Clec9a-based chimeric protein complexes
Chimeric protein complexes with Clec9A, modified IFNα2, and Fc domain targeting enhance precision and reduce adverse events, addressing delivery challenges and improving therapeutic efficacy and production characteristics.
Patent Information
- Application Number
- JP2025076699
- Authority / Receiving Office
- JP · JP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2019-09-26
- Filing Date
- 2025-05-02
- Publication Date
- 2025-08-13
AI Technical Summary
Existing chimeric proteins face challenges in achieving precise targeting, limited cross-reactivity, and systemic adverse events while maintaining desirable pharmaceutical properties for therapeutic efficacy, such as in vivo half-life, size, solubility, stability, and storage characteristics, which are crucial for effective biologic delivery.
The development of chimeric protein complexes comprising a C-type lectin domain family 9 member A (Clec9A), modified human IFNα2, and a targeting moiety that specifically binds to a modified Fc domain, designed to enhance precision, reduce cross-reactivity, and improve pharmaceutical properties for therapeutic applications.
The chimeric protein complexes achieve high-precision targeting with limited systemic adverse events, ensuring appropriate in vivo exposