] In certain embodiments, the constant region of human IgG1 comprises SEQ ID NO: 38, or a homologous sequence having at least 80% sequence identity thereto.

[0022]

[0022] In certain embodiments, the antibodies or antigen-binding fragments thereof provided herein are humanized.

[0023]

[0023] In certain embodiments, the antibody or antigen-binding fragment thereof provided herein is a diabody, Fab, Fab', F(ab')2, Fd, Fv fragment, disulfide stabilized Fv fragment (dsFv), (dsFv)2, bispecific dsFv (dsFv-dsFv'), disulfide stabilized diabody (ds diabody), single chain antibody molecule (scFv), scFv dimer (bivalent diabody), multispecific antibody, camelized single domain antibody, nanobody, domain antibody, or bivalent domain antibody.

[0024]

[0024] In certain embodiments, the antibodies or antigen-binding fragments thereof provided herein are bispecific.

[0025]

[0025] In certain embodiments, the antibody or antigen-binding fragment provided herein is capable of specifically binding to a first and a second epitope of hVEGFR2, or is capable of specifically binding to hVEGFR2 and a second antigen.

[0026]

[0026] In certain embodiments, the second antigen is an immune-related target optionally selected from the group consisting of: PD-L1, PD-L2, PD-1, CLTA-4, TIM-3, LAG3, CD160, 2B4, TGF beta, VISTA, BTLA, TIGIT, LAIR1, OX40, CD2, CD27, ICAM-1, NKG2C, SLAMF7, NKp80, CD160, B7-H3, LFA-1, 1COS, 4-1BB, GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, IL-2, IL-15, CD3, CD16 and CD83.

[0027] In certain embodiments, the second antigen comprises a tumor antigen.

[0028]

[0028] In certain embodiments, the tumor antigen is present in a VEGFR2-expressing cell.

[0029]

[0029] In certain embodiments, the tumor antigen comprises claudin 18.2, CA-125, ganglioside G(D2), G(M2) and G(D3), CD20, CD52, CD33, Ep-CAM, CEA, bombesin-like peptide, PSA, HER2 / neu, epidermal growth factor receptor (EGFR), erbB2, erbB3 / HER3, erbB4, CD44v6, Ki-67, cancer-associated mucin, VEGF, VEGFR (e.g., VEGFR3), estrogen receptor, Lewis-Y antigen, TGFβ1, IGF-1 receptor, EGFα, c-Kit receptor, transferrin receptor, IL-2R or CO17-1A.

[0030]

[0030] In certain embodiments, the antibodies or antigen-binding fragments thereof provided herein are linked to one or more conjugate moieties.

[0031]

[0031] In certain embodiments, the conjugate moiety comprises a clearance modifying agent, a chemotherapeutic agent, a toxin, a radioisotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme substrate label, a DNA alkylating agent, a topoisomerase inhibitor, a tubulin binding agent, or other anti-cancer drug.

[0032]

[0032] In another aspect, the present disclosure also provides an antibody or antigen-binding fragment thereof that competes with the antibody or antigen-binding fragment thereof provided herein for binding to hVEGFR2.

[0033]

[0033] In one aspect, the present disclosure provides a pharmaceutical composition comprising an antibody or antigen-binding fragment thereof provided herein and one or more pharma ceutically acceptable carriers.

[0034]

[0034] In certain embodiments, the pharmaceutical compositions provided herein further comprise a second therapeutic agent.

[0035]

[0035] In certain embodiments, the second therapeutic agent comprises an anti-cancer therapy, and optionally the anti-cancer therapy is selected from a chemotherapy agent, radiation therapy, an immunotherapy agent, an anti-angiogenic agent (e.g., an antagonist of VEGFR such as VEGFR-1 and VEGFR-3), an EGFR antagonist, a PDGFR antagonist, an IGFR antagonist, an NGFR antagonist, an FGFR antagonist, a targeted therapy (e.g., a HER2 antibody, a claudin 18.2 antibody), a cell therapy agent, a gene therapy agent, a hormonal therapy agent, a cytokine, palliative care, surgery for the treatment of cancer (e.g., a tumor removal surgery), one or more antiemetic agents, treatment of complications resulting from chemotherapy, or a dietary supplement for cancer patients (e.g., indole-3-carbinol).

[0036]

[0036] In one aspect, the present disclosure provides an isolated polynucleotide encoding an antibody or antigen-binding fragment thereof provided herein.

[0037]

[0037] In one aspect, the disclosure provides a vector comprising an isolated polynucleotide provided herein.

[0038]

[0038] In one aspect, the present disclosure provides a host cell comprising a vector provided herein.

[0039]

[0039] In one aspect, the present disclosure provides a method for expressing an antibody or antigen-binding fragment thereof provided herein, comprising culturing a host cell provided herein under conditions in which a vector provided herein is expressed.

[0040]

[0040] In one aspect, the present disclosure provides a method of treating, reducing the severity of, and / or delaying the progression of a VEGFR2-related disease or condition in a subject, comprising administering to the subject a therapeutically effective amount of an antibody or antigen-binding fragment thereof provided herein, or a pharmaceutical composition provided herein.

[0041] In certain embodiments, the VEGFR2-associated disease or condition is a tumor or angiogenic disease.

[0042]

[0042] In certain embodiments, the tumor produces VEGF (eg, VEGF-A) and / or is sensitive to VEGF (eg, VEGF-A) present in its microenvironment.

[0043]

[0043] In certain embodiments, the tumor is a solid tumor or a non-solid tumor.

[0044] In certain embodiments, the solid tumor is selected from the group consisting of breast cancer, lung cancer, colorectal cancer, pancreatic cancer, glioma and lymphoma, head and neck tumors, neuroendocrine tumors, colorectal tumors, prostate tumors, breast tumors, lung tumors such as small cell lung tumors and non-small cell lung tumors, pancreatic tumors, thyroid tumors, ovarian tumors, cervical tumors, kidney tumors, brain tumors, liver tumors, Kaposi's sarcoma, CNS neoplasms, neuroblastoma, capillary hemangioblastoma, meningioma, brain metastases, melanoma, gastrointestinal and renal carcinomas and sarcomas (e.g., gastric cancer), rhabdomyosarcoma, glioblastoma, preferably glioblastoma multiforme, leiomyosarcoma, squamous cell carcinoma, basal cell carcinoma, and skin cancers that can be treated by inhibiting the proliferation of malignant keratinocytes, such as human malignant keratinocytes.

[0045]

[0045] In certain embodiments, the tumor is selected from the group consisting of gastric cancer, non-small cell lung cancer, such as large cell lung cancer.

[0046]

[0046] In certain embodiments, the non-solid tumor is selected from the group consisting of leukemia, multiple myeloma and lymphoma, e.g., acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), erythrocytic or monocytic leukemia, Hodgkin's lymphoma and non-Hodgkin's lymphoma.

[0047]

[0047] In certain embodiments, the angiogenic disease is selected from the group consisting of atherosclerosis, rheumatoid arthritis (RA), neovascular glaucoma, proliferative retinopathies including proliferative diabetic retinopathy, macular degeneration, hemangiomas, angiofibromas, psoriasis, retinopathy of prematurity (e.g., retrolental fibroplasia), corneal graft rejection, insulin-dependent diabetes mellitus, multiple sclerosis, myasthenia gravis, Crohn's disease, autoimmune nephritis, primary biliary cirrhosis, acute pancreatitis, allograft rejection, allergic inflammation, contact dermatitis and delayed hypersensitivity reactions, inflammatory bowel disease, septic shock, osteoporosis, osteoarthritis, cognitive impairment caused by neuroinflammation, Osler-Weber syndrome, restenosis, and fungal, parasitic and viral infections such as cytomegalovirus infection.

[0048]

[0048] In certain embodiments, the subject is a human.

[0049]

[0049] In certain embodiments, administration is via oral, nasal, intravenous, subcutaneous, sublingual, intratumoral, or intramuscular administration.

[0050]

[0050] In certain embodiments, the methods provided herein further comprise the step of administering a therapeutically effective amount of a second therapeutic agent.

[0051]

[0051] In certain embodiments, the second therapeutic agent comprises an anti-cancer therapy, and optionally the anti-cancer therapy is selected from a chemotherapy agent, radiation therapy, an immunotherapy agent, an anti-angiogenic agent (e.g., an antagonist of VEGFR such as VEGFR-1, VEGFR-2, and VEGFR-3), an EGFR antagonist, a PDGFR antagonist, an IGFR antagonist, an NGFR antagonist, an FGFR antagonist, a targeted therapy agent, a cell therapy agent, a gene therapy agent, a hormonal therapy agent, a cytokine, palliative care, surgery for the treatment of cancer (e.g., tumor removal), one or more antiemetic agents, treatment of complications resulting from chemotherapy, or a dietary supplement for cancer patients (e.g., indole-3-carbinol).

[0052]

[0052] In one aspect, the present disclosure provides a kit comprising an antibody or antigen-binding fragment thereof provided herein.

[0053]

[0053] In one aspect, the present disclosure provides a method for detecting the presence or amount of VEGFR2 in a sample, comprising the steps of contacting the sample with an antibody or antigen-binding fragment thereof provided herein and determining the presence or amount of VEGFR2 in the sample.

[0054]

[0054] In one aspect, the present disclosure provides the use of an antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating, reducing the severity of, and / or delaying the progression of a VEGFR2-related disease or condition in a subject.

[0055]

[0055] In certain embodiments, the VEGFR2-related disease or condition is a tumor or angiogenic disease.

[0056]

[0056] In certain embodiments, the tumor produces VEGF (eg, VEGF-A) and / or is sensitive to VEGF (eg, VEGF-A) present in its microenvironment.

[0057]

[0057] In certain embodiments, the tumor is a solid tumor or a non-solid tumor.

[0058]

[0058] In certain embodiments, the angiogenic disease is selected from the group consisting of atherosclerosis, rheumatoid arthritis (RA), neovascular glaucoma, proliferative retinopathies including proliferative diabetic retinopathy, macular degeneration, hemangiomas, angiofibromas, psoriasis, retinopathy of prematurity (e.g., retrolental fibroplasia), corneal graft rejection, insulin-dependent diabetes mellitus, multiple sclerosis, myasthenia gravis, Crohn's disease, autoimmune nephritis, primary biliary cirrhosis, acute pancreatitis, allograft rejection, allergic inflammation, contact dermatitis and delayed hypersensitivity reactions, inflammatory bowel disease, septic shock, osteoporosis, osteoarthritis, cognitive impairment caused by neuroinflammation, Osler-Weber syndrome, restenosis, and fungal, parasitic and viral infections such as cytomegalovirus infection. [Brief description of the drawings]

[0059] [Figure 1]

[0059] Figures 1A and 1B show the dose-dependent binding of purified hybridoma antibodies #002, #003, #006, #018, #042, #048, and #054 to human VEGFR2 (hVEGFR2). [Diagram 2]

[0060] FIG. 2 shows the dose-dependent blocking activity of purified hybridoma antibodies against human VEGF-A (hVEGF-A) binding to hVEGFR2. [Diagram 3]

[0061] FIG. 3 shows the binding of hybridoma antibodies to HUVEC cells. [Figure 4]

[0062] Figures 4A and 4B show chimeric antibodies that bind to hVEGFR2 and rhesus VEGFR2. [Diagram 5]

[0063] FIG. 5 shows that the chimeric antibodies blocked the VEGF-A / VEGFR2 interaction. [Figure 6]

[0064] FIG. 6 shows the binding of chimeric antibodies to HUVEC cells. [Figure 7]

[0065] 7A and 7B show epitope binning using biotin-mAB002 by competitive assay. [Figure 8]

[0066] 8A, 8B and 8C show the results of a dose-dependent competition assay. [Figure 9]

[0067] Figures 9A, 9B and 9C show that the chimeric antibodies inhibit VEGF-A-induced phosphorylation of VEGFR2. [Figure 10]

[0068] FIG. 10A and FIG. 10B show humanized antibodies produced in 293T cells that bind to human VEGFR2-his by ELISA. [Figure 11]

[0069] FIG. 11A and FIG. 11B show humanized antibodies produced in CHO cells that bind to human VEGFR2-his and rhesus VEGFR2-his by ELISA. [Figure 12]

[0070] FIG. 12 shows a humanized antibody that specifically binds to VEGFR2. [Figure 13-1]

[0071] FIG. 13A and FIG. 13B show humanized antibodies that block binding of VEGF-A to human VEGFR2 or rhesus VEGFR2. [Figure 13-2]

[0071] Figures 13A and 13B show humanized antibodies that block binding of VEGF-A to human VEGFR2 or rhesus VEGFR2. [Figure 14-1]

[0072] Figure 14A, Figure 14B and Figure 14C show humanized antibodies that block binding of VEGF-A, C or D to VEGFR2. [Figure 14-2]

[0072] Figures 14A, 14B and 14C show humanized antibodies that block binding of VEGF-A, C or D to VEGFR2. [Figure 15]

[0073] FIG. 15 shows the binding of humanized antibodies to HUVEC cells. [Figure 16]

[0074] FIG. 16 shows that humanized antibody 054 inhibits VEGF-A-induced VEGFR2 phosphorylation. [Figure 17]

[0075] 1 shows a humanized antibody that blocks VEGF-A mediated cell proliferation. [Figure 18]

[0076] FIG. 18 shows survival curves of HL-60 engraftment in NOD / SCID mice treated with benchmark antibody 1121B, chimera 054 (54-C), chimera 002 (2-C) or saline. [Figure 19]

[0077] FIG. 19 shows ELISA binding of chimeric-DC101 to mouse VEGFR2. [Figure 20]

[0078] FIG. 20 shows blocking of binding of mouse VEGFR2 to human VEGF165 (a splice variant of VEGF-A) by chimeric-DC101. [Figure 21]

[0079] FIG. 21 shows tumor growth curves (mean±SEM, n=10) of MKN45 xenograft tumors in nude mice. [Figure 22]

[0080] FIG. 22 shows tumor growth curves (mean±SEM, n=10) of H460 xenograft tumors in nude mice. [Figure 23]

[0081] FIG. 23 shows tumor growth curves (mean±SEM, n=10) of H1975 xenograft tumors in nude mice. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0060]

[0082] The following description of the present disclosure is intended to merely illustrate various embodiments of the present disclosure. As such, the specific modifications discussed should not be interpreted as limitations on the scope of the present disclosure. It is clear to those skilled in the art that various equivalents, variations and modifications can be made without departing from the scope of the present disclosure, and it is understood that such equivalent embodiments should be included in this specification. All references cited in this specification, including publications, patents and patent applications, are incorporated herein by reference in their entirety.

[0061] definition

[0083] As used herein, the terms "a," "an," "the," and similar terms as used in the context of the present invention (particularly in the context of the claims) are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context.

[0062]

[0084] The term "antibody" as used herein includes any immunoglobulin, monoclonal, polyclonal, multivalent, bivalent, monovalent, multispecific, or bispecific antibody that binds to a specific antigen. A naturally occurring intact antibody contains two heavy (H) chains and two light (L) chains. Mammalian heavy chains are classified as alpha, delta, epsilon, gamma, and mu, and each heavy chain contains a variable region (V H ) and the first, second, and third constant regions (C H1 , C H2 , C H3 Mammalian light chains are classified as λ or κ, and each light chain is composed of a variable region (V L) and constant regions. Antibodies have the shape of a "Y" with the stem of the Y being composed of the second and third constant regions of two heavy chains bound together via disulfide bonds. Each arm of the Y contains the variable region and first constant region of a single heavy chain bound to the variable region and constant region of a single light chain. The variable regions of the light and heavy chains are responsible for antigen binding. The variable regions of both chains generally contain three highly variable loops called complementarity determining regions (CDRs) (light chain CDRs including LCDR1, LCDR2, and LCDR3, heavy chain CDRs including HCDR1, HCDR2, HCDR3). The boundaries of the CDRs of the antibodies and antigen binding domains disclosed herein may be determined according to the Kabat, IMGT, AbM, Chothia, or Al-Lazikani convention (Al-Lazikani, B., Chothia, C., Lesk, A.M., J. Mol. Biol., 273(4), 927 (1997); Chothia, C. et al., J. Mol. Biol. Dec. 5, 186(3):651-63 (1985); Chothia, C. and Lesk, A.M., J. Mol. Biol., 196, 901 (1987); N.R. Whitelegg et al., Protein. Engineering, vol. 13(12), pp. 819-824 (2000); Chothia, C. et al., Nature. Dec. 21-28; 342(6252):877-83 (1989); Kabat EA et al., National Institutes of Health, Bethesda, Md. (1991); Marie-Paule Lefranc et al., Developmental and Comparative Immunology, 27:55-77 (2003); Marie-Paule Lefranc et al., Immunome Research, 1(3), (2005); Marie-Paule Lefranc, Molecular Biology of B cells (2nd ed.), Chapter 26, pp. 481-514, (2015)). The three CDRs are interposed between adjacent stretches known as framework regions (FRs), which are more highly conserved than the CDRs and form a scaffold supporting the hypervariable loops.The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chains. The five main classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of alpha, delta, epsilon, gamma, and mu heavy chains, respectively. Some of the main antibody classes are divided into subclasses, such as IgG1 (gamma 1 heavy chain), IgG2 (gamma 2 heavy chain), IgG3 (gamma 3 heavy chain), IgG4 (gamma 4 heavy chain), IgA1 (alpha 1 heavy chain), or IgA2 (alpha 2 heavy chain). In certain embodiments, the antibodies provided herein include any antigen-binding fragment thereof.

[0063]

[0085] As used herein, the term "antigen-binding fragment" refers to an antibody fragment formed from a fragment of an antibody that contains one or more CDRs, or any other antibody portion that binds to an antigen but does not contain an intact native antibody structure. Examples of antigen-binding fragments include, but are not limited to, diabodies, Fab, Fab', F(ab')2, Fd, Fv fragments, disulfide-stabilized Fv fragments (dsFv), (dsFv)2, bispecific dsFv (dsFv-dsFv'), disulfide-stabilized diabodies (ds diabodies), single-chain antibody molecules (scFv), scFv dimers (bivalent diabodies), multispecific antibodies, camelized single-chain domain antibodies, nanobodies, domain antibodies, and bivalent domain antibodies. Antigen-binding fragments can bind to the same antigen that the parent antibody binds. In certain embodiments, antigen-binding fragments can include one or more CDRs from a particular human antibody.

[0064]

[0086] "Fab" with respect to an antibody refers to a monovalent antigen-binding fragment of an antibody that is composed of a single light chain (both variable and constant regions) linked by disulfide bonds to the variable region and first constant region of a single heavy chain. Fabs can be obtained by papain digestion of an antibody at residues in the hinge region proximal to the N-terminus of the disulfide bond between the heavy chains.

[0065]

[0087] "Fab'" refers to a Fab fragment containing a portion of the hinge region, which may be obtained by pepsin digestion of an antibody at the residues proximal to the C-terminus of the inter-heavy chain disulfide bond in the hinge region, and which therefore differs from Fab in a small number of residues in the hinge region, including one or more cysteines.

[0066]

[0088] "F(ab')2" refers to a dimer of Fab' containing two light chains and part of two heavy chains.

[0067]

[0089] "Fc" with respect to an antibody refers to the portion of the antibody that consists of the second and third constant regions of a first heavy chain bound to the second and third constant regions of a second heavy chain via disulfide bonds. The Fc region of IgG and IgM contains three heavy chain constant regions (the second, third and fourth heavy chain constant regions in each chain). It can be obtained by papain digestion of the antibody. The Fc portion of an antibody is responsible for various effector functions such as ADCC, ADCP and CDC, but does not function in antigen binding.

[0068]

[0090] "Fv" with respect to an antibody refers to the smallest fragment of an antibody that retains a complete antigen-binding site. An Fv fragment is composed of the variable region of a single light chain bound to the variable region of a single heavy chain. "dsFv" refers to a disulfide-stabilized Fv fragment, in which the link between the variable region of a single light chain and the variable region of a single heavy chain is a disulfide bond.

[0069]

[0091] "Single chain Fv antibody" or "scFv" refers to an engineered antibody composed of a light chain variable region and a heavy chain variable region connected to each other directly or via a peptide linker sequence (Huston JS et al. Proc Natl Acad Sci USA, 85:5879 (1988)). "scFv dimer" refers to a single chain containing two heavy chain variable regions and two light chain variable regions with a linker. In certain embodiments, an "scFv dimer" is a bivalent diabody or a bivalent ScFv (BsFv), which is a V H A part of VL and to form two binding sites that can target the same antigen (or epitope) or different antigens (or epitopes). H -V L The V dimerized with the moiety H -V L (linked by a peptide linker). In another embodiment, an "scFv dimer" is a bispecific diabody, which comprises H1 and V L1 V H2 and V L2 V is arranged so that they cooperate and each cooperated pair has a different antigen specificity. L1 -V H2 (linked by a peptide linker) H1 -V L2 (also linked by a peptide linker).

[0070]

[0092] "Single chain Fv-Fc antibody" or "scFv-Fc" refers to an engineered antibody composed of an scFv attached to the Fc region of an antibody.

[0071]

[0093] "Camelized single domain antibodies", "heavy chain antibodies", "nanobodies" or "HCAbs" are antibodies that consist of two V HIt refers to antibodies that contain heavy chain domains and do not contain light chains (Riechmann L. and Muyldermans S., J Immunol Methods. Dec. 10; 231(1-2):25-38 (1999); Muyldermans S., J Biotechnol. Jun. 74(4):277-302 (2001); WO94 / 04678; WO94 / 25591; U.S. Patent No. 6,005,079). Heavy chain antibodies were originally obtained from the Camelidae family (camels, dromedaries and llamas). Although lacking light chains, camelized antibodies have a robust antigen-binding repertoire (Hamers-Casterman C. et al., Nature. June 3;363(6428):446-8 (1993); Nguyen VK. et al. "Heavy chain antibodies in Camelidae; a case of evolutionary innovation", Immunogenetics. April;54(1):39-47 (2002); Nguyen VK. et al. Immunology. May;109(1):93-101 (2003)). The variable domain of heavy chain antibodies (VHH domains) represents the smallest known antigen-binding unit generated by the adaptive immune response (Koch-Nolte F. et al., FASEB J. November;21(13):3490-8. Epub 2007 June 15 (2007)). "Diabodies" include small antibody fragments with two antigen-binding sites, where the fragments are arranged in a single polypeptide chain. L V connected to the domain H Domain (V H -V L or V L -V H) (see, e.g., Holliger P. et al., Proc Natl Acad Sci USA. July 15; 90(14):6444-8 (1993); EP404097; WO93 / 11161). The two domains on the same chain cannot pair because the linker is too short, so they are forced to pair with complementary domains on another chain, thereby creating two antigen-binding sites. The two antigen-binding sites can target the same or different antigens (or epitopes).

[0072]

[0094] A "domain antibody" refers to an antibody fragment that contains only the variable region of a heavy chain or only the variable region of a light chain. In certain embodiments, two or more V H The domains are covalently linked with a peptide linker to form a bivalent or multivalent domain antibody. H The domains can target the same or different antigens.

[0073]

[0095] In certain embodiments, a "(dsFv)2" is a Fv comprising three peptide chains: a Fv comprising two V L Two V's joined together H Includes parts.

[0074]

[0096] In certain embodiments, a "bispecific ds diabody" is H1 and V L1 Through a disulfide bridge between V L1 -V H2 V bound to (linked by a peptide linker) H1 -V L2 (also linked by a peptide linker).

[0075]

[0097] In certain embodiments, a "bispecific dsFv" or "dsFv-dsFv'" comprises three peptide chains: H1 -V H2The two heavy chains are linked by a peptide linker (e.g., a long flexible linker) and are connected via disulfide bridges to each other by V L1 Part and V L2 Partially paired, V H1 -V H2 Each disulfide-paired heavy and light chain has a different antigen specificity.

[0076]

[0098] The term "humanized" as used herein means that the antibody or antigen-binding fragment comprises CDRs derived from a non-human animal, FR regions derived from a human, and, if applicable, constant regions derived from a human. In certain embodiments, the amino acid residues of the variable region framework of the humanized hVEGFR2 antibody are replaced for sequence optimization. In certain embodiments, the variable region framework sequences of the humanized hVEGFR2 antibody chains are at least 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% identical to the corresponding human variable region framework sequences.

[0077]

[0099] As used herein, the term "chimeric" refers to an antibody or antigen-binding fragment having a portion of the heavy and / or light chain derived from one species and the remaining portion of the heavy and / or light chain derived from a different species. In an illustrative example, a chimeric antibody can include a constant region derived from a human and a variable region derived from a non-human species, such as a mouse.

[0078]

[0100] The term "germline sequence" refers to a nucleic acid sequence encoding a variable region amino acid sequence or subsequence that shares the highest determined amino acid sequence identity with a reference variable region amino acid sequence or subsequence in comparison with all other known variable region amino acid sequences encoded by germline immunoglobulin variable region sequences. A germline sequence can also refer to a variable region amino acid sequence or subsequence that has the highest amino acid sequence identity with a reference variable region amino acid sequence or subsequence in comparison with all other evaluated variable region amino acid sequences. A germline sequence may be framework regions only, complementarity determining regions only, framework and complementarity determining regions, variable segments (as defined above), or other combinations of sequences or subsequences that include variable regions. Sequence identity can be determined by aligning the two sequences using the methods described herein, for example, BLAST, ALIGN, or another alignment algorithm known in the art. A germline nucleic acid or amino acid sequence can have at least about 90%, 91, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a reference variable region nucleic acid or amino acid sequence. Germline sequences can be determined, for example, through the publicly available international ImMunoGeneTics database (IMGT) and V-base.

[0079]

[0101] As used herein, "anti-hVEGFR2 antibody" or "antibody to hVEGFR2" refers to an antibody that can specifically bind to human VEGFR2 with sufficient affinity to provide, e.g., for diagnostic and / or therapeutic uses.

[0080]

[0102] The term "affinity" as used herein refers to the strength of the non-covalent interactions between an immunoglobulin molecule (i.e., an antibody) or fragment thereof and an antigen.

[0081]

[0103] As used herein, the terms "specific binding" or "specifically bind" refer to a non-random binding reaction between two molecules, such as between an antibody and an antigen. In certain embodiments, the antibodies or antigen-binding fragments provided herein have a specific binding affinity of ≦10 -6 M (e.g., ≦5×10 -7 M, ≤2×10 -7 M, ≦10 -7 M, ≤5×10 -8 M, ≤2×10 -8 M, ≦10 -8 M, ≤5×10 -9 M, ≤4×10 -9 M, ≤3×10 -9 M,≦2×10 -9 M, or ≤ 10 -9 Binding affinity (K D ) specifically binds to hVEGFR2. D is the ratio of the dissociation rate to the association rate (k off / k on ), which may be determined by using any conventional method known in the art, including, but not limited to, surface plasmon resonance, microscale thermophoresis, HPLC-MS, and flow cytometry (e.g., FACS). In certain embodiments, K D Values ​​may be suitably determined by using flow cytometry techniques. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select antibodies specifically immunoreactive with a protein (see, e.g., Harlow & Lane, Using Antibodies, A Laboratory Manual (1998), for a description of immunoassay formats and conditions that may be used to determine specific immunoreactivity). Usually, a specific or selective binding reaction will produce a signal that is at least 2-fold over background, more usually at least 10-100-fold over background.

[0082]

[0104] "Percent (%) sequence identity" with respect to an amino acid sequence (or nucleic acid sequence) is defined as the percentage of amino acid (or nucleic acid) residues in a candidate sequence that are identical with the amino acid (or nucleic acid) residues in a reference sequence after aligning the sequences and introducing gaps, if necessary, to obtain maximum correspondence. Alignment for purposes of determining percent amino acid (or nucleic acid) sequence identity can be performed using publicly available tools such as, for example, BLASTN, BLASTp (available at the US National Center for Biotechnology Information (NCBI) website, see also Altschul SF et al., J. Mol. Biol., 215:403-410 (1990); Stephen F. et al., Nucleic Acids Res., 25:3389-3402 (1997)), ClustalW2 (available at the European Bioinformatics Institute website, see also Higgins DG et al., Methods in Enzymology, 266:383-402 (1996); Larkin MA et al., Bioinformatics (Oxford, England), 23(21):2947-8 (2007)), and ALIGN or Megalign (DNASTAR) software. Those skilled in the art may use the default parameters provided by the tool, or may customize the parameters, such as by selecting an appropriate algorithm, as necessary for alignment. In certain embodiments, non-identical residue positions may differ by conservative amino acid substitutions. A "conservative amino acid substitution" is a substitution in which an amino acid residue is replaced by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, conservative amino acid substitutions do not substantially change the functional properties of a protein. When two or more amino acid sequences differ from each other by conservative substitutions, the percentage or degree of similarity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those skilled in the art.See, for example, Pearson (1994) Methods Mol. Biol. 24:307-331, incorporated herein by reference.

[0083]

[0105] As used herein, "homolog sequence" and "homologous sequence" are used interchangeably and refer to a polynucleotide sequence (or its complementary strand) or amino acid sequence that has at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to another sequence, optionally when aligned.

[0084]

[0106] An "isolated" material is one that has been altered by the hand of man from its natural state. An "isolated" composition or material, when present in nature, has been changed or removed from its original environment, or both. For example, a polynucleotide or polypeptide that naturally occurs in a living animal is not "isolated", but is "isolated" when the same polynucleotide or polypeptide is sufficiently separated from the coexisting materials of its natural state so that it exists in a substantially pure state. Isolated "nucleic acid" or "polynucleotide" are used interchangeably and refer to the sequence of an isolated nucleic acid molecule. In certain embodiments, an "isolated antibody or antigen-binding fragment thereof" refers to an antibody or antigen-binding fragment having a purity of at least 60%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% as determined by electrophoretic (e.g., SDS-PAGE, isoelectric focusing, capillary electrophoresis) or chromatographic (e.g., ion exchange chromatography or reverse phase HPLC) methods.

[0085]

[0107] As used herein, the ability to "block binding" refers to the ability of an antibody or antigen-binding fragment to inhibit the binding interaction between two molecules (e.g., VEGR-A and hVEGFR2) to any detectable extent. In certain embodiments, an antibody or antigen-binding fragment that blocks binding between two molecules (e.g., VEGR-A and hVEGFR2) inhibits the binding interaction between the two molecules by at least 50%. In certain embodiments, this inhibition may be greater than 60%, greater than 70%, greater than 80%, or greater than 90%.

[0086]

[0108] The term "antibody drug conjugate" as used herein refers to the linkage of an antibody or antigen-binding fragment thereof with another agent, such as a chemotherapeutic agent, a toxin, an immunotherapeutic agent, an imaging probe, etc. The linkage may be a covalent bond or a non-covalent interaction, such as by electrostatic forces. A variety of linkers known in the art may be used to form an antibody drug conjugate. In addition, an antibody drug conjugate may be provided in the form of a fusion protein that can be expressed from a polynucleotide encoding the conjugate. As used herein, a "fusion protein" refers to a protein created through the joining of two or more genes or gene fragments that originally code for separate proteins (including peptides and polypeptides). Translation of the fusion gene results in a single protein with functional properties derived from each of the original proteins.

[0087]

[0109] The term "subject" includes humans and non-human animals. Non-human animals include all vertebrates, such as mammals and non-mammals, such as non-human primates, mice, rats, cats, rabbits, sheep, dogs, cows, chickens, amphibians, and reptiles. Except where noted, the terms "patient" and "subject" are used interchangeably herein.

[0088]

[0110] As used herein, "effector function" or "antibody effector function" refers to the biological activity resulting from the binding of the Fc region of an antibody to an effector, for example, the binding of the Fc region of an antibody to the C1 complex and Fc receptor. Exemplary effector functions include: complement-dependent cytotoxicity (CDC), which is induced by the interaction of an antibody with C1q on the C1 complex; antibody-dependent cell-mediated cytotoxicity (ADCC), which is induced by the binding of the Fc region of an antibody to the Fc receptor on an effector cell; and antibody-dependent cellular phagocytosis (ADCP), in which non-specific cytotoxic cells expressing FcγR recognize the bound antibody on a target cell and subsequently cause the phagocytosis of the target cell. Effector functions include both those that act after the binding of an antigen and those that act independently of antigen binding.

[0089]

[0111] As used herein, "treating" or "treatment" of a condition includes preventing or alleviating the condition, slowing the rate of onset or occurrence of the condition, reducing the risk of developing the condition, preventing or delaying the onset of symptoms associated with the condition, reducing or terminating symptoms associated with the condition, causing complete or partial regression of the condition, curing the condition, or some combination thereof.

[0090]

[0112] The term "vector" as used herein refers to a vehicle into which a genetic element can be operably inserted to cause expression of the genetic element, for example, to produce a protein, RNA, or DNA encoded by the genetic element, or to replicate the genetic element. A vector can be used to transform, transduce, or transfect a host cell to cause expression of the genetic element carried by the vector in the host cell. Examples of vectors include plasmids, phagemids, cosmids, artificial chromosomes such as yeast artificial chromosomes (YACs), bacterial artificial chromosomes (BACs), or P1-derived artificial chromosomes (PACs), bacteriophages such as lambda phage or M13 phage, and animal viruses. A vector can contain various elements for controlling expression, including promoter sequences, transcription initiation sequences, enhancer sequences, selectable elements, and reporter genes. In addition, a vector can contain an origin of replication. A vector can also contain substances that aid in the entry of the vector into a cell, including, but not limited to, viral particles, liposomes, or protein coatings. The vector may be an expression vector or a cloning vector. The present disclosure provides a vector (e.g., an expression vector) containing a nucleic acid sequence provided herein encoding an antibody or antigen-binding fragment thereof, at least one promoter (e.g., SV40, CMV, EF-1α) operably linked to the nucleic acid sequence, and at least one selectable marker.

[0091]

[0113] As used herein, a "host cell" refers to a cell into which an exogenous polynucleotide and / or vector has been introduced.

[0092]

[0114] GYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV)

[0115] As used herein, an "hVEGFR2-associated" disease or condition refers to any disease or condition caused by, exacerbated by, or otherwise related to increased or decreased expression or activity of hVEGFR2. In some embodiments, the hVEGFR2-associated condition is, for example, a cancer or an angiogenic disease.

[0093]

[0116] "VEGF-A," used interchangeably with the term "vascular endothelial growth factor A," refers to a highly conserved dimeric glycoprotein or its transcriptional splice variants, such as VEGFA206, VEGFA189, VEGFA165, and VEGFA121, which contain 206, 189, 165, and 121 amino acids, respectively. VEGF-A is a member of the VEGF family, which also includes other members such as VEGF-B, VEGF-C, and VEGF-D.

[0094]

[0117] As used herein, "cancer" refers to any medical condition characterized by malignant cell proliferation or neoplasia, abnormal growth, invasion or metastasis, and includes both solid tumors and non-solid cancers such as leukemia (e.g., hematological malignancies). As used herein, a "solid tumor" refers to a solid mass of neoplastic and / or malignant cells.

[0095]

[0118] As used herein, "angiogenic disease" refers to any medical condition that involves abnormality in angiogenesis, the process of growing new blood vessels. Such abnormality includes, but is not limited to, excessive angiogenesis, insufficient angiogenesis, inappropriate angiogenesis and harmful angiogenesis. For example, such medical conditions that are characterized by excessive or harmful angiogenesis include, but are not limited to, cancer, diabetic retinopathy, age-related macular degeneration and atherosclerosis, stroke and myocardial infarction, and rheumatoid arthritis.

[0096]

[0119] The term "pharmaceutical acceptable" indicates that the specified carrier, vehicle, diluent, excipient and / or salt is generally chemically and / or physically compatible with the other ingredients comprising the formulation and physiologically compatible with the recipient thereof.

[0097]

[0120] Reference herein to a value or parameter of "about" includes (and describes) an embodiment that is directed to the value or parameter itself. For example, a reference to "about X" includes the reference to "X". A numerical range includes the numbers defining the range. Generally speaking, the term "about" refers to the stated value of the variable and all values ​​of the variable that are within experimental error of the stated value (e.g., within a 95% confidence interval for the mean) or within 10 percent of the stated value, whichever is greater. When the term "about" is used within the context of a period of time (years, months, weeks, days, etc.), the term "about" means the period plus or minus a certain amount of the next subperiod (e.g., about 1 year means 11-13 months; about 6 months means 6 months ± 1 week; about 1 week means 6-8 days; etc.), or within 10 percent of the stated value, whichever is longer.

[0098]

[0121] Anti-hVEGFR2 antibody

[0122] The present disclosure provides anti-hVEGFR2 antibodies and antigen-binding fragments thereof. The anti-hVEGFR2 antibodies and antigen-binding fragments provided herein can specifically bind to hVEGFR2 or hVEGFR2-expressing cells. As used herein, "specifically binds" refers to a specific binding to hVEGFR2 or hVEGFR2-expressing cells with a specific binding affinity of ≦10 -6 M (e.g., ≦5×10 -7 M, ≤2×10 -7 M, ≦10 -7 M, ≤5×10 -8 M, ≤2×10 -8 M, ≦10 -8 M, ≤5×10 -9 M, ≤4×10 -9 M, ≤3×10 -9 M, ≤2×10 -9 M, or ≤ 10 -9 M) binding affinity (e.g., K D)

[0099] i.Binding affinity

[0123] The binding affinity of the anti-hVEGFR2 antibodies and antigen-binding fragments provided herein is D This can be expressed by the ratio of the dissociation rate to the association rate (k off / k on ) represents the antigen-binding affinity (e.g., K D ) may be suitably determined using any suitable method known in the art, including, for example, Kinetic Exclusion Assay (KinExA), Biacore, Fortebio, or flow cytometry.

[0100]

[0124] In certain embodiments, the "K D " or "K DThe "value" is measured in one embodiment by a Biacore assay, which is performed with an anti-hVEGFR2 antibody and hVEGFR2, as described by the following assay that measures the solution binding affinity of an anti-hVEGFR2 antibody. In general, Biacore works by equilibrating a fixed amount of one binding partner (CBP) with various concentrations of the other binding partner (titrant), and then capturing a portion of the free CBP with a fluorescently labeled secondary antibody within a contact time that is shorter than the time required for dissociation of the previously formed CBP-titrant complex. The fluorescent signal generated from the captured CBP is directly proportional to the concentration of free CBP in the equilibrated sample, and is used to generate a binding curve (percentage of free CBP versus total titrant concentration) when measured in series. Further details are available from Schreiber, G., Fersht, AR Nature Structural Biology. 1996, 3(5), pp. 427-431. If an anti-hVEGFR2 antibody is used as the CBP in a fixed amount, then the hVEGFR2 protein can be used as the titrant, or vice versa. In certain embodiments, the K D is determined according to the method described in Example 16 of the present disclosure.

[0101]

[0125] Other methods suitable for measuring Kd may also be used where applicable, such as radiolabeled antigen binding assays (see, e.g., Chen, et al. (1999) J. Mol Biol 293:865-881).

[0102]

[0126] In certain embodiments, the binding affinity of anti-hVEGFR2 antibody is measured by flow cytometry.Generally, hVEGFR2 expressing cells (e.g. HUVEC) are incubated with a range of concentrations of anti-hVEGFR2 antibody, followed by incubation with fluorescently labeled secondary antibody, and then analyzed for fluorescent signal intensity.In certain embodiments, the binding affinity of anti-hVEGFR2 antibody or its antigen-binding fragment is determined according to the method described in Example 6 of the present disclosure.

[0103]

[0127] In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments thereof provided herein have a K of 6, 5, 4, 3, 2, 1, or 0.5 nM or less as measured by a Biacore assay. D In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments thereof provided herein specifically bind to hVEGFR2 (or cells expressing hVEGFR2) with a K value of 0.089 nM or less (or 0.001 nM or less) as measured by a Biacore assay. D specifically binds to hVEGFR2 (or cells expressing hVEGFR2) at a value of 0.1 to 1.0.

[0104]

[0128] Alternatively, the binding affinity to hVEGFR2 of the anti-hVEGFR2 antibodies and antigen-binding fragments provided herein may also be expressed as the "half maximal effective concentration" (EC 50 ) value, which refers to the concentration of antibody at which 50% of its maximal effect (e.g., binding) is observed. 50The binding value can be measured by methods known in the art, for example, sandwich assays such as ELISA, Western blots, flow cytometry assays, and other binding assays. In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein specifically bind to recombinant hVEGFR2 with an EC50 value of 80 ng / ml or less (or 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 12, or 10, 9, or 8 ng / ml or less) as measured by ELISA. In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein specifically bind to recombinant hVEGFR2 with an EC50 value of 35, 24, 15, 10, 9, 8, 7, or 6 ng / ml or less as measured by ELISA. In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein are cross-reactive with mouse VEGFR2 and have an EC50 value of 35 ng / ml or less as measured by ELISA. In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein specifically bind to hVEGFR2 with an EC50 value of 60% or less of the EC50 value of 1121B as measured by ELISA. In such embodiments, the anti-hVEGFR2 antibodies and fragments thereof comprise an HCDR1 comprising the sequence of SEQ ID NO: 31, an HCDR2 comprising the sequence of SEQ ID NO: 32 or SEQ ID NO: 37, an HCDR3 comprising the sequence of SEQ ID NO: 33, an LCDR1 comprising the sequence of SEQ ID NO: 28, an LCDR2 comprising the sequence of SEQ ID NO: 29, and an LCDR3 comprising the sequence of SEQ ID NO: 30. In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein are cross-reactive with rhesus VEGFR2 and have an EC50 value of 30, 25, 20, 15, 10, or 9 ng / ml or less as measured by ELISA.

[0105]

[0129] In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein specifically bind to cells expressing hVEGFR2 (e.g., HUVEC) with an EC50 value of 160 ng / ml or less (or 150, 140, 130, 120, 110, 100, 90, 80, 70, 65, 55, 50, 45, 40, 35, 30, or 25 ng / ml or less) as measured by flow cytometry.

[0106]

[0130] In certain embodiments, the antibodies and antigen-binding fragments thereof provided herein exhibit competitive VEGFR2 binding properties that effectively block the binding of VEGFR2 to VEGF-A. The blocking effect of the antibodies and antigen-binding fragments thereof provided herein can be measured, for example, using the ELISA described in Example 5 of the present disclosure. In certain embodiments, the blocking effect of the antibodies and antigen-binding fragments thereof provided herein can be expressed as IC50, which indicates the concentration of the antibodies and antigen-binding fragments thereof provided herein at which the binding of VEGFR2 to VEGF-A is reduced by 50% in the presence of the antibodies and antigen-binding fragments thereof disclosed herein. In certain embodiments, the IC50 of the antibodies and antigen-binding fragments thereof provided herein is within the range of 0.001 μg / ml to 2.5 μg / ml, 0.005 μg / ml to 0.5 μg / ml, 0.05 μg / ml to 0.4 μg / ml, or 0.1 μg / ml to 0.2 μg / ml. In certain embodiments, the antibodies and antigen-binding fragments thereof provided herein block VEGF-A-induced proliferation of hVEGFR2-expressing cells with an IC50 value equal to or less than 82% of the IC50 value of 1121B as measured by a cell viability assay. In such embodiments, the antibodies and antigen-binding fragments thereof provided herein comprise an HCDR1 comprising the sequence of SEQ ID NO:31, an HCDR2 comprising the sequence of SEQ ID NO:37, and an HCDR3 comprising the sequence of SEQ ID NO:33, an LCDR1 comprising the sequence of SEQ ID NO:28, an LCDR2 comprising the sequence of SEQ ID NO:29, and an LCDR3 comprising the sequence of SEQ ID NO:30, preferably expressed in CHO.

[0107]

[0131] Epitope

[0132] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope that includes at least one or more (e.g., 1, 2, 3 or more) of the amino acid residues at positions Y137A, R164A, Y165A, V218A, Y221A, R222A, E251A, L252A, N253A, G255A, D257A, K286A, G312A, L313A, M314A, T315A and K316A of hVEGFR2 having the amino acid sequence of SEQ ID NO: 103.

[0108]

[0133] The term "epitope" as used herein refers to a particular group of atoms or amino acids of an antigen to which an antibody binds. An epitope can include a particular amino acid, sugar side chain, phosphoryl group, or sulfonyl group that directly contacts the antibody. One skilled in the art will understand that it is possible to determine, without undue experimentation, whether an antibody binds to the same epitope as an antibody of the present disclosure (e.g., any of the hybridoma / chimeric or humanized antibodies 002, 003, 006, 018, 042, 048, and 054 provided herein and their chimeric and humanized variants) by determining whether the two antibodies compete for binding to the hVEGFR2 antigen polypeptide.

[0109]

[0134] The term "compete for binding" as used herein with respect to two antigen-binding proteins (e.g., antibodies) means that one antigen-binding protein blocks or reduces the binding of the other antigen-binding protein to an antigen (e.g., human / mouse / rhesus VEGFR2) as determined by competitive binding assays. Competitive binding assays are well known in the art and include, for example, direct or indirect radioimmunoassays (RIA), direct or indirect enzyme immunoassays (EIA), and sandwich competition assays (see, for example, Stahli et al., 1983, Methods in Enzymology 9:242-253). Typically, such assays involve the use of purified antigen or antigen-bearing cells bound to a solid surface, an unlabeled test antibody, and a labeled reference antibody. Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antibody. Typically, the test antibody is present in excess. When two antibodies compete for binding to hVEGFR2, the two antibodies bind to the same or overlapping epitopes, or adjacent epitopes close enough to sterically interfere with the epitope bound by the other antibody. Typically, a competing antibody, when present in excess, will inhibit (e.g., reduce) specific binding of a test antibody to a common antigen by at least 50-55%, 55-60%, 60-65%, 65-70%, 70-75%, 75-80%, 80-85%, 85-90% or more.

[0110]

[0135] In certain embodiments, the epitope or amino acid residue of the epitope bound by the antibody can be determined by mutating a specific residue of the antigen, i.e., hVEGFR2. If the antibody binds to mutant hVEGFR2 with an amino acid residue mutated, for example, to alanine, at a significantly reduced level compared to its binding to wild-type hVEGFR2, this indicates that the mutated residue is directly involved in the binding of the antibody to the hVEGFR2 antigen or is in close proximity to the antibody when the antibody is bound to the antigen. Such a mutated residue is considered to be within the epitope, and the antibody is considered to specifically bind to the epitope that includes that residue. As used herein, a significantly reduced level of binding means that the binding affinity (e.g., EC50, KD, or binding capacity) between the antibody and mutant hVEGFR2 is reduced by more than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more compared to the binding between the antibody and wild-type hVEGFR2. Such binding measurements may be performed using any suitable method known in the art and disclosed herein, including but not limited to KinExA assays, ELISA, Biacore, Fortebio and flow cytometry.

[0111]

[0136] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein exhibit reduced binding (e.g., at least a 30% reduction, a 50% reduction) to mutant hVEGFR2 as measured by ELISA, where a residue in wild-type hVEGFR2 is substituted with an alanine and the residue is selected from the group consisting of: Y137A, R164A, Y165A, V218A, Y221A, R222A, E251A, L252A, N253A, G255A, D257A, K286A, G312A, L313A, M314A, T315A and K316A relative to SEQ ID NO: 103.

[0112]

[0137] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope on hVEGFR2, wherein the epitope comprises one or more amino acid residues selected from the group consisting of: Y137, R164, Y165, V218, Y221, R222, E251, L252, N253, G255, D257, K286, G312, L313, M314, T315 and K316 of SEQ ID NO: 103.

[0113]

[0138] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope including Y165 and / or L313 of SEQ ID NO:103, but excluding any of R222, G255, D257, and T315.

[0114]

[0139] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope including Y137, V218, Y221, R222, E251, L252, N253, G255, D257, K286, L313, M314, T315, K316, or any combination thereof of SEQ ID NO: 103.

[0115]

[0140] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope comprising R164, Y165, D257 of SEQ ID NO:103, or any combination thereof.

[0116]

[0141] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope including Y165, Y221, R222, E251, G255, D257, G312, L313, M314, T315, K316, or any combination thereof of SEQ ID NO: 103.

[0117]

[0142] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope that includes Y165, but excludes R222, G255, D257, L313, and T315 of SEQ ID NO:103.

[0118]

[0143] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope including Y165, Y221, R222, E251, N253, G255, D257, G312, L313, M314, T315, K316, or any combination thereof of SEQ ID NO: 103.

[0119]

[0144] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope comprising R164, Y165, D257 of SEQ ID NO:103, or any combination thereof.

[0120]

[0145] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein bind to an epitope including Y165, Y221, R222, E251, N253, G255, D257, G312, L313, M314, T315, K316, or any combination thereof of SEQ ID NO: 103.

[0121]

[0146] Antibody sequence

[0147] In another aspect, the disclosure provides an anti-hVEGFR antibody or antigen-binding fragment thereof, comprising the sequences of heavy chain HCDR1, HCDR2, and HCDR3, and / or light chain LCDR1, LCDR2, and LCDR3, wherein: HCDR1 sequence comprises SSWMN (SEQ ID NO:1), DYYMS (SEQ ID NO:19), X1YGMS (SEQ ID NO:41), X4YWIM (SEQ ID NO:44), or a homologous sequence of at least 80% sequence identity thereof; The HCDR2 sequence is RIFPGDGDTYYNGKFQV (SEQ ID NO: 2), FIRNKANGYTTEYSASVKG (SEQ ID NO: 20), SISX2GGSYTYYADSVX 19G (SEQ ID NO: 42), DIYPGX5GSTNYNEKFKS (SEQ ID NO: 45), or a homologous sequence of at least 80% sequence identity thereof; The HCDR3 sequence comprises FLDTSGRYVDY (SEQ ID NO:3), FDYYGSTYCFDY (SEQ ID NO:21), EX3DGNYDY (SEQ ID NO:43), DSNPDY (SEQ ID NO:46), or a homologous sequence of at least 80% sequence identity thereof; LCDR1 sequence includes KASQDVNTAVA (SEQ ID NO: 4), RASQSVSTSSSSFMH (SEQ ID NO: 22), RSSKSLLYKDGKTYLN (SEQ ID NO: 28), RASESVX6NSGISFMX7 (SEQ ID NO: 47), or a homologous sequence of at least 80% sequence identity thereof; The LCDR2 sequence comprises SASYRYI (SEQ ID NO:5), YASNLES (SEQ ID NO:23), LMSTRAS (SEQ ID NO:29), AASX8QX9S (SEQ ID NO:48), or a homologous sequence of at least 80% sequence identity thereof; LCDR3 sequences include QQHYRAPLT (SEQ ID NO:6), QHTWEIPLT (SEQ ID NO:24), QQLVEYPFT (SEQ ID NO:30), QQSKEVPYT (SEQ ID NO:49), or homologous sequences of at least 80% sequence identity thereof; where X1 is I or M, X2 is V or I, X3 is L or M, X4 is T or S, X5 is T or S, X6 is D or E, X7 is T or H, X8 is T or Y, X9 is G or R, and X 19 is E or K, Anti-hVEGFR antibodies or antigen-binding fragments thereof are provided.

[0122]

[0148] In one aspect, the disclosure provides an anti-hVEGFR2 antibody or antigen-binding fragment thereof provided herein, wherein HCDR1 comprises the amino acid sequence of SEQ ID NO: 41, HCDR2 comprises the amino acid sequence of SEQ ID NO: 42, HCDR3 comprises the amino acid sequence of SEQ ID NO: 43, LCDR1 comprises the sequence of SEQ ID NO: 28, LCDR2 comprises the sequence of SEQ ID NO: 29, and LCDR3 comprises the sequence of SEQ ID NO: 30.

[0123]

[0149] In one aspect, the disclosure provides an antibody or antigen-binding fragment thereof provided herein, wherein: a) HCDR1 comprises the sequence of SEQ ID NO:25, HCDR2 comprises the sequence of SEQ ID NO:26 and HCDR3 comprises the sequence of SEQ ID NO:27; LCDR1 comprises the sequence of SEQ ID NO:28, LCDR2 comprises the sequence of SEQ ID NO:29 and LCDR3 comprises the sequence of SEQ ID NO:30; or b) HCDR1 comprises the sequence of SEQ ID NO: 31, HCDR2 comprises the sequence of SEQ ID NO: 32 or SEQ ID NO: 37, HCDR3 comprises the sequence of SEQ ID NO: 33, LCDR1 comprises the sequence of SEQ ID NO: 28, LCDR2 comprises the sequence of SEQ ID NO: 29 and LCDR3 comprises the sequence of SEQ ID NO: 30; or c) HCDR1 comprises the sequence of SEQ ID NO: 34, HCDR2 comprises the sequence of SEQ ID NO: 35 or SEQ ID NO: 37, HCDR3 comprises the sequence of SEQ ID NO: 36, LCDR1 comprises the sequence of SEQ ID NO: 28, LCDR2 comprises the sequence of SEQ ID NO: 29 and LCDR3 comprises the sequence of SEQ ID NO: 30.

[0124]

[0150] In one aspect, the disclosure provides an anti-hVEGFR2 antibody or antigen-binding fragment thereof provided herein, wherein HCDR1 comprises the amino acid sequence of SEQ ID NO: 44, HCDR2 comprises the amino acid sequence of SEQ ID NO: 45, HCDR3 comprises the amino acid sequence of SEQ ID NO: 46, LCDR1 comprises the sequence of SEQ ID NO: 47, LCDR2 comprises the sequence of SEQ ID NO: 48, and LCDR3 comprises the sequence of SEQ ID NO: 49.

[0125]

[0151] In one aspect, the disclosure provides an antibody or antigen-binding fragment thereof provided herein, wherein: a) HCDR1 comprises the sequence of SEQ ID NO:7, HCDR2 comprises the sequence of SEQ ID NO:8 and HCDR3 comprises the sequence of SEQ ID NO:9; LCDR1 comprises the sequence of SEQ ID NO:10, LCDR2 comprises the sequence of SEQ ID NO:11 and LCDR3 comprises the sequence of SEQ ID NO:12; or b) HCDR1 comprises the sequence of SEQ ID NO: 13, HCDR2 comprises the sequence of SEQ ID NO: 14, HCDR3 comprises the sequence of SEQ ID NO: 15, LCDR1 comprises the sequence of SEQ ID NO: 16, LCDR2 comprises the sequence of SEQ ID NO: 17 and LCDR3 comprises the sequence of SEQ ID NO: 18.

[0126]

[0152] In one aspect, the disclosure provides an antibody or antigen-binding fragment thereof provided herein, wherein: a) HCDR1 comprises the sequence of SEQ ID NO:1, HCDR2 comprises the sequence of SEQ ID NO:2, HCDR3 comprises the sequence of SEQ ID NO:3, LCDR1 comprises the sequence of SEQ ID NO:4, LCDR2 comprises the sequence of SEQ ID NO:5 and LCDR3 comprises the sequence of SEQ ID NO:6; or b) HCDR1 comprises the sequence of SEQ ID NO: 19, HCDR2 comprises the sequence of SEQ ID NO: 20, HCDR3 comprises the sequence of SEQ ID NO: 21, LCDR1 comprises the sequence of SEQ ID NO: 22, LCDR2 comprises the sequence of SEQ ID NO: 23 and LCDR3 comprises the sequence of SEQ ID NO: 24.

[0127]

[0153] In certain embodiments, the antibodies provided herein comprise one or more (e.g., one, two, three, four, five, or six) CDR sequences of hVEGFR2 antibodies 002, 003, 006, 018, 042, 048, and 054.

[0128]

[0154] As used herein with respect to antibodies, "002" or "2" refers to a murine antibody having a heavy chain variable region of SEQ ID NO:50 and a light chain variable region of SEQ ID NO:51.

[0129]

[0155] As used herein with respect to antibodies, "003" or "3" refers to a murine antibody having a heavy chain variable region of SEQ ID NO:52 and a light chain variable region of SEQ ID NO:53.

[0130]

[0156] As used herein with respect to antibodies, "006" or "6" refers to a murine antibody having a heavy chain variable region of SEQ ID NO:54 and a light chain variable region of SEQ ID NO:55.

[0131]

[0157] As used herein, "018" or "18" with respect to antibodies refers to a murine antibody having a heavy chain variable region of SEQ ID NO:56 and a light chain variable region of SEQ ID NO:57.

[0132]

[0158] As used herein with respect to antibodies, "042" or "42" refers to a murine antibody having a heavy chain variable region of SEQ ID NO:58 and a light chain variable region of SEQ ID NO:59.

[0133]

[0159] As used herein with respect to antibodies, "048" or "48" refers to a murine antibody having a heavy chain variable region of SEQ ID NO:60 and a light chain variable region of SEQ ID NO:61.

[0134]

[0160] As used herein with respect to antibodies, "054" or "45" refers to a murine antibody having a heavy chain variable region of SEQ ID NO:62 and a light chain variable region of SEQ ID NO:63.

[0135]

[0161] Table 1 shows the CDR sequences of these hVEGFR2 antibodies. The sequences of the heavy and light chain variable regions are also provided below in Table 2.

[0136]

[0162]

[0137] [Table 1-1]

[0138] [Table 1-2]

[0139] where X1 is I or M, X2 is V or I, X3 is L or M, X4 is T or S, X5 is T or S, X6 is D or E, X7 is T or H, X8 is T or Y, X9 is G or R, and X 19 is E or K.

[0140]

[0163]

[0141] [Table 2]

[0142] Here, the CDR regions are in bold.

[0143]

[0164] The anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein can be monoclonal, polyclonal, humanized, chimeric, recombinant, bispecific, labeled, bivalent, or anti-idiotypic antibodies. Recombinant antibodies are antibodies prepared in vitro using recombinant methods rather than in an animal.

[0144]

[0165] CDRs are known to be responsible for antigen binding, however, it has been found that not all six CDRs are necessarily essential or invariant. In other words, it is possible to replace, alter or modify one, two or three CDRs in the anti-hVEGFR2 antibodies provided herein and still substantially retain specific binding affinity to hVEGFR2.

[0145]

[0166] In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments provided herein comprise the heavy chain CDR3 sequence of one of the anti-hVEGFR2 antibodies 002, 003, 006, 018, 042, 048 and 054. The heavy chain CDR3 region is believed to be located at the center of the antigen-binding site and therefore makes the most contact with the antigen and provides the most free energy for the affinity of the antibody to the antigen. The heavy chain CDR3 is also believed to be by far the most diverse CDR with respect to the antigen-binding site in terms of length, amino acid composition and conformation due to multiple diversification mechanisms (Tonegawa S. Nature. 302:575-81). The diversity of the heavy chain CDR3 is sufficient to generate the majority of antibody specificities (Xu JL, Davis MM. Immunity. 13:37-45) as well as desirable antigen-binding affinities (Schier R, et al. J Mol Biol. 263:551-67).

[0146]

[0167] In some embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments provided herein comprise all or part of the heavy chain variable domain and / or all or part of the light chain variable domain. In one embodiment, the anti-hVEGFR2 antibodies and antigen-binding fragments provided herein are single-domain antibodies consisting of all or part of the heavy chain variable domain provided herein. Further information regarding such single-domain antibodies is available in the art (see, for example, U.S. Patent No. 6,248,516).

[0147]

[0168] In certain embodiments, the antibodies and antigen-binding fragments thereof provided herein comprise suitable framework region (FR) sequences, so long as the antibodies and antigen-binding fragments thereof can specifically bind to hVEGFR2. The CDR sequences provided in Table 1 are taken from mouse antibodies, but can be grafted to any suitable FR sequence of any suitable species, such as mouse, human, rat, rabbit, among others, using suitable methods known in the art, such as recombinant techniques.

[0148]

[0169] In certain embodiments, the antibodies and antigen-binding fragments thereof provided herein are humanized. Humanized antibodies or antigen-binding fragments are desirable in terms of their reduced immunogenicity in humans. Humanized antibodies are chimeric in their variable regions because non-human CDR sequences are grafted onto human or substantially human FR sequences. Humanization of antibodies or antigen-binding fragments can essentially be performed by substituting non-human (e.g., mouse) CDR genes for the corresponding human CDR genes in human immunoglobulin genes (see, for example, Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536).

[0149]

[0170] Suitable human heavy and light chain variable domains can be selected to this end using methods known in the art. In an illustrative example, a "best-fit" approach can be used, in which a non-human (e.g., rodent) antibody variable domain sequence is screened or BLASTed against a database of known human variable domain germline sequences, and the human sequence closest to the non-human query sequence is identified and used as a human scaffold for grafting the non-human CDR sequences (see, e.g., Sims et al. (1993) J.Immunol. 151:2296; Chothia et al. (1987) J.Mot.Biol. 196:901). Alternatively, frameworks derived from the consensus sequence of all human antibodies can be used for grafting of non-human CDRs (see, e.g., Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J. Immunol., 151:2623).

[0150]

[0171] In certain embodiments, the humanized antibodies or antigen-binding fragments provided herein are composed of substantially all human sequences, except for the CDR sequences, which are non-human. In some embodiments, the variable region FR, and, if present, the constant region, are derived entirely or substantially from human immunoglobulin sequences. The human FR sequences and the human constant region sequences may be derived from different human immunoglobulin genes, e.g., the FR sequences may be derived from one human antibody and the constant region may be derived from another human antibody. In some embodiments, the humanized antibodies or antigen-binding fragments comprise human heavy / light chain FR1-4.

[0151]

[0172] In some embodiments, the FR region derived from a human may contain the same amino acid sequence as the human immunoglobulin from which it is derived. In some embodiments, one or more amino acid residues of the human FR are replaced with the corresponding residues from the parent non-human antibody. This may be desirable in certain embodiments to make the humanized antibody or fragment thereof more similar to the non-human parent antibody structure, thereby reducing or avoiding immunogenicity, and / or improving or retaining binding activity or binding affinity.

[0152]

[0173] In certain embodiments, the humanized antibody or antigen-binding fragment provided herein comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in each human FR sequence, or no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in all FRs of the heavy or light chain variable domain. In some embodiments, such changes in amino acid residues may be present only in the heavy chain FR region, only in the light chain FR region, or in both chains. In certain embodiments, one or more amino acid residues are mutated, e.g., back-mutated to the corresponding residue found in the non-human parent antibody from which the CDR sequence is derived (e.g., in the mouse framework region). The positions suitable for mutation can be selected by the skilled artisan according to principles known in the art. For example, the position of the mutation may be selected at the following locations: 1) where the residue in the framework of the human Gremlin sequence is rarely present (e.g., in less than 20% or less than 10% of the human variable region sequences); 2) where the location is directly adjacent to one or more of the three CDRs in the primary sequence of the human germline chain, because it is more likely to interact with the residues in the CDRs; or 3) where the location is close to the CDRs in the three-dimensional model, and therefore may have a good possibility of interacting with the amino acids in the CDRs. The residue at the selected location may be backmutated to the corresponding residue in the parent antibody, or to a residue that is neither the corresponding residue in the human germline sequence nor the corresponding residue in the parent antibody, but is a common residue in human sequences, i.e., occurs more frequently at that position in known human sequences that belong to the same subgroup as the human germline sequence (see U.S. Patent No. 5,693,762).

[0153]

[0174] In certain embodiments, the humanized light chains and humanized heavy chains of the present disclosure are substantially non-immunogenic in humans and retain substantially the same, or even higher, affinity for hVEGFR2 as the parent antibody.

[0154]

[0175] In certain embodiments, the humanized antibodies and antigen-binding fragments thereof provided herein comprise one or more light chain FR sequences of human germline framework sequence VK / 2D-40, with or without back mutations, and / or one or more heavy chain FR sequences of human germline framework sequence VH / 3-21. Back mutations may be introduced into the human germline framework sequences, if desired. In certain embodiments, the humanized antibody 054 may contain one or more back mutations selected from the group consisting of R19K, A40T, G44R, S49A, S78T, and R87K, relative to the framework sequence of SEQ ID NO: 92 (EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARELDGNYDYWGQGTTLTVSS) of the heavy chain framework sequence VH / 3-21. The humanized antibody 048 may contain one or more back mutations selected from the group consisting of G44R, S49A, and S78T compared to the framework sequence of SEQ ID NO:92 of the heavy chain framework sequence VH / 3-21 (EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARELDGNYDYWGQGTTLTVSS). In certain embodiments, the humanized antibody 054 / 048 may contain one or more back mutations selected from the group consisting of M4T, T7D, P8E, P15F, P18S, A19V, Y42F, K45R, P65S and V91I compared to the framework sequence of SEQ ID NO:95 of the light chain framework sequence VK / 2D-40 (DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP).

[0155]

[0176] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein comprise a heavy chain variable region comprising a sequence selected from the group consisting of SEQ ID NO:93, SEQ ID NO:94, and SEQ ID NO:98, and homologous sequences thereof having at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity while still retaining specific binding affinity to hVEGFR2, particularly human hVEGFR2.

[0156]

[0177] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein comprise a light chain variable region comprising a sequence selected from the group consisting of SEQ ID NO:96 and SEQ ID NO:97, and homologous sequences thereof having at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity while still retaining specific binding affinity to hVEGFR2, particularly human hVEGFR2.

[0157]

[0178] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein comprise a heavy chain variable region comprising a sequence selected from the group consisting of SEQ ID NO:93, SEQ ID NO:94, and SEQ ID NO:98, and a light chain variable region comprising the sequence of SEQ ID NO:96 or SEQ ID NO:97.

[0158]

[0179] In certain embodiments, the anti-hVEGFR2 antibodies or antigen-binding fragments thereof provided herein further comprise one or more of heavy chains HFR1, HFR2, HFR3, and HFR4, and / or one or more of light chains LFR1, LFR2, LFR3, and LFR4, wherein: HFR1 is EVQLVESGGGLVKPGGSLX 10 LSCAASGFTFS (SEQ ID NO: 84), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; HFR2 is WVRQX 11PGKRLEWVA (SEQ ID NO: 85), or a homologous sequence having at least 80% (or at least 90%) sequence identity thereto; The HFR3 sequence is RFTISRDNAKNTLYLQMNSLX. 12 AEDTAVYYCAR (SEQ ID NO: 86), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; HFR4 is WGX 13 GTTLTVSS (SEQ ID NO: 87) or a homologous sequence of at least 80% sequence identity thereto; LFR1 is DIVITQX 14 X 15 LSLPVTX 16 GESVSISC (SEQ ID NO: 88), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; LFR2 comprises WFLQRPGQSPQLLIY (SEQ ID NO: 89), or a homologous sequence thereof of at least 80% (or at least 85%, 90%) sequence identity; LFR3 is GVX 17 DRFSGGSGTDFTLKISRVEAEDVGX 18 YYC (SEQ ID NO: 90), or a homologous sequence having at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; LFR4 comprises FGSGTKLEIK (SEQ ID NO: 91), or a homologous sequence thereof with at least 80% (or at least 90%) sequence identity; Where X 10 is R or K, and X 11 is A or T, and X 12 is R or K, and X 13 is Q or H, and X 14 is D or T, and X 15 is E or P, and X 16 is F or P, and X 17 is S or P, and X 18 is V or I.

[0159]

[0180] In certain embodiments, HFR1 comprises a sequence selected from the group consisting of SEQ ID NOs: 64, 68, and 72, HFR2 comprises a sequence selected from the group consisting of SEQ ID NOs: 65, 69, and 73, HFR3 comprises a sequence selected from the group consisting of SEQ ID NOs: 66, 70, and 74, HFR4 comprises a sequence selected from the group consisting of SEQ ID NOs: 67, 71, and 75, LFR1 comprises a sequence selected from the group consisting of SEQ ID NOs: 76 and 80, LFR2 comprises a sequence selected from the group consisting of SEQ ID NOs: 77 and 81, LFR3 comprises a sequence selected from the group consisting of SEQ ID NOs: 78 and 82, and LFR4 comprises a sequence selected from the group consisting of SEQ ID NOs: 79 and 83.

[0160]

[0181]

[0161] [Table 3]

[0162]

[0182] Tables 4 and 5 illustrate the sequences of the variable regions of the humanized 054 and 048 antibodies.

[0163]

[0183]

[0164] [Table 4]

[0165]

[0184]

[0166] [Table 5]

[0167]

[0185] The light chain variable region of humanized 048 is identical to that of humanized 054.

[0168]

[0186] The humanized anti-hVEGFR2 antibodies provided herein retained specific binding affinity to hVEGFR2-expressing cells, at least comparable to or even better than the parent antibody in these respects. The humanized antibodies provided herein can also retain their functional interaction with VEGFR2-expressing cells, such as HUVEC cells, in that all antibodies can inhibit VEGF-A-induced VEGFR2 phosphorylation, HUVEC proliferation and tube formation. In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein further comprise an immunoglobulin constant region, optionally a constant region of human Ig, or optionally a constant region of human IgG. In some embodiments, the immunoglobulin constant region comprises a heavy and / or light chain constant region. The heavy chain constant region comprises a CH1, hinge, and / or CH2-CH3 region. In certain embodiments, the heavy chain constant region comprises an Fc region. In certain embodiments, the light chain constant region comprises a Cκ or Cλ.

[0169]

[0187] In certain embodiments, the anti-hVEGFR2 antibodies and fragments thereof provided herein further comprise a constant region of human IgG1, IgG2, IgG3, or IgG4. In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments thereof provided herein comprise a constant region of an IgG1 isotype. In certain embodiments, the constant region of human IgG1 is set forth in SEQ ID NO: 38 (ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK) or a homologous sequence having at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity thereto.

[0170]

[0188] The constant region of IgG1 isotype can induce effector functions such as ADCC or CDC. The effector function of the anti-hVEGFR2 antibody and its antigen-binding fragments provided herein can cause cytotoxicity against cells expressing hVEGFR2. Effector function can be evaluated using various assays, such as Fc receptor binding assay, C1q binding assay, and cytolysis assay, and any of the above assays for determining ADCC or CDC.

[0171]

[0189] Antibody variants

[0190] The anti-hVEGFR2 antibodies and antigen-binding fragments thereof provided herein also encompass various types of variants of the antibody sequences provided herein.

[0172]

[0191] In certain embodiments, the variants contain one or more modifications or substitutions in one, two, or three CDR sequences provided in Table 1, in one or more FR sequences, in the variable region sequences of the heavy or light chains provided herein, and / or in the constant region (e.g., Fc region). Such antibody variants retain the specific binding affinity of their parent antibody to hVEGFR2, but have one or more desirable properties imparted by the modifications or substitutions. For example, the antibody variants may have improved antigen binding affinity, improved glycosylation patterns, reduced risk of glycosylation, reduced deamination, reduced or improved effector functions, improved FcRn receptor binding, extended pharmacokinetic half-life, pH sensitivity, and / or suitability for conjugation (e.g., one or more introduced cysteine ​​residues), to name a few.

[0173]

[0192] The parent antibody sequence can be screened to identify suitable or preferred residues for modification or substitution using methods known in the art, such as "alanine scanning mutagenesis" (see, e.g., Cunningham and Wells (1989) Science, 244:1081-1085). Briefly, target residues (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) can be identified and replaced with neutral or negatively charged amino acids (e.g., alanine or polyalanine), and modified antibodies are generated and screened for the desired properties. If substitution at a particular amino acid position manifests a desired functional change, that position can be identified as a potential residue for modification or substitution. Potential residues can be further evaluated by substituting with different types of residues (e.g., cysteine ​​residues, positively charged residues, etc.).

[0174] 1. Affinity variants

[0193] Affinity variants retain the specific binding affinity of parent antibody to hVEGFR2, or even have improved specific binding affinity to hVEGFR2 over parent antibody. Various methods known in the art can be used to achieve this goal. For example, a library of antibody variants (e.g., Fab variants or scFv variants) can be generated and expressed using phage display technology, and then screened for binding affinity to hVEGFR2. In another example, computer software can be used to virtually simulate the binding of an antibody to hVEGFR2 and identify the amino acid residues on the antibody that form the binding interface. Such residues can be avoided in substitutions to prevent a decrease in binding affinity, or targeted for substitutions that result in stronger binding.

[0175]

[0194] In certain embodiments, at least one (or all) of the substitutions in the CDR sequence, FR sequence, or variable region sequence comprises conservative substitution. "Conservative substitution" in the context of amino acid sequence refers to replacing an amino acid residue with a different amino acid residue having a side chain with similar physicochemical properties. For example, conservative substitution can be made between amino acid residues with hydrophobic side chains (e.g., Met, Ala, Val, Leu, and Ile), between residues with neutral hydrophilic side chains (e.g., Cys, Ser, Thr, Asn, and Gln), between residues with acidic side chains (e.g., Asp, Glu), between amino acids with basic side chains (e.g., His, Lys, and Arg), or between residues with aromatic side chains (e.g., Trp, Tyr, and Phe). As known in the art, conservative substitution usually does not cause significant changes in the conformational structure of a protein, and thus may retain the biological activity of the protein.

[0176]

[0195] In certain embodiments, the antibodies or antigen-binding fragments provided herein comprise one or more amino acid residue substitutions in one or more CDR sequences and / or one or more FR sequences. In certain embodiments, the affinity variants comprise a total of 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 or less substitutions in one or more CDR sequences and / or FR sequences.

[0177]

[0196] In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments thereof comprise one, two, or three CDR sequences having at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to the CDR sequence(s) listed in Table 1, while retaining binding affinity to hVEGFR2 at a similar or even higher level than its parent antibody.

[0178]

[0197] In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments thereof comprise one or more variable region sequences having at least 80% (e.g., at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to the variable region sequence(s) of SEQ ID NOs: 50-63, 93-94, and 96-98, while retaining a similar or even higher level of binding affinity to hVEGFR2 than its parent antibody. In some embodiments, a total of 1-10 amino acids are substituted, inserted, or deleted in a sequence selected from SEQ ID NOs: 50-63, 93-94, and 96-98. In some embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs).

[0179] 2. Glycosylation variants

[0198] The anti-hVEGFR2 antibodies and antigen-binding fragments provided herein also encompass glycosylation variants, which can be obtained to increase or decrease the degree of glycosylation of the antibody or antigen-binding fragment.As used herein, the term "glycosylation" refers to the enzymatic process of attaching glycans, such as fucose, xylose, mannose, or GlcNAc phosphoserine glycans, to proteins, lipids, or other organic molecules.Depending on the carbon that is linked to the glycan, glycosylation can be divided into five classes, including N-linked glycosylation, O-linked glycosylation, phosphate glycosylation, C-linked glycosylation, and glypiation.

[0180]

[0199] Glycosylation of antibodies is usually N-linked or O-linked. N-linked refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue in a tripeptide sequence, such as asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline. O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine.

[0181]

[0200] In certain embodiments, the antibody or antigen-binding fragment thereof provided herein is afucosylated. The terms "afucosylation" or "afucosylated" refer to the reduction or removal of core fucose on the N-glycan attached to the antibody. The majority of glycans of human IgG antibodies are known as G0, G1, and G2, which are complex biantennary molecules with 0, 1, or 2 terminal galactose core fucose residues.

[0182]

[0201] Afucosylated antibody variants are described, for example, in US2003 / 0157108; WO2000 / 61739; WO2001 / 29246; US2003 / 0115614; US2002 / 0164328; US2004 / 0093621; US2004 / 0132140; US2004 / 0110704; US2004 / 0110282; US2004 / 0109865; WO2003 / 085119; WO2003 / 084570; WO2005 / 035586; WO2005 / 035778; WO2005 / 053742; WO2002 / 031140; Okazaki et al. They can be made using methods known in the art, such as those described in J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87:614 (2004).

[0183]

[0202] In certain embodiments, antibody glycosylation variants may be obtained by removal of a native glycosylation site (e.g., by N297A substitution), such that, for example, the tripeptide sequence of the N-linked glycosylation site, or the serine or threonine residue of the O-linked glycosylation site, is no longer present in the antibody or in the Fc sequence. Alternatively, in certain embodiments, antibody glycosylation variants may be obtained by producing the antibody in a host cell line that is not capable of adding the selected sugar group to the mature core carbohydrate structure of the antibody.

[0184] 3. Cysteine ​​engineered variants

[0203] The anti-hVEGFR2 antibodies and antigen-binding fragments provided herein also include cysteine ​​engineered variants, which contain one or more introduced free cysteine ​​amino acid residues.

[0185]

[0204] A free cysteine ​​residue is a cysteine ​​residue that is not part of a disulfide bridge.Cysteine ​​engineered variants are useful for, for example, conjugation with cytotoxic compounds and / or imaging compounds, labels, or radioisotopes, among others, at the site of engineered cysteine, for example, through maleimide or haloacetyl.Methods for engineering antibodies or antigen-binding fragments to introduce free cysteine ​​residues are known in the art, see, for example, WO2006 / 034488.

[0186]

[0205] antigen binding fragment

[0206] Also provided herein are anti-hVEGFR2 antigen-binding fragments. Various types of antigen-binding fragments are known in the art and can be developed based on the anti-hVEGFR2 antibodies provided herein, including, for example, the exemplary antibodies whose CDR sequences are shown in Table 1 and various variants thereof (e.g., affinity variants, glycosylation variants, Fc variants, cysteine ​​engineered variants, etc.).

[0187]

[0207] In certain embodiments, the anti-hVEGFR2 antigen-binding fragment provided herein is a diabody, a Fab, a Fab', a F(ab')2, an Fd, an Fv fragment, a disulfide-stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv'), a disulfide-stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, or a bivalent domain antibody.

[0188]

[0208] A variety of techniques can be used to generate such antigen-binding fragments. Exemplary methods include enzymatic digestion of intact antibodies (see, for example, Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)), recombinant expression by host cells such as E. coli (for example, for Fab, Fv, and ScFv antibody fragments), screening from a phage display library as discussed above (for example, for ScFv), and chemical coupling of two Fab'-SH fragments to form F(ab')2 fragments (Carter et al., Bio / Technology 10:163-167 (1992)). Other techniques for generating antibody fragments will be apparent to those skilled in the art.

[0189]

[0209] In certain embodiments, the antigen-binding fragment is scFv. The generation of scFv is described, for example, in WO93 / 16185; U.S. Patent No. 5,571,894; and U.S. Patent No. 5,587,458. scFv can be fused to effector protein at either amino or carboxyl terminus to produce fusion protein (see, for example, Antibody Engineering, edited by Borrebaeck).

[0190]

[0210] In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments thereof provided herein are bivalent, tetravalent, hexavalent, or multivalent.The term "valency" as used herein refers to the presence of a specified number of antigen-binding sites in a given molecule.Thus, the terms "bivalent", "tetravalent" and "hexavalent" refer to the presence of two binding sites, four binding sites, and six binding sites, respectively, in an antigen-binding molecule.Any molecule that is more than bivalent is considered multivalent, including, for example, trivalent, tetravalent, hexavalent, etc.

[0191]

[0211] A bivalent molecule can be monospecific when both binding sites are specific for binding to the same antigen or epitope. This allows for stronger binding to antigen or epitope than its monovalent counterpart in certain embodiments. Similarly, a multivalent molecule can also be monospecific. In certain embodiments, in a bivalent or multivalent antigen-binding moiety, the first valency of the binding site and the second valency of the binding site are structurally identical (i.e., have the same sequence) or structurally different (i.e., have different sequences, despite having the same specificity).

[0192]

[0212] Bivalent can also be bispecific, when two binding sites are specific for different antigens or epitopes. This also applies to multivalent molecules. For example, a trivalent molecule can be bispecific, when two binding sites are monospecific for a first antigen (or epitope) and the third binding site is specific for a second antigen (or epitope).

[0193]

[0213] bispecific antibody

[0214] In certain embodiments, the antibodies and antigen-binding fragments thereof provided herein are bispecific. The term "bispecific" as used herein encompasses molecules with three or more specificities, and molecules with three or more specificities, i.e., multispecific. In certain embodiments, the bispecific antibodies and antigen-binding fragments provided herein can specifically bind to a first and a second epitope of hVEGFR2, or can specifically bind to hVEGFR2 and a second antigen. In certain embodiments, the first and second epitopes of hVEGFR2 are completely different from each other or do not overlap. In certain embodiments, the bispecific antibodies and antigen-binding fragments thereof can simultaneously bind to both the first and second epitopes.

[0194]

[0215] In certain embodiments, the bispecific antibody comprises a first binding domain and a second binding domain, wherein the first binding domain comprises an HCDR1 comprising a sequence selected from the group consisting of SEQ ID NOs: 25, 31, 34, and 1; an HCDR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 26, 32, 35, and 2; an HCDR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 27, 33, 36, and 3; an LCDR1 comprising a sequence selected from the group consisting of SEQ ID NOs: 28 and 4; an LCDR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 29 and 5; and an LCDR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 30 and 31. the second binding domain comprises an HCDR1 comprising a sequence selected from the group consisting of SEQ ID NOs: 7, 13 and 19, an HCDR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 8, 14 and 20, an HCDR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 9, 15 and 21, an LCDR1 comprising a sequence selected from the group consisting of SEQ ID NOs: 10, 16 and 22, an LCDR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 11, 17 and 23, and an LCDR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 12, 18 and 24.

[0195]

[0216] In certain embodiments, a bispecific antibody comprises a first binding domain and a second binding domain, wherein the first binding domain is: a) an HCDR1 comprising the sequence of SEQ ID NO: 25, an HCDR2 comprising the sequence of SEQ ID NO: 26, an HCDR3 comprising the sequence of SEQ ID NO: 27, an LCDR1 comprising the sequence of SEQ ID NO: 28, an LCDR2 comprising the sequence of SEQ ID NO: 29, and an LCDR3 comprising the sequence of SEQ ID NO: 30; or b) HCDR1 comprising the sequence of SEQ ID NO: 31, HCDR2 comprising the sequence of SEQ ID NO: 32 or SEQ ID NO: 37, HCDR3 comprising the sequence of SEQ ID NO: 33, LCDR1 comprising the sequence of SEQ ID NO: 28, LCDR2 comprising the sequence of SEQ ID NO: 29, and LCDR3 comprising the sequence of SEQ ID NO: 30; or c) HCDR1 comprising the sequence of SEQ ID NO: 34, HCDR2 comprising the sequence of SEQ ID NO: 35 or SEQ ID NO: 37, HCDR3 comprising the sequence of SEQ ID NO: 36, LCDR1 comprising the sequence of SEQ ID NO: 28, LCDR2 comprising the sequence of SEQ ID NO: 29, and LCDR3 comprising the sequence of SEQ ID NO: 30; or d) comprises an HCDR1 comprising the sequence of SEQ ID NO:1, an HCDR2 comprising the sequence of SEQ ID NO:2, an HCDR3 comprising the sequence of SEQ ID NO:3, an LCDR1 comprising the sequence of SEQ ID NO:4, an LCDR2 comprising the sequence of SEQ ID NO:5, and an LCDR3 comprising the sequence of SEQ ID NO:6; The second binding domain is: e) HCDR1 comprising the sequence of SEQ ID NO:7, HCDR2 comprising the sequence of SEQ ID NO:8, HCDR3 comprising the sequence of SEQ ID NO:9; LCDR1 comprising the sequence of SEQ ID NO:10, LCDR2 comprising the sequence of SEQ ID NO:11, and LCDR3 comprising the sequence of SEQ ID NO:12; or f) HCDR1 comprising the sequence of SEQ ID NO: 13, HCDR2 comprising the sequence of SEQ ID NO: 14, HCDR3 comprising the sequence of SEQ ID NO: 15; LCDR1 comprising the sequence of SEQ ID NO: 16, LCDR2 comprising the sequence of SEQ ID NO: 17, and LCDR3 comprising the sequence of SEQ ID NO: 18; or g) HCDR1 comprising the sequence of SEQ ID NO: 19, HCDR2 comprising the sequence of SEQ ID NO: 20, HCDR3 comprising the sequence of SEQ ID NO: 21; LCDR1 comprising the sequence of SEQ ID NO: 22, LCDR2 comprising the sequence of SEQ ID NO: 23, and LCDR3 comprising the sequence of SEQ ID NO: 24.

[0196]

[0217] In certain embodiments, the second antigen is different from hVEGFR2.

[0197]

[0218] In certain embodiments, the second antigen is an immune-related target. In some embodiments, the bispecific antibody and its antigen-binding fragments can specifically bind to hVEGFR2 and an immune-related target, and can send immune cells to target hVEGFR2-expressing cells (e.g., hVEGFR2-expressing tumor cells) and / or activate hVEGFR2-specific immune responses against hVEGFR2-expressing target cells. As used herein, immune-related targets include biomolecules that are involved in immune responses, optionally in the generation or modulation of cellular immune responses. Examples of immune-related targets are immune checkpoint molecules and surface molecules of cytolytic immune cells, such as T cells or natural killer (NK) cells.

[0198]

[0219] Immune checkpoint molecules can mediate costimulatory signals to amplify immune responses, or mediate costenulatory signals to suppress immune responses. Examples of immune checkpoint molecules include, for example, PD-L1, PD-L2, PD-1, CLTA-4, TIM-3, LAG3, A2AR, CD160, 2B4, TGFβ, VISTA, BTLA, TIGIT, LAIR1, OX40, CD2, CD27, CD28, CD30, CD40, CD47, CD122, ICAM-1, IDO, NKG2C, SLAMF7, SIGLEC7, NKp80, CD160, B7-H3, LFA-1, 1COS, 4-1BB, GITR, BAFFR, HVEM, CD7, LIGHT, IL-2, IL-7, IL-15, IL-21, CD3, CD16, and CD83.

[0199]

[0220] Cytolytic immune cells can be triggered by the surface molecules to attack and mediate the lysis of target cells, such as tumor cells. In certain embodiments, the second antigen is a T cell surface antigen. Examples of T cell surface antigens include, but are not limited to, antigens selected from the group consisting of CD3, CD2, CD4, CD5, CD6, CD8, CD28, CD40L and / or CD44, preferably CD3. In certain embodiments, the second antigen is the epsilon chain of CD3. In certain embodiments, the binding of the bispecific antibody to CD3 on T cells results in the proliferation and / or activation of the T cells, which induce the release of cytotoxic factors, such as perforin and granzymes, and cytolysis and apoptosis of target cells. In certain embodiments, the second antigen is a NK cell surface antigen, such as CD16 (FcγRIII) or CD56. In certain embodiments, binding of the bispecific antibody to CD16 on NK cells results in NK cell degranulation and perforin-dependent target cell lysis (ADCC) of the target cell.

[0200]

[0221] In certain embodiments, the second antigen comprises a tumor antigen. As used herein, "tumor antigen" refers to tumor-specific antigens (e.g., antigens that are unique to tumor cells and not commonly found in non-tumor cells), tumor-associated antigens (e.g., found in both tumor and non-tumor cells, but differentially expressed in tumor cells), and tumor neo-antigens (e.g., expressed in cancer cells because somatic mutations change the protein sequence or create fusion proteins between two unrelated sequences).

[0201]

[0222] Examples of tumor antigens include, but are not limited to, EpCAM, HER2 / neu, HER3 / neu, C250, CEA, MAGE, proteoglycan, VEGF, EGFR, αVβ3-integrin, HLA, HLA-DR, ASC, CD1, CD2, CD4, CD6, CD7, CD8, CD11, CD13, CD14, CD19, CD20, CD21, CD22, CD23, CD24, CD30, CD33, CD37, CD40, CD41, CD47, CD52, c-erb-2, CALLA, MHCII, CD44v3, CD44v6, p97, Ganglio Sid GM1, GM2, GM3, GD1a, GD1b, GD2, GD3, GT1b, GT3, GQ1, NY-ESO-1, NFX2, SSX2, SSX4, Trp2, gp100(Pmel 17), tyrosinase, Muc-1, telomerase, survivin, G250, p53, CA125 MUC, Wue antigen, Lewis Y antigen, HSP-27, HSP-70, HSP-72, HSP-90, Pgp, MCSP, EpHA2 and cell surface targets GC182, GT468 or GT512, PD-L1, arbovirus E protein epitopes, glioma-associated antigen, carcinoembryonic antigen (CEA), β-human chorionic gonadotropin, alpha fetoprotein (AFP), lectin-reactive AFP, thyroglobulum, RAGE-1, MN-CA IX, human telomerase reverse transcriptase, RU1, RU2 (AS), intestinal carboxyi esterase, mut hsp70-2, M-CSF, prostase, prostate specific antigen (PSA), PAP, NY-ESO-1, LAGE-la, p53, prostein, PSMA, survivin and telomerase, prostate cancer tumor antigen-1 (PCTA-1), MAGE, ELF2M, neutrophil elastase, ephrinB2, CD22, insulin growth factor (IGF)-I, IGF-II, IGF-I receptor and mesothelin, ART-l / MelanA (MART-1), tyrosinase, TRP-1, TRP-2 and tumor specific multilineage antigens, e.g., MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, pi5;Ras, unique tumor antigens resulting from chromosomal translocations, e.g., BCR-ABL, E2A-PRL, H4-RET, 1GH-IGK, MYL-RAR; and viral antigens, e.g., Epstein-Barr virus antigen EBVA and human papillomavirus (HPV) antigens E6 and E7; protein-based antigens include TSP-180, MAGE-4, MAGE-5, MAGE-6, RAG E, NY-ESO, pl85erbB2, pl80erbB-3, c-met, nm-23H1, PSA, TAG-72, CA19-9, CA72-4, CAM17.1, NuMa, K-ras, beta-catenin, CDK4, Mum-1, p15, p16, 43-9F, 5T4(791Tgp72), alpha-fetoprotein (fetoprotem), beta-HCG, BCA225, BTAA, CA 125, CA 15-3\CA 27.29\BCAA, CA 195, CA 242, CA-50, CAM43, CD68\I, CO-029, FGF-5, G250, Ga733VEpCAM, HTgp-175, M344, MA-50, MG7-Ag, MOV 18, NB / 70K, NY-CO-1, RCAS 1, SDCCAG16, TA-90\Mac-2 binding protein, cyclophilin C-related protein, TAAL6, TAG72, TLP, and TPS.;

[0202]

[0223] The bispecific antibodies and antigen-binding fragments thereof provided herein may be in any suitable format known in the art. For example, exemplary bispecific formats include bispecific diabodies, scFv-based bispecific formats, IgG-scFv fusions, dual variable domain (DVD)-Ig, quadromas, knobs-into-holes, common light chains (e.g., common light chains with knobs-into-holes, etc.), BiTEs, CrossMab, CrossFab, Duobody, SEEDbody, leucine zipper, dual acting Fab (DAF)-IgG, and Mab. 2 It may be in a bispecific format (see, for example, Brinkmann et al. 2017, Mabs, 9(2):182-212). Bispecific molecules may be of symmetric or asymmetric structure.

[0203]

[0224] The bispecific antibodies and antigen-binding fragments provided herein can be made using any suitable method known in the art.

[0204]

[0225] In one embodiment, two immunoglobulin heavy chain-light chain pairs with different antigen specificities are co-expressed in a host cell, resulting in recombinant production of a bispecific antibody (see, e.g., Milstein and Cuello, Nature, 305:537 (1983)), which is subsequently purified by affinity chromatography.

[0205]

[0226] In another embodiment, sequences encoding antibody heavy chain variable domains for the two specificities are each fused to an immunoglobulin constant domain sequence and subsequently inserted into one or more expression vectors which are co-transfected with an expression vector for the light chain sequences into a host cell suitable for recombinant expression of the bispecific antibody (see, e.g., WO 94 / 04690; Suresh et al., Methods in Enzymology, 121:210 (1986)). Similarly, scFv dimers can also be constructed and expressed recombinantly from a host cell (see, e.g., Gruber et al., J. Immunol., 152:5368 (1994)).

[0206]

[0227] In another method, the leucine zipper peptides from the Fos and Jun proteins can be linked to the Fab' portions of two different antibodies by gene fusion. The linked antibodies are reduced at the hinge region into four half antibodies (i.e., monomers) and then reoxidized to form heterodimers (Kostelny et al., J. Immunol., 148(5):1547-1553 (1992)).

[0207]

[0228] Two antigen-binding domains can also be conjugated or cross-linked to form bispecific antibodies or antigen-binding fragments.For example, one antibody can be coupled to biotin, while the other antibody can be coupled to avidin, and the strong association between biotin and avidin will combine the two antibodies together to form a bispecific antibody (see, for example, U.S. Pat. No. 4,676,980; WO91 / 00360, WO92 / 00373, and EP03089).In another example, two antibodies or antigen-binding fragments can be cross-linked by conventional methods known in the art, for example, as disclosed in U.S. Pat. No. 4,676,980.

[0208]

[0229] Bispecific antigen-binding fragments can be produced from bispecific antibodies, for example, by proteolytic cleavage or by chemical linkage. For example, an antigen-binding fragment of an antibody (e.g., Fab') can be prepared and converted to a Fab'-thiol derivative and then mixed and reacted with another converted Fab' derivative having a different antigen specificity to form a bispecific antigen-binding fragment (see, for example, Brennan et al., Science, 229:81 (1985)).

[0209]

[0230] In certain embodiments, the bispecific antibodies or antigen-binding fragments thereof provided herein can be engineered at the interface such that knob-into-hole associations can form to promote heterodimerization of two different antigen-binding sites. This can maximize the percentage of heterodimers recovered from recombinant cell culture. As used herein, "knobs-into-holes" refers to the interaction between two polypeptides (e.g., Fc) where one polypeptide has a protrusion (i.e., "knobs") due to the presence of an amino acid residue with a bulky side chain (e.g., tyrosine or tryptophan) and the other polypeptide has a recess (i.e., "hole") where a small side chain amino acid residue (e.g., alanine or threonine) is present, but the protrusion can be positioned in the recess to promote the interaction of the two polypeptides, thereby forming a heterodimer or complex. Methods for generating polypeptides with knobs-into-holes are known in the art, for example, as described in U.S. Pat. No. 5,731,168.

[0210]

[0231] Conjugates

[0232] In some embodiments, the anti-hVEGFR2 antibody and its antigen-binding fragment are linked to one or more conjugate moieties. A conjugate is a moiety that can be attached to an antibody or its antigen-binding fragment. It is contemplated that various conjugates can be linked to the antibody or antigen-binding fragment provided herein (see, for example, "Conjugate Vaccines", Contributions to Microbiology and Immunology, JM Cruse and RE Lewis, Jr. (eds.), Carger Press, New York, 1989). These conjugates can be linked to the antibody or antigen-binding fragment by covalent bonding, affinity bonding, intercalation, coordinate bonding, complex formation, association, blending, or addition, among other methods. In certain embodiments, the antibody or its antigen-binding fragment is linked to one or more conjugates via a linker. In certain embodiments, the linker is a hydrazone linker, a disulfide linker, a bifunctional linker, a dipeptide linker, a glucuronide linker, or a thioether linker.

[0211]

[0233] In certain embodiments, the anti-hVEGFR2 antibodies and antigen-binding fragments disclosed herein can be engineered to contain specific sites outside the epitope-binding moiety that can be utilized for binding to one or more conjugates. For example, such sites can include one or more reactive amino acid residues, such as, for example, cysteine ​​or histidine residues, to facilitate covalent linkage to the conjugate.

[0212]

[0234] The conjugate can be a clearance modifier, a therapeutic agent (e.g., a chemotherapeutic agent), a toxin, a radioisotope, a detectable label (e.g., a lanthanide, a luminescent label, a fluorescent label, or an enzyme substrate label), a pharmacokinetic-modifying moiety, a DNA alkylating agent, a topoisomerase inhibitor, a tubulin binding agent, another anti-cancer drug, or a purification moiety (e.g., a magnetic bead or nanoparticle).

[0213]

[0235] Examples of detectable labels include fluorescent labels (e.g., fluorescein, rhodamine, dansyl, phycoerythrin, or Texas Red), enzyme substrate labels (e.g., horseradish peroxidase, alkaline phosphatase, luciferase, glucoamylase, lysozyme, sugar oxidase, or β-D-galactosidase), radioisotopes, other lanthanides, luminescent labels, chromophore moieties, digoxigenin, biotin / avidin, detectable DNA molecules, or gold.

[0214]

[0236] Examples of radioisotopes include: 123 I, 124 I, 125 I, 131 I, 35 S, 3 H, 111 In, 112 In, 14 C. 64 Cu, 67 Cu, 86 Y, 88 Y, 90 Y, 177 Lu, 211 At, 186 Re, 188 Re, 153 Sm, 212 Bi, and 32 Examples include P. Radioisotope-labeled antibodies are useful in receptor-targeted imaging experiments.

[0215]

[0237] In certain embodiments, the conjugate may be a pharmacokinetic-modifying moiety, such as PEG, which serves to extend the half-life of the antibody. Other suitable polymers include, for example, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone, ethylene glycol / propylene glycol copolymers, and the like.

[0216]

[0238] In certain embodiments, the conjugate can be a purification moiety, such as a magnetic bead or nanoparticle.

[0217]

[0239] Antibody Drug Conjugates

[0240] In certain embodiments, the disclosure provides an antibody drug conjugate (ADC) comprising any of the above-described anti-hVEGFR2 antibodies or antigen-binding fragments conjugated to a cytotoxic agent.

[0218]

[0241] ADCs can be useful, for example, for the local delivery of cytotoxic agents in the treatment of cancer. This allows for targeted delivery of cytotoxic agents to tumors and their intracellular accumulation there, which is particularly useful when systemic administration of these unconjugated cytotoxic agents would result in unacceptable levels of toxicity to normal cells as well as the tumor cells to be eliminated (Baldwin et al., (1986) Lancet (March 15, 1986): 603-05; Thorpe, (1985) "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", in Monoclonal Antibodies '84: Biological And Clinical Applications, A. Pinchera et al. (eds.), pp. 475-506; Syrigos and Epenetos (1999) Anticancer Research 19: 605-614; Niculescu-Duvaz and Springer (1997) Adv. Drug. 19: 605-614). Del.Rev.26:151-172; US Pat. No. 4,975,278).

[0219]

[0242] In certain embodiments, the cytotoxic agent may be any agent that is harmful to cells or can damage or kill cells. In certain embodiments, the cytotoxic agent is optionally a toxin, a chemotherapeutic agent (e.g., a DNA alkylating agent, a topoisomerase inhibitor, a tubulin binding agent, a proliferation inhibitor, or other anti-cancer drug), or a radioisotope.

[0220]

[0243] Exemplary toxins include bacterial and plant toxins, such as diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin, alvin, modeccin, alpha-sarcin, Abrasiongum protein, dianthin protein, Phytolacca americana protein (PARI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, soapwort inhibitor, gelonin, restrictocin, phenomycin, enomycin, and trichothecenes (see, e.g., WO 93 / 21232). Such large molecule toxins can be conjugated to the antibodies or antigen-binding fragments provided herein using methods known in the art, for example, as described in Vitetta et al. (1987) Science, 238:1098.

[0221]

[0244] Cytotoxic agents also include small molecule toxins and chemotherapeutic agents, such as geldanamycin (Mandler et al. (2000) Jour. of the Nat. Cancer Inst. 92(19):1573-1581; Mandler et al. (2002) Bioconjugate Chem. 13:786-791), maytansine and maytansinoids (EP 1391213; Liu et al. (1996) Proc. Natl. Acad. Sci. USA 93:8618-8623; U.S. Pat. No. 5,208,020), calicheamicin (Lode et al. (1998) Cancer Res. 58:2928; Hinman et al. (1993) Cancer Res.53:3336-3342), taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, vindesine, colchicine, doxorubicin, daunorubicin, dihydroxyanthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin and its analogs, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil, decarbazine), alkylating agents (e.g., mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamineplatinum(II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), xorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and antimitotics (e.g., vincristine and vinblastine), calicheamicins, maytansinoids, dolastatins, uristatins such as MMAE and MMAF (U.S. Pat. Nos. 5,635,483, 5,780,588), dolostatin, trichothecenes, and CC1065, and derivatives thereof that have cytotoxic activity.

[0222]

[0245] The cytotoxic agent can also be a highly radioactive isotope. Examples include At 211 , I 131 , I 125 , Y 90 , Re 186 , Sm 153 , Bi 212 , P 32 , Pb 212, and radioisotopes of Lu. Methods for conjugating radioisotopes to antibodies via suitable ligand reagents are known in the art (see, for example, WO94 / 11026; Current Protocols in Immunology, Vol. 1 and Vol. 2, Coligen et al., eds. Wiley-Interscience, New York, NY, Pubs. (1991)). The ligand reagent has a chelating ligand that can bind, chelate or otherwise complex with a radioisotope metal, and also has a functional group that is reactive with the thiol of cysteine ​​of an antibody or antigen-binding fragment. Exemplary chelating ligands include DOTA, DOTP, DOTMA, DTPA and TETA (Macrocyclics, Dallas, Tex.).

[0223]

[0246] The cytotoxic agent may be linked to the antibody or antigen-binding fragment via any suitable linker known in the art, see, e.g., U.S. Pat. Nos. 5,208,020, 6,441,163, or European Patent No. 0 425 235 B1, Chari et al., Cancer Research 52:127-131 (1992), and US2005 / 0169933A1, the disclosures of which are expressly incorporated herein by reference.

[0224]

[0247] In certain embodiments, the linker is cleavable under certain physiological conditions, thereby facilitating the release of the cytotoxic drug in cells. For example, the linker can be an acid-labile linker, a peptidase-sensitive linker, a photolabile linker, a dimethyl linker or a disulfide-containing linker, a thioether linker, and an esterase-labile linker (Chari et al., Cancer Research 52:127-131 (1992); U.S. Patent No. 5,208,020). In some embodiments, the linker can include amino acid residues such as dipeptides, tripeptides, tetrapeptides, or pentapeptides. The amino acid residues in the linker can be naturally occurring or non-naturally occurring amino acid residues. Examples of such linkers include: valine-citrulline (ve or val-cit), alanine-phenylalanine (af or ala-phe), glycine-valine-citrulline (gly-yal-cit), glycine-glycine-glycine (gly-gly-gly), valine-citrulline-p-aminobenzyloxycarbonyl ("vc-PAB"). Amino acid linker components can be designed and optimized for their selectivity for enzymatic cleavage by specific enzymes, such as tumor-associated proteases, cathepsins B, C and D, or plasmin proteases.

[0225]

[0248] In certain embodiments, the cytotoxic agent may be, for example, N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC), N-succinimidyl-4-(2-pyridylthio)pentanoate (SPP), iminothiolane (IT), bifunctional derivatives of imidoesters (e.g., dimethyladipimidate HCl), active esters (e.g., disuccinimidyl suberate), aldehydes (e.g., glutaraldehyde), bis-azido compounds (e.g., bis(p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (e.g., bis-(p-diazonium benzoyl)benzoate), ... The antibodies or antigen-binding fragments thereof provided herein may be linked by bifunctional linker reagents including succinimidyl-(4-vinylsulfone)benzoate (e.g., succinimidyl-(4-vinylsulfone)benzoate), diisocyanates (e.g., toluene 2,6-diisocyanate), bis-active fluorine compounds (e.g., 1,5-difluoro-2,4-dinitrobenzene), BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPRH, SBAP, SIA, SIAB, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB. These linker reagents are commercially available (see, e.g., Pierce Biotechnology, Inc., Rockford, Ill., USA, pp. 467-498, 2003-2004 Applications Handbook and Catalog).

[0226]

[0249] In certain embodiments, in the ADCs provided herein, the antibody (or antigen-binding fragment thereof) is conjugated to one or more cytotoxic agents at an antibody:agent ratio of about 1 to about 20, about 1 to about 6, about 2 to about 6, about 3 to about 6, about 2 to about 5, about 2 to about 4, or about 3 to about 4.

[0227]

[0250] The ADCs provided herein can be prepared by any suitable method known in the art. In certain embodiments, the nucleophilic group of an antibody (or antigen-binding fragment thereof) is first reacted with a bifunctional linker reagent and then linked to a cytotoxic agent, or the order is reversed, i.e., the nucleophilic group of the cytotoxic agent is first reacted with the bifunctional linker and then linked to the antibody.

[0228]

[0251] In certain embodiments, the cytotoxic agent can contain (or be modified to contain) a thiol-reactive functional group capable of reacting with a cysteine ​​thiol of a free cysteine ​​of an antibody or antigen-binding fragment provided herein. Exemplary thiol-reactive functional groups include, for example, maleimides, iodoacetamides, pyridyl disulfides, haloacetyls, succinimidyl esters (e.g., NHS, N-hydroxysuccinimide), isothiocyanates, sulfonyl chlorides, 2,6-dichlorotriazinyl, pentafluorophenyl esters, or phosphoramidites ((Haugland, 2003, Molecular Probes Handbook of Fluorescent Probes and Research Chemicals, Molecular Probes, Inc.; Brinkley, 1992, Bioconjugate Chem. 3:2; Garman, 1997, Non-Radioactive Labelling: A Practical Approach, Academic Press, London; Means (1990) Bioconjugate Chem. 1:2; Hermanson, G. in Bioconjugate Techniques (1996) Academic Press, San Diego, pp. 40-55, 643-671).

[0229]

[0252] A cytotoxic agent or an antibody may be reacted with a linking reagent and then conjugated to form an ADC. For example, an N-hydroxysuccinimidyl ester (NHS) of a cytotoxic agent may be performed, isolated, purified, and / or characterized, or may be formed in situ and reacted with a nucleophilic group of an antibody. Typically, the carboxyl form of the conjugate is activated by reacting with some combination of a carbodiimide reagent, such as dicyclohexylcarbodiimide; diisopropylcarbodiimide, or a uronium reagent, such as TsTu (O--(N-succinimidyl)-N,N,N',N'-tetramethyluronium tetrafluoroborate, HBTU (O-benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate) or HATU (O-(7-azabenzotriazol-1-yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate), an activating agent such as 1-hydroxybenzotriazole (HOBt) and N-hydroxysuccinimide to give an NHS ester (activated by reacting with some combination). In some cases, the cytotoxic agent and the antibody can be linked by in situ activation and reaction to form an ADC in one step. Other activating and linking reagents include TBTU (2-(1H-benzotriazo-1-yl)-1-1,3,3-tetramethyluronium hexafluorophosphate), TFFH (N,N',N'',N''-tetramethyluronium 2-fluoro-hexafluorophosphate), PyBOP (benzotriazol-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate, EEDQ (2-ethoxy-1-ethoxycarbonyl-1,2-dihydro-quinoline), DCC (dicyclohexylcarbodiimide); DIPCDI (diisopropylcarbodiimide), MSNT (1-(mesitylene-2-sulfonyl)-3-nitro-1H-1,2,4-triazole, and arylsulfonyl halides such as triisopropylbenzenesulfonyl chloride.In another example, an antibody or antigen-binding fragment may be conjugated to biotin and then indirectly conjugated to a second conjugate that is conjugated to avidin.

[0230]

[0253] Polynucleotides and Recombinant Methods

[0254] The present disclosure provides isolated polynucleotides encoding anti-hVEGFR2 antibodies and their antigen-binding fragments.As used herein, the terms "nucleic acid" or "polynucleotide" refer to deoxyribonucleic acid (DNA) or ribonucleic acid (RNA) and polymers thereof, either in single-stranded or double-stranded form.Unless otherwise specified, a specific polynucleotide sequence also implicitly encompasses its conservatively modified variants (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions can be made by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and / or deoxyinosine residues (see Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell Probes 8:91-98 (1994)).

[0231]

[0255] DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes capable of binding specifically to genes encoding the heavy and light chains of the antibody). The encoding DNA may also be obtained by synthetic methods.

[0232]

[0256] The present disclosure provides a vector (e.g., an expression vector) comprising the isolated polynucleotide provided herein. In certain embodiments, the expression vector provided herein comprises a polynucleotide encoding an antibody or antigen-binding fragment thereof provided herein, at least one promoter (e.g., SV40, CMV, EF-1α) operably linked to the polynucleotide sequence, and at least one selectable marker. Examples of vectors include, but are not limited to, retroviruses (including lentiviruses), adenoviruses, adeno-associated viruses, herpes viruses (e.g., herpes simplex viruses), poxviruses, baculoviruses, papilloma viruses, papova viruses (e.g., SV40), lambda phage, and M13 phage, plasmids such as pcDNA3.3, pMD18-T, pOptivec, pCMV, pEGFP, pIRES, pQD-Hyg-GSeu, pALTER, pBAD, pcDNA, pCal, pL, pET , pGEMEX, pGEX, pCI, pEGFT, pSV2, pFUSE, pVITRO, pVIVO, pMAL, pMONO, pSELECT, pUNO, pDUO, Psg5L, pBABE, pWPXL, pBI, p15TV-L, pPro18, pTD, pRS10, pLexA, pACT2.2, pCMV-SCRIPT (registered trademark), pCDM8, pCDNA1.1 / amp, pcDNA3.1, pRc / RSV, PCR2.1, pEF-1, pFB, pSG5, pXT1, pCDEF3, pSVSPORT, pEF-Bos, and the like.

[0233]

[0257] A vector containing a polynucleotide sequence encoding an antibody or an antigen-binding fragment thereof can be introduced into a host cell for cloning or gene expression. As used herein, suitable host cells for cloning or expressing the DNA of a vector are the above-mentioned prokaryotic cells, yeast cells, or higher eukaryotic cells. Suitable prokaryotes for this purpose include eubacteria, such as gram-negative or gram-positive bacteria, such as Enterobacteriaceae, such as Escherichia, such as E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, such as Salmonella typhimurium, Serratia, such as Serratia marcescens, and Shigella, as well as Bacillus, such as Bacillus subtilis and B. licheniformis, Pseudomonas, such as Pseudomonas aeruginosa, and Streptomyces.

[0234]

[0258] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for anti-hVEGFR2 antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. However, several other genera, species, and strains are commonly available and useful herein: for example, Schizosaccharomyces pombe; Kluyveromyces spp. hosts, such as K. lactis, K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. wartsii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K. thermotolerans, and K. marchii. cyanus, etc.; Yarrowia (EP 402,226); Pichia pastoris (EP 183,070); Candida; Trichoderma lesia (EP 244,234); Neurospora crassa; Schwanniomyces, e.g., Schwanniomyces oxidentalis; and filamentous fungi, e.g., Neurospora, Penicillium, Tolypocladium, etc., and Aspergillus hosts, e.g., A. nidulans and A. niger.

[0235]

[0259] Suitable host cells for the expression of glycosylated antibodies or antigen-fragments provided herein are derived from multicellular organisms, such as invertebrate cells, such as plant cells and insect cells. A number of baculovirus strains and variants from hosts, such as Fall Armyworm (caterpillar), Aedes aegypti (mosquito), Aedes melanogaster (mosquito), Drosophila melanogaster (fruit fly), and Bombyx mori, and corresponding permissive insect host cells have been identified. A variety of virus strains for transfection, such as the L-1 variant of Pseudomonas nigroma NPV and the Bm-5 strain of Bombyx mori NPV, are publicly available, and such viruses can be used as viruses herein according to the present invention, particularly for the transfection of Fall Armyworm cells. Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be used as hosts.

[0236]

[0260] However, interest has been greatest in vertebrate cells, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are: SV40 transformed monkey kidney CV1 line (COS-7, ATCC CRL1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL10); Chinese hamster ovary cells / -DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); mouse Sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL34); buffalo rat hepatocytes (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL75); human hepatocytes (Hep G2, HB 8065); mouse mammary tumor (MMT060562, ATCC CCL51); TRI cells (Mather et al., Annals NYAcad. Sci. 383:44-68 (1982)); MRC5 cells; FS4 cells; and human hepatoma line (Hep G2). In some preferred embodiments, the host cells are mammalian cultured cell lines, such as CHO, BHK, NS0, 293, and derivatives thereof. In some preferred embodiments, the host cells are CHO and derivatives thereof.

[0237]

[0261] Host cells are transformed with the above-described expression or cloning vectors for producing anti-hVEGFR2 antibodies and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying genes encoding the desired sequences. In another embodiment, antibodies can be produced by homologous recombination as known in the art.

[0238]

[0262] The host cells used to produce the antibodies or antigen-binding fragments provided herein can be cultured in a variety of media. Commercially available media, such as Ham's F10 (Sigma), Minimum Essential Medium (MEM) (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium (DMEM) (Sigma), are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58:44 (1979), Barnes et al., Anal. Biochem. 102:255 (1980), U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90 / 03430; WO 87 / 00195; or U.S. Pat. No. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented, if necessary, with hormones and / or other growth factors (e.g., insulin, transferrin or epidermal growth factor), salts (e.g., sodium chloride, calcium, magnesium, and phosphate), buffers (e.g., HEPES), nucleotides (e.g., adenosine and thymidine), antibiotics (e.g., GENTAMYCIN™ drug), trace elements (usually defined as inorganic compounds present in final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary nutritional supplements may also be included at appropriate concentrations that would be known to those skilled in the art. Culture conditions such as temperature, pH, etc. are those conventionally used with the host cell selected for expression and will be apparent to those skilled in the art.

[0239]

[0263] When using recombinant techniques, antibodies can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If antibodies are produced intracellularly, as a first step, particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio / Technology 10:163-167 (1992) describe a procedure for isolating antibodies secreted into the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonyl fluoride (PMSF) for about 30 minutes. Cell debris can be removed by centrifugation. If antibodies are secreted into the medium, the supernatant from such expression systems is generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the preceding steps to inhibit proteolysis, and an antibiotic may be included to prevent the growth of adventitious contaminating bacteria.

[0240]

[0264] Anti-hVEGFR2 antibodies and antigen-binding fragments thereof prepared from cells can be purified using, for example, hydroxyapatite chromatography, gel electrophoresis, dialysis, DEAE cellulose ion exchange chromatography, ammonium sulfate precipitation, salting out, and affinity chromatography, with affinity chromatography being the preferred purification technique.

[0241]

[0265] In certain embodiments, Protein A immobilized on a solid phase is used for immunoaffinity purification of antibodies and their antigen-binding fragments. The suitability of Protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain present in the antibody. Protein A can be used to purify antibodies based on human gamma 1, gamma 2, or gamma 4 heavy chains (Lindmark et al., J. Immunol. Meth. 62:1-13 (1983)). Protein G is recommended for all mouse isotypes and for human gamma 3 (Guss et al., EMBO J. 5:1567-1575 (1986)). The matrix to which the affinity ligand is attached is most often agarose, although other matrices are available. Mechanically stable matrices, such as controlled pore glass or poly(styrenedivinyl)benzene, allow faster flow rates and shorter processing times than can be achieved with agarose. If the antibody contains a CH3 domain, Bakerbond ABX™ resin (JT Baker, Phillipsburg, NJ) is useful for purification. Other techniques for protein purification, such as fractionation on ion exchange columns, ethanol precipitation, reverse-phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSE™ chromatography on anion or cation exchange resins (e.g., polyaspartic acid columns), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation, are also available depending on the antibody to be recovered.

[0242]

[0266] After any preliminary purification steps, the mixture containing the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer performed at a pH between about 2.5-4.5, preferably with a low salt concentration (e.g., about 0 to 0.25 M salt).

[0243]

[0267] Pharmaceutical Compositions

[0268] The present disclosure further provides pharmaceutical compositions comprising an anti-hVEGFR2 antibody, or antigen-binding fragment thereof, and one or more pharma- ceutically acceptable carriers.

[0244]

[0269] Pharmaceutically acceptable carriers for use in the pharmaceutical compositions disclosed herein can include, for example, pharma- ceutically acceptable liquid, gel, or solid carriers, aqueous vehicles, non-aqueous vehicles, antimicrobial agents, isotonic agents, buffers, antioxidants, anesthetics, suspending / dispending agents, sequestering or chelating agents, diluents, adjuvants, excipients, or non-toxic auxiliary agents, other ingredients known in the art, or various combinations thereof.

[0245]

[0270] Suitable ingredients can include, for example, antioxidants, fillers, binders, disintegrants, buffers, preservatives, lubricants, flavorings, thickeners, colorings, emulsifiers, or stabilizers such as sugars and cyclodextrins. Suitable antioxidants can include, for example, methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum, catalase, citric acid, cysteine, thioglycerol, thioglycolic acid, thiosorbitol, butylated hydroxyanisole, butylated hydroxytoluene, and / or propyl gallate. As disclosed herein, the inclusion of one or more antioxidants, such as methionine, in compositions comprising the antibodies or antigen-binding fragments and conjugates provided herein reduces the oxidation of the antibodies or antigen-binding fragments. Such reduction in oxidation prevents or reduces the loss of binding affinity, thereby improving antibody stability and maximizing shelf life. Thus, in certain embodiments, compositions are provided that include one or more antibodies or antigen-binding fragments disclosed herein and one or more antioxidants, such as methionine. Additionally, methods are provided to prevent oxidation of the antibodies or antigen-binding fragments provided herein, extending their shelf life, and / or improving their effectiveness by combining the antibodies or antigen-binding fragments provided herein with one or more antioxidants, such as methionine.

[0246]

[0271] To further illustrate, pharma- ceutically acceptable carriers include, for example, aqueous vehicles such as Sodium Chloride Injection, Ringer's Solution, Isotonic Dextrose Injection, Sterile Water Injection, or Dextrose and Lactated Ringer's Injection; non-aqueous vehicles such as fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil, or peanut oil; antimicrobial agents in bacteriostatic or fungistatic concentrations; isotonic agents such as sodium chloride or dextrose; buffers such as phosphate or citrate buffers; antioxidants such as sodium bisulfate; local anesthetics. The carrier may include drugs such as procaine hydrochloride, suspending and dispersing agents such as sodium carboxymethylcellulose, hydroxypropylmethylcellulose, or polyvinylpyrrolidone, emulsifying agents such as polysorbate 80 (TWEEN®-80), sequestering or chelating agents such as EDTA (ethylenediaminetetraacetic acid) or EGTA (ethylene glycol tetraacetic acid), ethyl alcohol, polyethylene glycol, propylene glycol, sodium hydroxide, hydrochloric acid, citric acid, or lactic acid. Antimicrobial agents utilized as carriers may be added to pharmaceutical compositions in multi-dose containers, including phenol or cresol, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride, and benzethonium chloride. Suitable excipients may include, for example, water, saline, dextrose, glycerol, or ethanol. Suitable nontoxic auxiliary substances can include, for example, wetting or emulsifying agents, pH buffering agents, stabilizing agents, solubility enhancers, or agents such as sodium acetate, sorbitan monolaurate, triethanolamine oleate, or cyclodextrins.

[0247]

[0272] The pharmaceutical compositions can be liquid solutions, suspensions, emulsions, pills, capsules, tablets, sustained release formulations, or powders. Oral formulations can include standard carriers, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinylpyrrolidone, sodium saccharine, cellulose, magnesium carbonate, and the like.

[0248]

[0273] In certain embodiments, the pharmaceutical composition is formulated into an injectable composition.The injectable pharmaceutical composition can be prepared in any conventional form, such as liquid solution, suspension, emulsion, or solid form suitable for producing liquid solution, suspension or emulsion.The preparation for injection can include sterile and / or non-pyrogenic solution ready for injection, sterile dry soluble, such as lyophilized powder, ready to be combined with solvent immediately before use, including subcutaneous tablets, sterile suspension ready for injection, sterile dry insoluble, ready to be combined with vehicle immediately before use, and sterile and / or non-pyrogenic emulsion.The solution can be either aqueous or non-aqueous.

[0249]

[0274] In certain embodiments, unit dose parenteral preparations are packaged in an ampoule, vial, or syringe with a needle. All preparations for parenteral administration are required to be sterile and non-pyrogenic, as is known and practiced in the art.

[0250]

[0275] In certain embodiments, a sterile, freeze-dried powder is prepared by dissolving the antibody or antigen-binding fragment disclosed herein in a suitable solvent. The solvent may contain excipients to improve stability or other pharmacological components of the powder or reconstituted solution prepared from the powder. Excipients that may be used include, but are not limited to, water, dextrose, sorbital, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agents. The solvent may contain a buffer, such as citrate, sodium or potassium phosphate, or other such buffer known to those of skill in the art, in one embodiment, at about neutral pH. Subsequent sterile filtration of the solution followed by lyophilization under standard conditions known to those of skill in the art provides the desired formulation. In one embodiment, the resulting solution is apportioned into vials for lyophilization. Each vial may contain a single dose or multiple doses of an anti-hVEGFR2 antibody or antigen-binding fragment thereof, or a composition thereof. Overfilling the vial by a small amount (e.g., about 10%) beyond that needed for a dose or series of doses is permissible to facilitate accurate sampling and accurate dosing. The lyophilized powder can be stored under appropriate conditions, such as at about 4° C. to room temperature.

[0251]

[0276] Reconstitution of the lyophilized powder with water for injection provides a formulation for use in parenteral administration. In one embodiment, for reconstitution, sterile water and / or non-pyrogenic water, or other liquid suitable carrier, is added to the lyophilized powder. The exact amount depends on the selected therapy being given, but may be empirically determined.

[0252]

[0277] How to use

[0278] The present disclosure also provides methods of treatment comprising administering a therapeutically effective amount of an antibody or antigen-binding fragment provided herein and / or a pharmaceutical composition provided herein to a subject in need thereof, thereby treating, reducing the severity of, and / or delaying the progression of a VEGFR2-related disease or condition in the subject.

[0253]

[0279] In some embodiments, the VEGFR2-associated disease or condition is a tumor or angiogenic disease.

[0254]

[0280] tumor

[0281] In certain embodiments, the VEGFR2-related disease or condition is a tumor, such as a solid tumor or a non-solid tumor. In some embodiments, the tumor produces VEGF (e.g., VEGF-A) and / or is sensitive to VEGF (e.g., VEGF-A) present in its microenvironment. Studies have observed VEGF production and VEGFR2 expression in solid tumors or non-solid tumors, such as human leukemia (Sato, K. et al., Tohoku J. Exp. Med., 185:173-84 (1998); Ishii, Y., Nippon Sanka Fujinka Gakkai Zasshi: 47:133-40 1995); and Ferrer, FA et al., Urology, 54:567-72 (1999); Fielder et al., Blood 89:1870-5 (1997) and Bellamy et al., Cancer Res. 59:728-33 (1999)). Without wishing to be bound by theory, it has been further demonstrated that the VEGF / hVEGFR2 autocrine loop modulates tumor cell survival and migration in vivo, and that VEGFR1 monoclonal antibodies inhibited the autocrine VEGF / VEGFR1 loop in certain solid tumor cells, e.g., breast cancer cells, and inhibited VEGF-stimulated migration of human leukemia cells (see, e.g., U.S. Patent No. 7,498,414 (B2)).

[0255]

[0282] In certain embodiments, the solid tumor is selected from the group consisting of breast cancer, lung cancer, colorectal cancer, pancreatic cancer, glioma and lymphoma, for example, head and neck tumor, colorectal tumor, prostate tumor, breast tumor, lung tumor such as small cell lung tumor and non-small cell lung tumor, pancreatic tumor, thyroid tumor, ovarian tumor, cervical tumor, kidney tumor, brain tumor, and liver tumor, Kaposi's sarcoma, CNS neoplasm, neuroblastoma, capillary hemangioblastoma, meningioma, brain metastasis, melanoma, gastrointestinal and renal carcinoma and sarcoma (e.g., gastric cancer), rhabdomyosarcoma, glioblastoma, preferably glioblastoma multiforme, leiomyosarcoma, squamous cell carcinoma, basal cell carcinoma, and skin cancer that can be treated by suppressing the proliferation of malignant keratinocytes, such as human malignant keratinocytes. In certain embodiments, the solid tumor is selected from the group consisting of gastric cancer, non-small cell lung cancer, such as large cell lung cancer.

[0283] In certain embodiments, the non-solid tumor is selected from the group consisting of leukemia, multiple myeloma, and lymphoma, such as acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), erythrocytic or monocytic leukemia, Hodgkin's lymphoma, and non-Hodgkin's lymphoma.

[0256]

[0284] Angiogenic disease

[0285] In certain embodiments, VEGFR2-related disease or condition is angiogenesis disease.Angiogenesis disease is related to uncontrolled angiogenesis, which can be regulated by VEGF, for example, VEGF-A.VEGF expression can be found in fetal tissue, macrophages, and epidermal keratinocytes proliferating during wound healing (Breier et al., Development, 114:521-32 (1992); Brown et al., J.Exp.Med., 176:1375-9 (1992); and Ferrara et al., Endocr.Rev, 13:18-32 (1992)). High expression of VEGF can also be found in tumors such as glioblastoma multiforme, hemangioblastoma, central nervous system neoplasms and AIDS-associated Kaposi's sarcoma; in atherosclerotic lesions, plaques and in inflammatory cells (Nakamura, S. et al., AIDS Weekly, 13(1) (1992); Plate, K. et al., Nature, 359:845-8 (1992); Plate, K. et al., Cancer Res., 53:5822-7 (1993); and Berkman, R. et al., J. Clin. Invest., 91:153-9 (1993)). Without wishing to be bound by theory, endothelial cells adjacent to VEGF-expressing tumor cells generally show upregulated expression of VEGF receptors, e.g., VEGFR2. The release of VEGF by tumors leads to the stimulation of angiogenesis in adjacent endothelial cells, which results in endothelial cell proliferation, migration, differentiation, tube formation, maintenance of vascular integrity and increased vascular permeability. Thus, abnormalities in VEGF / VEGFR2 signaling involved in angiogenic diseases can be treated by anti-VEGFR2 antibodies or antigen-binding fragments thereof provided by the present disclosure.

[0257]

[0286] In some embodiments, the angiogenic disease is atherosclerosis, rheumatoid arthritis (RA), neovascular glaucoma, proliferative retinopathies including proliferative diabetic retinopathy, macular degeneration, hemangiomas, angiofibromas, psoriasis, retinopathy of prematurity (e.g., retrolental fibroplasia), corneal graft rejection, insulin-dependent diabetes mellitus, multiple sclerosis, myasthenia gravis, Crohn's disease, autoimmune nephritis, primary biliary cirrhosis, acute pancreatitis, allograft rejection, allergic inflammation, contact dermatitis and delayed hypersensitivity reactions, inflammatory bowel disease, septic shock, osteoporosis, osteoarthritis, cognitive impairment caused by neuroinflammation, Osler-Weber syndrome, restenosis, and fungal, parasitic and viral infections such as cytomegalovirus infection.

[0258]

[0287] In some embodiments, the subject is a human.

[0259]

[0288] The antibodies or antigen-binding fragments provided herein, and / or the pharmaceutical compositions provided herein can be administered via oral, nasal, intravenous, subcutaneous, sublingual, intratumor, or intramuscular administration.

[0260]

[0289] In some embodiments, the methods provided herein further include administering a therapeutically effective amount of a second therapeutic agent, e.g., an anti-cancer therapy, optionally selected from a chemotherapeutic agent, radiation therapy, an immunotherapy, an anti-angiogenic agent (e.g., an antagonist of VEGFR, such as VEGFR-1, VEGFR-2, and VEGFR-3), an EGFR antagonist, a PDGFR antagonist, an IGFR antagonist, an NGFR antagonist, an FGFR antagonist, a targeted therapy, a cell therapy, a gene therapy, a hormone therapy, a cytokine, palliative care, surgery for the treatment of cancer (e.g., tumor removal), one or more antiemetic agents, treatment of complications resulting from chemotherapy, or a dietary supplement for cancer patients (e.g., indole-3-carbinol).

[0261]

[0290] In some embodiments, the disclosure provides kits comprising an antibody or antigen-binding fragment thereof provided herein, optionally conjugated to a detectable moiety. The kits may be useful in detecting the presence or amount of hVEGFR2 in a biological sample and may be useful in the methods of diagnosis provided herein.

[0262]

[0291] In some embodiments, the present disclosure provides a kit comprising an antibody or antigen-binding fragment thereof provided herein and a second therapeutic agent. The kit may be useful in treating, preventing, and / or ameliorating a VEGFR2-related disease or condition.

[0263]

[0292] The present disclosure also provides a method of detecting the presence or amount of VEGFR2 in a sample, comprising contacting the sample with an antibody or antigen-binding fragment thereof provided herein and determining the presence or amount of VEGFR2 in the sample.

[0264]

[0293] In some embodiments, the present disclosure also provides the use of an antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating, reducing the severity of, and / or delaying the progression of a VEGFR2-related disease or condition in a subject. EXAMPLES

[0265] Example 1: Preparation and characterization of VEGFR2 protein

[0294] Human VEGFR2 / KDR-His: Recombinant human VEGFR / KDR protein (hVEGFR2-his, accession number AAI31823.1) was expressed in human 293 cells (HEK293). Briefly, the coding region of human VEGFR2 gene from Ala20 to Glu764 with a 6xhis tag at the C-terminus was used for transfection. The supernatant was purified using a His-tag affinity column. The resulting purified protein was characterized using SDS-page gel. The above protein was purchased from ACRO Biosystems (Cat#KDR-H5227).

[0266]

[0295] Rhesus VEGFR2 / KDR with His tag: Recombinant rhesus VEGFR2 / KDR protein extracellular domain Ala20-Glu764 (Accession no. XP_014994176.1) was fused with a polyhistidine tag at the C-terminus and produced in human 293 cells (HEK293). Transfection supernatant from HEK293 cells was purified using a His-tag affinity column. The resulting purified protein was characterized using SDS-page gel. The above protein was purchased from ACRO Biosystems (Cat#VE2-C52H3).

[0267]

[0296] The VEGFR2 protein described above was used in the following experiments.

[0268] Example 2: Antibody Generation

[0297] 1. Antigen Conjugation and Immunization

[0298] For immunization, recombinant hVEGFR2-his protein was conjugated with various MabSpace immune enhancing peptides. Briefly, a 2- to 8-fold molar excess of peptides was mixed with Sulfo-SMCC (sulfosuccinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate, Peirce #22322)-activated hVEGFR2 protein and incubated for 1 hour at room temperature. The reaction was stopped and the conjugated proteins were analyzed using SDS-PAGE gels and QC was performed.

[0269]

[0299] The above conjugated hVEGFR2-his proteins were emulsified in a 1:1 ratio using complete Freund's adjuvant (Pierce), and then immunized subcutaneously and intraperitoneally into C57B / L6 mice. To maintain the native conformation of the protein, booster immunizations were performed using CpG and alum. Immunizations were performed at least every 2 weeks, and antisera from mice were collected after the first immunization for anti-hVEGFR2 titer analysis by ELISA assay.

[0270]

[0300] For serum titer determination, 20 μl of mouse serum was prepared from each immunized mouse. High-binding clear polystyrene 96-well plates (Nunc) were coated with 100 μl / well of a 1 μg / ml solution composed of human VEGFR2-his in high pH coating buffer (0.16% Na2CO3, 0.3% NaHCO3, pH 9.8). Plates were incubated overnight at 4° C. and then washed once in an automated plate washer using wash buffer PBS+0.1% Tween® 20 (Sigma). 200 μl of blocking buffer (PBS+1% BSA+1% goat serum+0.05% Tween® 20) was added to each well and incubated for 2 hours at room temperature. The blocking buffer was then aspirated and 100 μl of serum serially diluted in dilution buffer (PBS+1% BSA+1% goat serum+0.01% Tween®20) was transferred to each well of the ELISA plate and incubated for 60 min at room temperature. The plate was then washed three times using the method described above. 100 μl / well of a solution of HRP-conjugated goat anti-mouse Fc antibody (Abcam, Cat#Ab98808) diluted in dilution buffer was then added to each well of the plate. The ELISA plate was then incubated for 60 min at RT and the plate was washed three times with 250 μl / well of wash buffer. Finally, 100 μl / well of TMB was added to each well and the reaction was terminated using 0.64 M H2SO4. The plate was read at 450 nM on a Thermo Multiscan FC.

[0271]

[0301] 2.Fusion

[0302] Four days prior to fusion, each mouse was boosted intraperitoneally with unconjugated hVEGFR2 protein in PBS. On the day of fusion, the spleen was aseptically removed and the organ was processed into a single cell suspension. Red blood cells were lysed and splenocytes were washed with DMEM (Gibco). Live logarithmic growth phase myeloma cells (SP2 / 0) were mixed with mouse splenocytes at a 1:4 ratio. The cells were then washed twice prior to fusion with PEG. The fused cells were washed with DMEM and suspended in cell growth medium supplemented with 10% FBS+HFCS+OPI+1×HAT. 200 μl per well of this cell suspension was plated into a 96-well cell culture plate and incubated overnight in a humidified 10% CO2 incubator at 37°C. The cultures were incubated for 7 days, then the growth medium was aspirated from the wells and replaced with fresh growth medium. Screening of hybridoma supernatants was initiated 2–3 days after medium change.

[0272]

[0303] 3. Antibody Screening by ELISA Assay

[0304] Same protocol as above for serum titer determination. Briefly, hVEGFR2-his 0.5μg / ml was coated overnight at 4℃. After washing, 100μl of hybridoma supernatant was added and allowed to bind completely. HRP-conjugated goat anti-mouse Fc antibody was then added to detect bound hVEGFR2 antibody. Finally, after TMB reaction and H2SO4 termination, the plate was read at 450nM on a Thermo Multiscan FC. Cells from ELISA-positive hybridoma wells were subsequently expanded in cell culture for further characterization studies.

[0273] Example 3: Subcloning of positive hybridoma clones and small-scale antibody production

[0305] 1. Subcloning of positive hybridoma clones

[0306] Cells from ELISA positive hybridoma wells with desired binding profile and blocking activity were selected and plated in 96-well plate respectively using limiting dilution. These cells were grown for 7 days. When appropriate cell amount was reached, the supernatant from each well was collected and rescreened for antigen binding ability (see screening in Example 2).

[0274]

[0307] From each 96-well plate, clones with the highest antigen binding activity were identified and expanded by further limiting dilution into 96-well plates containing 200 μl of hybridoma growth medium per well. After 7 days, cells from the 96-well plates were tested for antigen binding. Subcloning was performed three or more times. When more than 90 wells showed positive binding signals, two clones with the highest antigen binding activity were identified and transferred to 24-well plates containing medium and expanded for another 2 days. When the 24-well plates were confluent, the cells were transferred to 6-well plates. After 5 days of incubation, a portion of the cells was frozen. The rest of the cells were transferred to flasks and expanded. When the flasks were confluent, half of the cells were frozen (3 vials per clone) for additional backup. The remaining half was further expanded in flasks containing medium for antibody production. Isotype was determined using standard methods.

[0275]

[0308] 2. Small-scale Antibody Production

[0309] Hybridoma cells were inoculated into roller bottles and cultured in 200-300 ml of hybridoma culture medium (Invitrogen) for 14 days. VEGFR2 monoclonal antibodies (mAbs) were purified from the hybridoma cell cultures as follows. All purification processes were carried out at room temperature. One purification scheme was used to purify the various mAbs, which used affinity chromatography.

[0276]

[0310] The host cell culture fluid (CCF) was centrifuged to remove cell debris, and the CCF supernatant was then filtered, diluted, and then loaded onto a protein G chromatography medium in the form of a column, Protein G High Performance (Bio-Rad), and allowed to equilibrate.

[0277]

[0311] After loading, the Protein G column was washed until the flow-through absorbance at 280 nm returned to baseline. The VEGFR2 mAb was then eluted from the column using glycine, pH 2.5, and immediately neutralized by adding 50 μL of 1 M Tris base stock solution per mL of elution volume. The absorbance at 280 nm of the eluate was monitored, and fractions containing protein were collected to generate the Protein A pool.

[0278]

[0312] Following purification, the VEGFR2 mAb was formulated in PBS by dialysis using a 10,000 MWCO membrane (Pierce Slide-A-Lyzer or dialysis tubing). Following formulation, the VEGFR2 mAb was filtered.

[0279] Example 4: Binding analysis of purified VEGFR2 antibodies

[0313] The same protocol as antibody screening by ELISA assay in Example 2. Briefly, hVEGFR2-his 0.5μg / ml was coated, and serially diluted purified antibodies were allowed to bind to the coated antigen. The binding signal of each antibody could be detected using HRP-conjugated goat anti-mouse Fc antibody.

[0280]

[0314] The data was calculated and fitted by Graphpad Prism Software and the EC50s of the antibodies are summarized in Figures 1A-1B and Table 6. The hybridoma antibodies have similar affinities to humans.

[0281] [Table 6]

[0282] Example 5: Evaluation of blocking activity of purified antibodies that inhibit hVEGF-A binding to hVEGFR2

[0315] High-binding clear polystyrene 96-well plates were coated overnight at 4°C with 100 μl / well of hVEGFR2-his 1 μg / ml. After washing and blocking, serially diluted antibodies (10 μg / ml to 0.0006 μg / ml) were added and incubated at RT for 1 h. hVEGF-A (Acrobiosystem, Cat#VE5-H4210) 0.3 μg / ml was added and incubated at RT for 2 h. Biotinylated rabbit anti-human VEGF-A (Peprotech, Cat#400-P10Bt) 0.25 μg / ml was then added at 100 μl / well to detect bound VEGF-A. A solution of HRP-conjugated neutravidin antibody (Pierce, Cat#31001) and TMB was then added sequentially at 100 μl / well. Finally, the reaction was terminated using 0.64M H2SO4 and the plates were read at 450 nM. 1121B is a benchmark antibody (ramucirumab) disclosed in US Patent No. 7,498,414.

[0283]

[0316] As shown in Figure 2, 002, 048, 054 and 1121B had similar blocking activities with comparable IC50s, indicating that the above three antibodies, like 1121B, could also inhibit the activity of VEGF-A through blocking the VEGF-A / VEGFR2 interaction.

[0284] Example 6: Dose-dependent response of purified VEGFR2 antibody binding to HUVEC measured by FACS

[0317] Log-phase HUVEC cells were harvested, counted, and resuspended in FACS buffer (5% BSA+PBS). 2x10^5 cells were added to each tube, then washed once with PBS (1500 rpm, 5 min, RT). 100μl / tube of serially diluted VEGFR2 antibodies in FACS buffer purified from hybridoma supernatants were then added to the corresponding tubes and incubated for 1 hour at 4°C. Cells were then washed twice with 1ml PBS, followed by the addition of 100μl / tube of the second antibody (1:400 anti-mIgG(H+L)-PE, Cell signaling#8887) in FACS buffer. Cells were incubated for 0.5 hours at 4°C, then washed twice with PBS, followed by resuspending the cells in 600μl PBS per sample. Cells were then transferred to FACS tubes, and binding of the antibodies to the cells was detected using flow cytometry (BD Accuri C6) (see Figure 3).

[0285]

[0318] The percentage of positive binding cells was calculated and fitted by Graphpad Prism Software. As shown in Figure 3, these hybridoma antibodies were able to bind to HUVEC cells, which are well known for VEGFR2 expression on the cell surface.

[0286] Example 7: Gene cloning and sequencing of hybridoma antibodies

[0319] The sequences of the light and heavy chain variable regions of the mouse anti-human VEGFR2 antibody were obtained by a polymerase chain reaction (PCR) amplification technique known as 5'RACE (rapid amplification of cDNA ends). Total RNA from 11B8(002) / 21B4(003) / 5G4(048) / 10D11(054) antibody-producing hybridoma cells was isolated using Trizol (Invitrogen), and cDNA was synthesized using the Superscript first-strand synthesis system (Invitrogen) with Oligo(dT)12-18 primers. The variable regions of the mouse IgG gene were cloned by PCR using MuIgG VH3'-2 and MuIg VH5' leader primers for the heavy chain variable region, and MuIgK VL3'-1 and MuIgK VL5' leader primers (NOVAGEN) for the light chain variable region. The resulting bands for each antibody were cloned into the pMD®18-T cloning vector and DNA from 20 clones was subjected to sequencing and determined using an ABI DNA sequencer (Perkin Elmer). Consensus sequences were determined using Vector NTI Advance10 software (Invitrogen).

[0287]

[0320] Generation of chimeric antibodies: After sequence analysis and confirmation, the variable regions of each of the above genes were cloned into the recombinant expression vector pCP-Hck / Hcg1. Briefly, the pCP-Hck / Hcg1 vector was first digested by two-step restriction enzymes. Then, the light chain variable region (VL) and heavy chain variable region (VH) genes were homologously recombined with the digested vector. After transformation, colony PCR and sequence confirmation, the expression vector of the chimeric antibody was generated.

[0288] Example 8: Expression and purification of recombinant chimeric antibodies

[0321] The recombinant chimeric antibody protein produced above was expressed and purified by the following method: 1 × 10 6HEK293E cells cultured at 10000 cells / ml were transfected with DNA vector at a final concentration of 0.5 μg / ml and PEI (polyethyleneimine-linear, Polyscience) 1.0 μg / ml. The ratio of DNA to PEI was 1:2. The formation time of DNA and PEI complex with Optimal MEM should be 15 min at room temperature. The transfected cells were cultured in flasks at 5% CO2, 37°C and shaking speed of 125 rpm. 1% peptone medium was added 22-26 hours after transfection. Conditioned medium was collected on day 6 and the supernatant was centrifuged at 3,000 rpm for 30 min. The clarified conditioned medium was then loaded onto 0.5 ml of a pre-equilibrated Protein A column, washed with 5 column volumes of 1×PBS, and finally bound IgG was eluted with 3 mL of 0.1 M glycine-HCl buffer at pH 3.0. The eluted antibody protein was dialyzed into PBS and stored at -80°C. To remove endotoxin, the purified protein was further processed by passing it through a Hitrap DEAE Sepharose FF column, and the resulting antibodies were analyzed to determine purity levels using size exclusion chromatography (Superdex 200 5 / 150 GL, GE Healthcare).

[0289] Example 9: Binding of purified anti-VEGFR2 chimeric antibodies to human and mouse VEGFR2 proteins

[0322] Same protocol as in Example 4, except that HRP-conjugated goat anti-human Fc antibody was used as the secondary antibody. Binding to hVEGFR2-his and rhesus VEGFR2-his (Acrobiosystems, Cat#VE2-C52H3) was also analyzed in a direct comparison.

[0290]

[0323] As shown in Figures 4A and 4B, the four chimeric antibodies, like 1121B, were able to bind to human and rhesus VEGFR2 with similar affinity, which pointed to the possibility of evaluating safety issues in rhesus monkeys for further studies.

[0291] Example 10: Characterization of the ability of chimeric anti-VEGFR2 antibodies to inhibit binding of VEGF-A to hVEGFR2

[0324] For this assay, VEGF-A 0.25 μg / ml was coated onto an ELISA plate, followed by the addition of a mixture of chimeric antibody and VEGFR2. To detect free VEGF-A (not bound to VEGFR2), a 1:1000 dilution of mouse serum (from mice pre-immunized with human VEGFR2) was added, and an HRP-conjugated goat anti-mouse Fc antibody was used as the secondary antibody.

[0292]

[0325] As shown in Figure 5, three antibodies (042C, 048C and 054C) were able to inhibit VEGF-A binding to VEGFR2 as well as or better than 1121B. 002C showed much weaker neutralizing activity.

[0293] Example 11: FACS-based analysis of binding of selected purified chimeric antibodies to HUVECs

[0326] Same protocol as in Example 6, except using 1:400 rabbit anti-hIgG(H+L)-PE (Cell signaling #8887) as the secondary antibody. As shown in Figure 6, 002C and 054C bound to HUVEC cells with almost the same EC50 as 1121B. Therefore, these VEGFR2 antibodies could function by binding to human VEGFR2 expressed on the cell surface.

[0294] Example 12: Epitope binning by competitive assay

[0327] The protocol was the same as the ELISA binding assay described above. Briefly, 0.5μg / ml of hVEGFR2-his was coated on the plate. 20μg / ml of competing antibody and 1.25μg / ml of biotinylated other antibody were added simultaneously. After 3 hours of incubation, neutravidin-conjugated HRP was added to detect the bound biotinylated antibody. The signal of the bound biotinylated antibody was reduced when the competing antibody competed for the same epitope, but had no effect when the competing antibody competed for a different epitope.

[0295]

[0328] As shown in Figure 7, biotin-mAb 002 was competed by 002, 042, 048 and 054, indicating that they may belong to the same epitope group, which was later found to have the best blocking activity and the same epitope as 1121B (data not shown).

[0296]

[0329] Then, diluted competitive hybridoma antibodies (002, 042, 048 and 054) and lower concentrations (100ng / ml) of chimeric antibodies (002C, 042C, 054C) were added for supplementation according to the same protocol as above. Anti-hIgGFc-HRP was used as the detection antibody.

[0297]

[0330] As shown in Figures 8A-8C, as the concentration of hybridoma antibody increased, the chimeric antibody was unable to bind poorly or at all. Consistent with Figures 7A and 7B, hybridomas 002, 042, 048 and 054 were able to compete with the chimeric antibody, likely due to the same epitope.

[0298] Example 13: Profiling the activity of purified chimeric antibodies in blocking VEGF-A-induced pVEGFR2 in HUVEC cells

[0331] Cells expressing VEGFR2, such as HUVEC cells, will upregulate the expression level of VEGFR2 upon VEGF-A stimulation. The increased VEGFR2 can then bind to VEGF-A and assume a dimerized form. Dimerization induces Tyr phosphorylation of VEGFR2, which subsequently activates downstream pathways such as MAPK / ERK and PI3K.

[0299]

[0332] Briefly, HUVEC cells were cultured at 1.5 × 10 in medium containing 10% FBS. 5Cells were seeded in 12-well plates at a density of 10 cells / well and incubated for 16 hours in a 37°C, 5% CO2 incubator, then cells were starved with serum-free medium for 4 hours. Different chimeric antibodies were added to each well and incubated for 30 minutes, followed by the addition of VEGF-A 20 or 40ng / ml and incubation for 15 minutes. Finally, cell lysates were prepared by adding 100μl of RIPA buffer (Thermo Scientific™, Cat#89900) containing Complete protease inhibitors (Roche#04693132001) and phosphatase inhibitors (Pierce#1862495), incubating on ice for 15 minutes, centrifuging and collecting the supernatant. Equal amounts of cell lysates were separated by 8% SDS-PAGE. Proteins were transferred to PVDF membranes (Millipore) in an ice-containing tank and run at 400amp for 150 minutes. The membrane was then incubated with a solution containing 5% BSA+TBST for 2 hours at RT.The membrane was then incubated with a solution containing 1% BSA+TBST and rabbit anti-phosphoVEGFR2(Tyr1175)mAB(CST, Cat#3770) / mouse anti-β-actin antibody(Abbkine, Cat#A0101502) overnight at 4°C;The membrane was then washed 3x with TBST for 10 minutes each time with gentle rotation;The membrane was then incubated with HRP-conjugated goat anti-rabbit IgG Fc pAB(Abcam, Cat#Ab97080) / HRP-conjugated goat anti-mouse IgG pAb(Abcam, Cat#ab97040) diluted 1:1000 in 1% BSA+TBST for 2 hours. The membrane was then washed 3x with TBST for 10 min each time with gentle rotation; finally, 1 ml of ECL mixture (Pierce) was added onto the PVDF membrane for signal exposure.

[0300]

[0333] As shown in Figures 9A, 9B, and 9C, both VEGF-A at 20 ng / ml and 40 ng / ml were able to rapidly induce VEGFR2 phosphorylation, and 054C, 048C, 042C, and 002C, as well as ramucirumab, were able to reverse this stimulation in a dose-dependent manner.

[0301] Example 14: Generation and characterization of humanized antibodies

[0334] 1. Generation, Expression, and Purification of Humanized Antibodies

[0335] The sequences of the variable domains of murine antibodies 054 and 048 were used to identify germline sequences with the highest homology to the murine frameworks. Computer modeling was used to design humanized variants with CDR grafting and back mutations.

[0302]

[0336] Ab-54

[0337] Human germline framework sequences VK / 2D-40 for the light chain and VH / 3-21 for the heavy chain, respectively, were used for CDR grafting.

[0303]

[0338] Mab54 HC germline sequence:

[0339] VH / 3-21 (Mab54-germline, SEQ ID NO:92): EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARELDGNYDYWGQGTTLTVSS

[0340] VH / 3-21 variant 1 (Mab54-Hzd-HC-V1, SEQ ID NO:93): EVQLVESGGGLVKPGGSLKLSCAASGFTFSMYGMSWVRQTPGKRLEWVASISIGGSYTYYADSVKGRFTISRDNAKNTLYLQMNSLKAEDTAVYYCARELDGNYDYWGQGTTLTVSS

[0341] VH / 3-21 variant 2 (Mab54-HC-V2, SEQ ID NO:94): EVQLVESGGGLVKPGGSLRLSCAASGFTFSMYGMSWVRQAPGKRLEWVASISIGGSYTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARELDGNYDYWGQGTTLTVSS

[0342] Mab54 LC germline sequence:

[0343] VK / 2D-40 (Mab54 LC germline, SEQ ID NO: 95): DIVMTQTPLSLPVTPGEPASISCRSSQSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRIEFP

[0344] VK / 2D-40 variant 3 (Mab54-Hzd-LC-V1, SEQ ID NO: 96): DIVITQDELSLPVTFGESVSISCRSSKSLLYKDGKTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLKISRVEAEDVGIYYCQQLVEYPFTFGSGTKLEIK

[0345] VK / 2D-40 variant 4 (Mab54-Hzd-LC-V2, SEQ ID NO:97): DIVITQTPLSLPVTPGESVSISCRSSKSLLYKDGKTYLNWFLQRPGQSPQLLIYLMSTRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQQLVEYPFTFGSGTKLEIK

[0346] Ab-48

[0347] Human germline framework sequences VK / 2D-40 for the light chain and VH / 3-21 for the heavy chain, respectively, were used for CDR grafting.

[0304]

[0348] Mab48 HC germline sequence:

[0349] VH / 3-21 (Mab48-HC germline, SEQ ID NO: 102): EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

[0350] VH / 3-21 variant 5 (Mab48-Hzd-HC-V3, SEQ ID NO:98): EVQLVESGGGLVKPGGSLRLSCAASGFTFSMYGMSWVRQAPGKRLEWVASISIGGSYTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAREMDGNYDYWGHGTTLTVSS

[0351] The germline and light chain sequences of Mab48 were identical to Mab54.

[0305]

[0352] Thus, there were four variants of humanized Mab54, abbreviated as 54-H1L1, 54-H2L1, 54-H1L2, 54-H2L2, and two variants of humanized Mab48, abbreviated as 48-H3L1, 48-H3L2. In fact, VH / 3-21 variant 5 is almost identical to VH / 3-21 variant 2, except for one amino acid in HCDR3, which is consistent with the similar biological activity of the two antibodies presented in this patent.

[0306]

[0353] The heavy and light chain cDNAs described above were synthesized and fused to the constant region of human IgG1 in the Fc region (heavy chain residue numbering as described herein is according to the EU index of Kabat (see Kabat et al., "Proteins of Immunological Interest", US Dept. of Health & Human Services (1983))). The heavy and light chain variable regions of the selected antibody genes were synthesized and cloned into expression vectors, and large-scale DNA was prepared using the PureYield™ Plasmid Maxiprep System from Promega. Transfection was performed using ExpiFectamine™ 293 Reagent from Invitrogen according to the manufacturer's protocol. The supernatant was harvested when cell viability was approximately 50%. Protein A beads and the cleared supernatant were incubated at 4°C for 2 hours with shaking, and then passed through the column. The Protein A beads inside the column were washed with PBS, and the antibodies were eluted using 100 mM glycine buffer (pH 3.0), which was dialyzed overnight at 4°C against PBS buffer (137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 2 mM KH2PO4, pH 7.4). Finally, endotoxin was removed using Pierce High Capacity Endotoxin Removal Resin (Invitrogen, Cat. No.: 88271). The purified antibodies were characterized by SDS-PAGE and SEC-HPLC.

[0307]

[0354] 2. Binding of humanized antibodies to hVEGFR2 and rhesus VEGFR2 in ELISA

[0355] Same protocol as in Example 9. Humanized 054 and 048 antibodies expressed by 293T cells were first tested (see Figures 10A and 10B).

[0308]

[0356] The two humanized antibodies 54-H2L1 and 48-H3L1 were then expressed by CHO cells for further evaluation and labeled as 54-H2L1(CHO) and 48-H3L1(CHO). Cross-species binding to rhesus VEGFR2-his was maintained, which is a very important property for therapeutic antibody development (see Figures 11A and 11B).

[0309]

[0357] 3. Binding specificity of humanized VEGFR2 antibodies

[0358] Briefly, human VEGFR1 (Sino Biological, cat#10136-H08H), VEGFR2 (Acrobiosystem, cat#KDR-H5227), and VEGFR3 (Sino Biological, cat#10806-H08H) proteins were coated at 4° C. overnight. Humanized antibodies (48-H3L1 and 54-H2L1, produced in CHO cells, or ramucirumab from Eli Lilly, Germany, lot#20150819) were added at 1 μg / ml for binding to the coated antigen. Secondary antibody HRP-conjugated goat anti-human Fc antibody was added for detection of binding signal.

[0310]

[0359] As shown in FIG. 12, the VEGFR2 antibodies 48-H3L1, 54-H2L1 and ramucirumab bind only to VEGFR2, but not to VEGFR1 or VEGFR3, indicating the high specificity of these antibodies.

[0311]

[0360] 4. Blockade of hVEGF-A binding to hVEGFR2 and rhesus VEGFR2 in ELISA

[0361] Same protocol as in Example 10. Briefly, VEGF-A 0.25 μg / ml was coated overnight at 4° C. After blocking, serial dilutions of 54-H2L1, 48-H3L1, ramucirumab and 1 μg / ml human VEGFR2 or rhesus VEGFR2 were added simultaneously during 2 hours of incubation. After washing, mouse serum containing polyclonal VEGFR2 antibody and HRP-conjugated goat anti-mouse Fc antibody was added for detection of free VEGF-A coated on the plate (see FIGS. 13A and 13B).

[0312]

[0362] As shown in Figures 13A and 13B, the two humanized antibodies were able to block VEGF-A from interacting with either human VEGFR2 or rhesus VEGFR2. The neutralizing activity of 48-H3L1 and 54-H2L1 was comparable to, or potentially even better than, that of ramucirumab.

[0313]

[0363] 5. Blockade of VEGF-C and VEGF-D binding to VEGFR2 by humanized antibodies

[0364] The same protocol as in Example 10. Briefly, 0.5μg / ml VEGF-A or VEGF-C or VEGF-D was coated, and 30μg / ml VEGFR2 antibody and 2.5μg / ml human VEGFR2 were added simultaneously during 2 hours of incubation. Using the same detection method as in Example 10, free VEGF-A or VEGF-C or VEGF-D coated on the plate could be measured (see Figure 14A, 14B and 14C).

[0314]

[0365] As shown in Figures 14A, 14B and 14C, VEGFR2 antibodies, including 1121B, completely blocked VEGF-A binding to VEGFR2, but did not block the binding of VEGF-C or VEGF-D. A slight reduction in VEGF-C binding was observed, but the window was too limited to draw any conclusions.

[0315]

[0366] 6. Binding of Humanized Antibodies to hVEGFR2 on HUVECs by FACS

[0367] The same method as in Example 11. Briefly, logarithmic phase HUVEC cells were collected and added to each tube. Then, 100 μl / tube of serially diluted humanized antibody in FACS buffer was added and maintained at 4° C. for 1 hour. The binding of antibody to HUVEC was detected by the PE signal of the second antibody (anti-hIgG(H+L)-PE) added after the first antibody. (See FIG. 15).

[0316]

[0368] 7. Blockade of hVEGF-A-induced hVEGFR2 phosphorylation in HUVECs

[0369] The same method as in Example 13. Briefly, HUVEC cells were seeded in 12-well plate in medium containing 10% FBS, incubated for 16 hours, and then starved without serum for 4 hours. Diluted humanized antibody was added to each well and incubated for 30 minutes, followed by adding VEGF-A 40ng / ml and incubated for 15 minutes. Finally, cell lysate was prepared and phospho-VEGFR2 and β-actin were detected by Western blot as described in Example 13 (see Figure 16).

[0317]

[0370] As shown in Figure 16, the two variants of humanized 54 were able to reduce the amount of phosphorylated VEGFR2 induced by VEGF-A. The inhibitory effect of 54-H2L1 was more potent than that of 54-H1L1.

[0318] Example 15: Evaluation of the ability of purified humanized antibodies to inhibit HUVEC proliferation and tube formation

[0371] Log-phase HUVEC cells were cultured at 5 × 10 3Cells were seeded at a density of 1000 cells / well into a 96-well plate and incubated overnight at 37° C. in a 5% CO2 incubator, then cells were starved with serum-free medium 50 μl / well for 4 hours. Serially diluted humanized antibodies were added at 50 μl / well and incubated for 30 minutes, followed by addition of VEGF-A (final concentration: 20 ng / ml) 50 μl / well and incubation for 72 hours. At the end of cell culture, Cell Titer-Glo® Luminescent kit 20 μl / well was added and the supernatant was transferred to a new white plate for reading the luminescent signal.

[0319]

[0372] HUVEC cells stimulated by VEGF family will be activated and proliferate. Blockade of VEGFR2 and VEGF could reverse the stimulatory effect. As shown in Figure 17, humanized 54 and 48 antibodies could inhibit proliferation in a dose-dependent manner similar to ramucirumab, indicating that they blocked the VEGF / VEGFR2 signal pathway in HUVEC cells.

[0320] Example 16: Evaluation of the binding affinity of selected murine hybridoma or humanized anti-VEGFR2 antibodies via Biacore

[0373] A CM5 sensor chip was activated in each flow cell with a 7-minute injection (10 μl / min) of freshly prepared 1:1 50 mM N-hydroxysuccinimide (NHS):200 mM 1-ethyl-3-(3-dimethylaminopropyl)-carbodiimide (EDC). Anti-human Fc antibody (GE Healthcare) at a concentration of 10 μg / ml in 10 mM sodium acetate buffer PH 5.0 was then injected over the activated chip at 10 μl / min (HBS-EP running buffer: 10 mM HEPES, 150 mM NaCl, 3.4 mM EDTA, 0.005% surfactant P20, pH 7.4). Remaining active coupling sites were blocked with a 7-minute injection of 1 M ethanolamine at 10 μl / min. The immobilization level in each flow cell is approximately 9000 RU. Antibodies were captured to 200-300 RU on FC2 with anti-human Fc IgG or anti-mouse Fc (GE Healthcare). FC1 was used as a reference cell. Antigen was injected at various concentrations (2.5 nM, 5 nM, 10 nM, 20 nM, 40 nM and 80 nM) after antibody capture. The association time for the antibody to bind the antigen is 180 s. The surface regeneration conditions are 120 s at 10 μl / min in Gly pH 1.5. The signal with captured antibody subtracted from the signal without captured antibody was calculated using Biacore X100 evaluation software ver.2.0 (Biacore).

[0321]

[0374]

[0322] [Table 7]

[0323]

[0375] The interaction between human VEGF-A and VEGFR2-Fc has a K of approximately 89 pM. D It is known that it has (doi:10.1007 / s10456-011-9249-6).

[0324] Example 17: Epitope mapping of selected anti-VEGFR2 antibodies via alanine scanning

[0376] 1. Generation of Mutant Human VEGFR2 Recombinant Protein

[0377] cDNA encoding extracellular human VEGFR2 (amino acids 1-1356) and Fc fragment of human IgG1 was synthesized in vitro (SEQ ID NO: 103 is the amino acid sequence). Variants of human VEGFR2 with single amino acid changes at the designated positions listed below were amplified by overlap PCR using primers (Dr.Oligo BLP-192, Biolytic) shown in (Table 8). The resulting fragments were digested with restriction enzymes for Hind III and BamH I at the 5' and 3' ends, respectively. The PCR products were then cloned into pcDNA3.1(+) vector by the method of homologous recombination using Syno assembly mix reagent (Synbio) according to the manufacturer's instructions. The plasmids were purified by using QIAGEN Plasmid Mega Kit (QIAGEN).

[0325]

[0378] Amino acid sequence (SEQ ID NO:103): MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRIS WDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLG YPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVN KVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSE

[0379] Using the wild-type VEGFR2 plasmid (SEQ ID NO: 103 and 104) generated above as a template, two segments of the integrated sequence were generated using megaprimers (Table 8), and ligated by homologous recombination. The products were then cloned into pcDNA3.1(+) vector, and after screening individual positive colonies through sequencing to identify the variants, it was found that the VEGFR2 mutant type was successfully generated. The PCR procedure and conditions are as follows:

[0380]

[0326] [Table 8]

[0327]

[0381] The other 20 variants will be constructed by another company, Genewiz (Suzhou, China). A similar method is carried out using Synbio Tech to synthesize the VEGFR2 variants.

[0328]

[0382] These plasmids of mutant and wild-type VEGFR2 were then transfected into the 293T (ATCC® CRL3216) cell line. 6 293T cells were seeded in a 60 mm dish to ensure that the primary ratio was at 60%-80% for transfection. Then, 10 μg of DNA was diluted in 400 μl of 1×HBS and incubated for about 5 min. 10 μl of 25 kDa linear PEI transfection reagent (dissolved in 1×HBS, 1 mg / ml stock solution) was added to the above mixture to ensure that the DNA / PEI ratio was 1:2.5. The mixture was then added dropwise to the 293T dish. After about 6-8 hours, the medium was changed and replaced with complete DMEM. After 72 hours, the cell culture supernatant was collected using a 0.22 μm filter, respectively, and then stored at -80°C for use.

[0329]

[0383] 2. Binding of VEGFR2 antibodies to hVEGFR2 variants by ELISA

[0384] Supernatants were used to detect VEGFR2 antibody binding by ELISA as described below.

[0330]

[0385] 2.1 For mouse Ab:

[0386] Anti-human Fc antibody (Abcam) was coated at 0.5 μg / ml for 1 hour at room temperature. 160 μl of DMEM supernatant containing various mutant human VEGFR2-Fc proteins or 500 ng / ml of wild-type human VEGFR2-Fc protein in DMEM was added to each well and incubated at room temperature for 1 hour. Mouse anti-VEGFR2 antibody at 0.5 μg / ml was added and incubated at RT for 1 hour. HRP-conjugated goat anti-mouse IgGFc antibody and TMB were then added sequentially and the reaction was stopped using 0.64 M H2SO4. Plates were read at 450 nM on a Thermo Multiscan FC.

[0331]

[0387] 2.2 For Abs containing human Fc (chimeric or humanized antibodies):

[0388] Similar protocol as 2.1, except adding chimeric or humanized antibody for binding to mutant VEGFR2-Fc, and HRP-conjugated anti-hIgGFc as secondary antibody.

[0332]

[0389] Table 9 summarizes the key residues on hVEGFR2 that are required for each individual antibody tested against human VEGFR2 in an ELISA assay. Mutations of amino acid residues on the human VEGFR2 protein that result in significantly reduced binding signals compared to the binding signal of the wild-type protein are marked.

[0333] [Table 9]

[0334] Example 18: Large-scale production of anti-VEGFR2 antibodies for in vivo studies

[0390] Antibodies were produced using transient expression in CHO-K1 cells. The produced antibodies were purified using a Protein A affinity column, and upon desalting, the antibodies were formulated in PBS at 5 mg / ml with endotoxin levels at <3 units / mg. The resulting antibodies were characterized for purity using SDS-PAGE gels and SEC-HPLC.

[0335]

[0391] Transient expression and purification of recombinant antibodies using CHO-K1 cells

[0392] The heavy and light chain variable regions of the selected antibody genes were synthesized and cloned into an expression vector. The resulting expression constructs were used to transfect CHO-K1 cells adapted to grow in serum-free medium. After 10 days of growth in a 10L Applikon bioreactor, the culture medium was harvested and cells and cell debris were removed using an ultrafiltration membrane. The clarified supernatant was then concentrated by ultrafiltration and uploaded onto a prepared Protein A (human IgG) or G-Sepharose (mouse IgG) column. After washing to baseline with equilibration buffer under UV monitoring, the column was then eluted with 0.1M citric acid, pH 3.5, and the eluted antibody was immediately neutralized with 1.0M Tris-HCl buffer, pH 8.0, and dialyzed against PBS, pH 7.2 (Invitrogen) at 2-8°C overnight with two buffer exchanges. Purified antibody was filtered through a 0.22 μm sterile syringe filter and stored in aliquots at -80° C. or below.

[0336] Example 19: In vivo evaluation of chimeric anti-human VEGFR2 antibodies in the HL-60 tumor model

[0393] To evaluate the anti-tumor efficacy of VEGFR2 candidate antibodies, a HL-60 mouse model was set up and multiple indications were evaluated for efficacy. Briefly, 4-6 week old female NOD / SCID mice were randomized and grouped into 4 groups. After treatment with CTX (150mpk, ip), 1.5x10^7 cells / mouse were injected iv the next day. Three days after HL-60 cell injection, mice were treated with different antibodies as listed in the table below (Table 10).

[0337] [Table 10]

[0338]

[0394] As shown in Figure 18 and Table 11, 54-C had the best survival percentage and status compared with other groups. No animals died in 54-C treatment, while 2 died in the negative control group and 2-C treatment group. As we know, VEGFR2 activation occurs via binding to its ligand VEGF-A, which mediates the proliferation of HL-60 cells through autocrine signaling. This can explain the tumor inhibition of VEGFR2 neutralizing antibodies 54-C and 1121B.

[0339] [Table 11]

[0340] Example 20: Evaluation of anti-mouse VEGFR2 antibody DC101

[0395] 1. In vitro evaluation of anti-mouse VEGFR2 antibody DC101

[0396] The present inventors engineered and expressed anti-mouse VEGFR2 antibody DC101 according to its sequence of Fab region listed in Table 12 below. For the Fc region of DC101, rat IgG1 Fc was replaced with human IgG1 Fc, and named chimera-DC101. Then, chimera-DC101 was evaluated by in vitro assay to confirm its biological activity.

[0341]

[0397]

[0342] [Table 12]

[0343] The bolded sequences in Table 12 represent the signal peptides of VH and VL, respectively.

[0344]

[0398] ELISA binding assay was performed to confirm its binding affinity. Briefly, ELISA plates were coated with mouse VEGFR2 500ng / mL in coating buffer (0.16% Na2CO3, 0.3% NaHCO3) and incubated overnight at 4°C. After two washes, blocking buffer (1% BSA, 1% goat serum, 0.05% Tween® 20 in PBS) was added and the plate was incubated at room temperature for 2 hours. After three washes, serially diluted chimera-DC101 was added in dilution buffer (1% BSA, 1% goat serum, 0.01% Tween® 20 in PBS) and the plate was incubated at room temperature for 3 hours. After three washes, goat anti-human HRP (1:5000 dilution) was added and the plate was incubated at room temperature for 1 hour. Finally, after three washes, TMB was added and the reaction was terminated by adding 0.16 mol / L sulfuric acid after 4 minutes. OD450nm was read and recorded.

[0345]

[0399] As shown in FIG. 19, the three lots of chimera-DC101 showed highly consistent binding curves and an EC 50 It also has the EC of humanized 54 and 48 antibodies. 50 was completely similar.

[0346]

[0400] An ELISA blocking assay was performed to confirm its VEGF blocking activity. Briefly, ELISA plates were coated with recombinant human VEGF165 250ng / mL in coating buffer and incubated overnight at 4°C. After two washes, blocking buffer was added and the plates were incubated at room temperature for 2 hours. After three washes, serially diluted chimera-DC101 was added in dilution buffer, followed by mouse VEGFR2 1000ng / mL. The plates were incubated at room temperature for 3 hours. After three washes, polyclonal anti-mouse VEGFR2 with mouse Fc (1:1000) was added and the plates were incubated at room temperature for 1 hour. After three washes, goat anti-mouse HRP (1:5000 dilution) was added and the plates were incubated at room temperature for 1 hour. Finally, after three washes, TMB was added and the reaction was terminated by adding 0.16mol / L sulfuric acid after 4 minutes. OD450nm was read and recorded.

[0347]

[0401] As shown in FIG. 20, the three lots of Chimera-DC101 showed consistent cutoff curves and IC 50 These were the EC values ​​of the humanized anti-human VEGFR2 antibodies 54 and 48. 50 The values ​​were quite similar to those of the humanized 054 and 048 antibodies. Chimeric-DC101 was shown to have similar binding affinity and blocking activity to those of the humanized 054 and 048 antibodies, indicating that chimeric-DC101 can be used as a surrogate antibody for the 054 and 048 antibodies.

[0348]

[0402] 2. In vivo evaluation of anti-mouse VEGFR2 antibody DC101 using the MKN45 gastric tumor model

[0403] MKN45 cells were maintained in vitro as monolayer cultures at 37°C in an atmosphere with 5% CO2 in air in RPMI1640 medium (Thermo Fisher) supplemented with 10% heat-inactivated fetal bovine serum (ExCell Biology), 100U / ml penicillin, and 100ug / ml streptomycin (Hyclone). Tumor cells were routinely subcultured twice a week by trypsin-EDTA treatment (Hyclone). Cells growing in exponential phase were harvested and counted for tumor inoculation. Female SPF grade nude mice were cultured in 5% CO2-treated RPMI1640 medium (Thermo Fisher) supplemented with 10% heat-inactivated fetal bovine serum (ExCell Biology), 100U / ml penicillin, and 100ug / ml streptomycin (Hyclone). * 10^6 MKN45 cells were inoculated. When the tumor size was approximately 100mm^3, tumor-bearing mice were selected and randomized into 5 groups (n=10). Animals were treated with isotype control 30mg / kg, chimeric-DC101 3mg / kg, chimeric-DC101 10mg / kg, chimeric-DC101 30mg / kg, and docetaxel 5mg / kg as a positive control, where isotype control and chimeric-DC101 were administered by ip injection twice a week for 3 weeks, while docetaxel was administered by iv injection once a week for 3 weeks. Tumor size was measured twice a week in two dimensions using calipers (INSIZE), and volume was calculated according to the formula: V=0.5a * The mean and mean SEM were expressed as mean ± SEM using the formula: b^2 (where a and b are the long and short diameters of the tumor, respectively). Results were analyzed using Prism GraphPad and expressed as mean ± SEM. Comparisons between two groups were performed by T-test with p < 0.05. * <0.05 and ** Differences are considered significant if <0.01.

[0349]

[0404] As shown in Table 12 and Figure 21, chimera-DC101 at 3 mg / kg significantly inhibited the growth of MKN45 tumors compared to the isotype control group. With increasing dose, the tumor inhibition rate also improved from 54% to 77%, indicating that tumor growth inhibition was induced by chimera-DC101 in a dose-dependent manner.

[0350] [Table 13]

[0351]

[0405] 3. In vivo evaluation of anti-mouse VEGFR2 antibody DC101 using the H460 lung tumor model

[0406] H460 cells were maintained in vitro as monolayer cultures at 37°C in an atmosphere with 5% CO2 in air in RPMI1640 medium (Thermo Fisher) supplemented with 10% heat-inactivated fetal bovine serum (ExCell Biology), penicillin 100U / ml and streptomycin 100ug / ml (Hyclone). Tumor cells were routinely subcultured twice a week by trypsin-EDTA treatment (Hyclone). Cells growing in exponential phase were harvested and counted for tumor inoculation. Female SPF grade nude mice were cultured in 5% CO2-treated RPMI1640 medium (Thermo Fisher) supplemented with 10% heat-inactivated fetal bovine serum (ExCell Biology), penicillin 100U / ml and streptomycin 100ug / ml (Hyclone). * 10^6 H460 cells were inoculated. When the tumor size was approximately 150mm^3, tumor-bearing mice were selected and randomized into 5 groups (n=10). Animals were treated with isotype control 30mg / kg, chimeric-DC101 3mg / kg, chimeric-DC101 10mg / kg, chimeric-DC101 30mg / kg and docetaxel 5mg / kg as a positive control, where isotype control and chimeric-DC101 were administered by ip injection twice a week for 2 weeks, while docetaxel was administered by iv injection once every 5 days for 3 doses. Tumor size was measured twice a week in two dimensions using calipers (INSIZE) and volume was calculated according to the formula: V=0.5a * The mean and mean SEM were expressed as mean ± SEM using the formula: b^2 (where a and b are the long and short diameters of the tumor, respectively). Results were analyzed using Prism GraphPad and expressed as mean ± SEM. Comparisons between two groups were performed by T-test with p < 0.05. * <0.05 and ** Differences are considered significant if <0.01.

[0352]

[0407] As shown in Table 13 and Figure 22, as the lowest dose, 3 mg / kg of chimera-DC101 did not seem to be sufficient to inhibit H460 tumor growth. When the dose reached 10 mg / kg and 30 mg / kg, H460 proliferation was significantly affected. A dose-dependent effect was evident, indicating that the effect was caused by chimera-DC101.

[0353] [Table 14]

[0354]

[0408] 4. In vivo evaluation of anti-mouse VEGFR2 antibody DC101 using the H1975 NSCLC tumor model

[0409] H1975 cells were maintained in vitro as monolayer cultures at 37°C in an atmosphere with 5% CO2 in air in RPMI1640 medium (Thermo Fisher) supplemented with 10% heat-inactivated fetal bovine serum (ExCell Biology), 100U / ml penicillin, and 100ug / ml streptomycin (Hyclone). Tumor cells were routinely subcultured twice a week by trypsin-EDTA treatment (Hyclone). Cells growing in exponential phase were harvested and counted for tumor inoculation. Female SPF grade nude mice were cultured in 5% CO2-treated RPMI1640 medium (Thermo Fisher) supplemented with 10% heat-inactivated fetal bovine serum (ExCell Biology), 100U / ml penicillin, and 100ug / ml streptomycin (Hyclone). * 10^6 H1975 cells were inoculated. When the tumor size was approximately 100mm^3, tumor-bearing mice were selected and randomized into 5 groups (n=10). Animals were treated with isotype control 30mg / kg, chimeric-DC101 3mg / kg, chimeric-DC101 10mg / kg, chimeric-DC101 30mg / kg, and docetaxel 5mg / kg as a positive control, where isotype control and chimeric-DC101 were administered by ip injection twice a week for 2 weeks, while docetaxel was administered by iv injection once a week for 2 weeks. Tumor size was measured twice a week in two dimensions using calipers (INSIZE) and volume was calculated according to the formula: V=0.5a *The mean and mean SEM were expressed as mean ± SEM using the formula: b^2 (where a and b are the long and short diameters of the tumor, respectively). Results were analyzed using Prism GraphPad and expressed as mean ± SEM. Comparisons between two groups were performed by T-test with p < 0.05. * <0.05 and ** Differences are considered significant if <0.01.

[0355]

[0410] As shown in Table 14 and Figure 23, chimera-DC101 has a significant tumor inhibition effect on H1975 xenograft tumor model belonging to NSCLC adenocarcinoma. When the dose increased from 3mg / kg to 30mg / kg, the tumor inhibition became more and more significant, from 40% to 80%. The dose-dependent effect indicated that the inhibition was caused by chimera-DC101.

[0356] [Table 15]

Claims

1. 1. An anti-hVEGFR antibody or antigen-binding fragment thereof, comprising the sequences of heavy chain HCDR1, HCDR2, and HCDR3, and light chain LCDR1, LCDR2, and LCDR3, wherein: The HCDR1 sequence is selected from the group consisting of X 1 YGMS (SEQ ID NO:41), SSWMN (SEQ ID NO:1), DYYMS (SEQ ID NO:19), and X ４ YWIM (SEQ ID NO:44); The HCDR2 sequence is SISX 2 GGSYTYYADSVX 19 G (SEQ ID NO: 42), RIFPGDGDTYYNGKFQV (SEQ ID NO: 2), FIRNKANGYTTEYSASVKG (SEQ ID NO: 20), or DIYPGX ５ GSTNYNEKFKS (SEQ ID NO:45); The HCDR3 sequence comprises EX 3 DGNYDY (SEQ ID NO:43), FLDTSGRYVDY (SEQ ID NO:3), FDYYGSTYCFDY (SEQ ID NO:21), or DSNPDY (SEQ ID NO:46); The LCDR1 sequence is RSSKSLLYKDGKTYLN (SEQ ID NO:28), KASQDVNTAVA (SEQ ID NO:4), RASQSVSTSSSSFMH (SEQ ID NO:22), or RASESVX ６ NSGISFMX ７ (SEQ ID NO:47); The LCDR2 sequence is LMSTRAS (SEQ ID NO:29), SASYRYI (SEQ ID NO:5), YASNLES (SEQ ID NO:23), or AASX ８ QX ９ S (SEQ ID NO:48); the LCDR3 sequence comprises QQLVEYPFT (SEQ ID NO:30), QQHYRAPLT (SEQ ID NO:6), QHTWEIPLT (SEQ ID NO:24), or QQSKEVPYT (SEQ ID NO:49); Here, X １ is I or M, and X ２ is V or I, X ３ is L or M, and X ４ is T or S, and X ５ is T or S, and X ６ is D or E, and X ７ is T or H, and X ８ is T or Y, and X ９ is G or R, and X １９ is E or K, an anti-hVEGFR antibody or antigen-binding fragment thereof.

2. a) the HCDR1 comprises the amino acid sequence of SEQ ID NO: 41, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 42, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 43, the LCDR1 comprises the sequence of SEQ ID NO: 28, the LCDR2 comprises the sequence of SEQ ID NO: 29, and the LCDR3 comprises the sequence of SEQ ID NO: 30; or b) the HCDR1 comprises the sequence of SEQ ID NO:1, the HCDR2 comprises the sequence of SEQ ID NO:2, the HCDR3 comprises the sequence of SEQ ID NO:3, the LCDR1 comprises the sequence of SEQ ID NO:4, the LCDR2 comprises the sequence of SEQ ID NO:5, and the LCDR3 comprises the sequence of SEQ ID NO:6; or c) the HCDR1 comprises the sequence of SEQ ID NO: 19, the HCDR2 comprises the sequence of SEQ ID NO: 20, the HCDR3 comprises the sequence of SEQ ID NO: 21, the LCDR1 comprises the sequence of SEQ ID NO: 22, the LCDR2 comprises the sequence of SEQ ID NO: 23, and the LCDR3 comprises the sequence of SEQ ID NO: 24; or d) the HCDR1 comprises the amino acid sequence of SEQ ID NO: 44, the HCDR2 comprises the amino acid sequence of SEQ ID NO: 45, the HCDR3 comprises the amino acid sequence of SEQ ID NO: 46, the LCDR1 comprises the sequence of SEQ ID NO: 47, the LCDR2 comprises the sequence of SEQ ID NO: 48, and the LCDR3 comprises the sequence of SEQ ID NO: 49; The anti-hVEGFR antibody or antigen-binding fragment thereof according to claim 1. Claim 3: a) the HCDR1 comprises the sequence of SEQ ID NO:34, the HCDR2 comprises the sequence of SEQ ID NO:35 or SEQ ID NO:37, the HCDR3 comprises the sequence of SEQ ID NO:36, the LCDR1 comprises the sequence of SEQ ID NO:28, the LCDR2 comprises the sequence of SEQ ID NO:29, and the LCDR3 comprises the sequence of SEQ ID NO:30; or b) said HCDR1 comprises the sequence of SEQ ID NO:25, said HCDR2 comprises the sequence of SEQ ID NO:26, said HCDR3 comprises the sequence of SEQ ID NO:27; said LCDR1 comprises the sequence of SEQ ID NO:28, said LCDR2 comprises the sequence of SEQ ID NO:29, and said LCDR3 comprises the sequence of SEQ ID NO:30; or c) the HCDR1 comprises the sequence of SEQ ID NO:31, the HCDR2 comprises the sequence of SEQ ID NO:32 or SEQ ID NO:37, the HCDR3 comprises the sequence of SEQ ID NO:33, the LCDR1 comprises the sequence of SEQ ID NO:28, the LCDR2 comprises the sequence of SEQ ID NO:29, and the LCDR3 comprises the sequence of SEQ ID NO:30; or d) said HCDR1 comprises the sequence of SEQ ID NO:7, said HCDR2 comprises the sequence of SEQ ID NO:8, said HCDR3 comprises the sequence of SEQ ID NO:9; said LCDR1 comprises the sequence of SEQ ID NO:10, said LCDR2 comprises the sequence of SEQ ID NO:11, and said LCDR3 comprises the sequence of SEQ ID NO:12; or e) the HCDR1 comprises the sequence of SEQ ID NO: 13, the HCDR2 comprises the sequence of SEQ ID NO: 14, the HCDR3 comprises the sequence of SEQ ID NO: 15, the LCDR1 comprises the sequence of SEQ ID NO: 16, the LCDR2 comprises the sequence of SEQ ID NO: 17, and the LCDR3 comprises the sequence of SEQ ID NO: 18; The antibody or antigen-binding fragment thereof described in claim 2.

4. Further comprising one or more of heavy chains HFR1, HFR2, HFR3 and HFR4, and / or one or more of light chains LFR1, LFR2, LFR3 and LFR4, wherein: The HFR1 is EVQLVESGGGLVKPGGSLX １０ LSCAASGFTFS (SEQ ID NO: 84), or a homologous sequence thereof with at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; The HFR2 is WVRQX １１ PGKRLEWVA (SEQ ID NO:85), or a homologous sequence thereof with at least 80% (or at least 90%) sequence identity thereto; The HFR3 sequence is １２ AEDTAVYYCAR (SEQ ID NO: 86), or a homologous sequence thereof with at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; The HFR4 is WGX １３ GTTLTVSS (SEQ ID NO: 87) or a homologous sequence of at least 80% sequence identity thereto; The LFR1 is DIVITQX １４ X １５ LSLPVTX １６ GESVSISC (SEQ ID NO:88), or a homologous sequence thereof with at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; said LFR2 comprises WFLQRPGQSPQLLIY (SEQ ID NO:89), or a homologous sequence thereof of at least 80% (or at least 85%, 90%) sequence identity; The LFR3 is GVX １７ DRFSGSGSGTDFTLKISRVEAEDVGX １８ YYC (SEQ ID NO:90), or a homologous sequence thereof with at least 80% (or at least 85%, 90%, 95%) sequence identity thereto; and said LFR4 comprises FGSGTKLEIK (SEQ ID NO:91), or a homologous sequence thereof with at least 80% (or at least 90%) sequence identity; Here, X １０ is R or K, and X １１ is A or T, and X １２ is R or K, and X １３ is Q or H, and X １４ is D or T, and X １５ is E or P, and X １６ is F or P, and X １７ is S or P, and X １８ The antibody or antigen-binding fragment thereof according to any one of claims 1 to 3, wherein is V or I.

5. said HFR1 comprising a sequence selected from the group consisting of SEQ ID NOs: 64, 68 and 72; said HFR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 65, 69 and 73; said HFR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 66, 70 and 74; said HFR4 comprising a sequence selected from the group consisting of SEQ ID NOs: 67, 71 and 75; said LFR1 comprising a sequence selected from the group consisting of SEQ ID NOs: 76 and 80; said LFR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 77 and 81; said LFR3 comprises a sequence selected from the group consisting of SEQ ID NOs: 78 and 82; and The antibody or antigen-binding fragment thereof of claim 4, wherein the LFR4 comprises a sequence selected from the group consisting of SEQ ID NOs: 79 and 83. Claim 6: a) the heavy chain variable region comprises a sequence selected from the group consisting of SEQ ID NO:50, SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58, SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:98, and homologous sequences thereof having at least 80% sequence identity while still retaining specific binding affinity to hVEGFR2; and b) the light chain variable region comprises a sequence selected from the group consisting of SEQ ID NO:51, SEQ ID NO:53, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:59, SEQ ID NO:61, SEQ ID NO:63, SEQ ID NO:96, SEQ ID NO:97, and homologous sequences thereof having at least 80% sequence identity while still retaining specific binding affinity to hVEGFR2; An antibody or antigen-binding fragment thereof according to any one of claims 1 to 3. Claim 7: a) the heavy chain variable region comprises the sequence of SEQ ID NO:50 and the light chain variable region comprises the sequence of SEQ ID NO:51; b) the heavy chain variable region comprises the sequence of SEQ ID NO:52 and the light chain variable region comprises the sequence of SEQ ID NO:53; c) the heavy chain variable region comprises the sequence of SEQ ID NO:54 and the light chain variable region comprises the sequence of SEQ ID NO:55; d) the heavy chain variable region comprises the sequence of SEQ ID NO:56 and the light chain variable region comprises the sequence of SEQ ID NO:57; e) the heavy chain variable region comprises the sequence of SEQ ID NO:58 and the light chain variable region comprises the sequence of SEQ ID NO:59; f) the heavy chain variable region comprises the sequence of SEQ ID NO:60 and the light chain variable region comprises the sequence of SEQ ID NO:61; g) the heavy chain variable region comprises the sequence of SEQ ID NO:62 and the light chain variable region comprises the sequence of SEQ ID NO:63; or h) The antibody or antigen-binding fragment thereof according to any one of claims 1 to 3, wherein the heavy chain variable region comprises the sequence of SEQ ID NO:93 or SEQ ID NO:94 or SEQ ID NO:98 and the light chain variable region comprises the sequence of SEQ ID NO:96 or SEQ ID NO:

97.

8. The antibody or antigen-binding fragment thereof according to any one of claims 1 to 3, further comprising an immunoglobulin constant region, or further comprising a constant region of a human Ig, or further comprising a constant region of a human IgG.

9. The antibody or antigen-binding fragment thereof of claim 8, wherein the constant region comprises a human IgG1, IgG2, IgG3, or IgG4 constant region, or further comprises a human IgG1 constant region comprising SEQ ID NO:

38.

10. a) humanized; b) is a diabody, a Fab, a Fab', an F(ab') 2 , an Fd, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv) 2 , a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, or a bivalent domain antibody; and / or c) is bispecific; An antibody or antigen-binding fragment thereof according to any one of claims 1 to 3.

11. The antibody or antigen-binding fragment thereof according to any one of claims 1 to 3, which is capable of specifically binding to a first and a second epitope of hVEGFR2, or which is capable of specifically binding to hVEGFR2 and a second antigen.

12. The second antigen is an immune-related target or a tumor antigen, a) the immune related target is selected from the group consisting of PD-L1, PD-L2, PD-1, CLTA-4, TIM-3, LAG3, CD160, 2B4, TGF beta, VISTA, BTLA, TIGIT, LAIR1, OX40, CD2, CD27, ICAM-1, NKG2C, SLAMF7, NKp80, CD160, B7-H3, LFA-1, 1COS, 4-1BB, GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, IL-2, IL-15, CD3, CD16, and CD83; or b) the tumor antigen is selected from the group consisting of claudin 18.2, CA-125, gangliosides G(D2), G(M2) and G(D3), CD20, CD52, CD33, Ep-CAM, CEA, bombesin-like peptide, PSA, HER2 / neu, epidermal growth factor receptor (EGFR), erbB2, erbB3 / HER3, erbB4, CD44v6, Ki-67, cancer-associated mucins, VEGF, VEGFR (e.g., VEGFR3), estrogen receptor, Lewis-Y antigen, TGFβ1, IGF-1 receptor, EGFα, c-Kit receptor, transferrin receptor, IL-2R or CO17-1A; The antibody or antigen-binding fragment thereof described in claim 11.

13. 4. The antibody or antigen-binding fragment thereof of any one of claims 1 to 3, which is linked to one or more conjugate moieties comprising a clearance modifier, a chemotherapeutic agent, a toxin, a radioisotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme substrate label, a DNA alkylating agent, a topoisomerase inhibitor, a tubulin binding agent, or other anti-cancer drug.

14. A pharmaceutical composition comprising the antibody or antigen-binding fragment thereof according to any one of claims 1 to 3 and one or more pharma- ceutically acceptable carriers.

15. 15. The pharmaceutical composition of claim 14, further comprising a second therapeutic agent.

16. An isolated polynucleotide encoding an antibody or antigen-binding fragment thereof described in any one of claims 1 to 3.

17. A vector comprising the isolated polynucleotide of claim 16.

18. A host cell comprising the vector of claim 17.

19. A pharmaceutical composition comprising the antibody or antigen-binding fragment thereof of any one of claims 1 to 3 for use in a method of treating, alleviating the severity of, and / or delaying the progression of a VEGFR2-related disease or condition in a subject.

20. 20. The pharmaceutical composition of claim 19, wherein the VEGFR2-related disease or condition is a tumor or angiogenic disease.

21. The method of claim 20, wherein the tumor produces VEGF (e.g., VEGF-A) and / or is sensitive to VEGF (e.g., VEGF-A) present in its microenvironment; and / or b) the tumor is a solid tumor or a non-solid tumor; and / or c) the tumor is a solid tumor, said solid tumor being selected from the group consisting of breast cancer, lung cancer, colorectal cancer, pancreatic cancer, glioma and lymphoma, head and neck tumors, neuroendocrine tumors, colorectal tumors, prostate tumors, breast tumors, lung tumors such as small cell lung tumors and non-small cell lung tumors, pancreatic tumors, thyroid tumors, ovarian tumors, liver tumors, Kaposi's sarcoma, CNS neoplasms, neuroblastoma, capillary hemangioblastoma, meningioma, brain metastases, melanoma, gastrointestinal and renal carcinomas and sarcomas (e.g. gastric cancer), rhabdomyosarcoma, glioblastoma, preferably glioblastoma multiforme, leiomyosarcoma, squamous cell carcinoma, basal cell carcinoma and skin cancer that can be treated by inhibiting the proliferation of malignant keratinocytes, such as human malignant keratinocytes; and / or d) the tumor is a non-solid tumor, the non-solid tumor being selected from the group consisting of leukemia, multiple myeloma and lymphoma, such as acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), erythrocytic or monocytic leukemia, Hodgkin's lymphoma and non-Hodgkin's lymphoma; and / or e) the angiogenic disease is selected from the group consisting of atherosclerosis, rheumatoid arthritis (RA), neovascular glaucoma, proliferative retinopathies including proliferative diabetic retinopathy, macular degeneration, hemangiomas, angiofibromas, psoriasis, retinopathy of prematurity (e.g. retrolental fibroplasia), corneal graft rejection, insulin-dependent diabetes mellitus, multiple sclerosis, myasthenia gravis, Crohn's disease, autoimmune nephritis, primary biliary cirrhosis, acute pancreatitis, allograft rejection, allergic inflammation, contact dermatitis and delayed hypersensitivity reactions, inflammatory bowel disease, septic shock, osteoporosis, osteoarthritis, cognitive impairment caused by neuroinflammation, Osler-Weber syndrome, restenosis, and fungal, parasitic and viral infections such as cytomegalovirus infection, 21. The pharmaceutical composition of claim 20.

22. 20. The pharmaceutical composition of claim 19, wherein the subject is a human.

23. The pharmaceutical composition of claim 19, wherein the method further comprises administering a therapeutically effective amount of a second therapeutic agent.

24. 24. The pharmaceutical composition of claim 23, wherein the second therapeutic agent comprises an anti-cancer therapy, optionally wherein the anti-cancer therapy is selected from a chemotherapeutic agent, a radiation therapy, an immunotherapy, an anti-angiogenic agent (e.g., an antagonist of VEGFR such as VEGFR-1, VEGFR-2, and VEGFR-3), an EGFR antagonist, a PDGFR antagonist, an IGFR antagonist, an NGFR antagonist, an FGFR antagonist, a targeted therapy, a cell therapy, a gene therapy, a hormone therapy, a cytokine, palliative care, surgery for the treatment of cancer (e.g., tumor removal), one or more antiemetic drugs, treatment of complications resulting from chemotherapy, or a dietary supplement for cancer patients (e.g., indole-3-carbinol).

25. A kit comprising the antibody or antigen-binding fragment thereof according to any one of claims 1 to 3.

Images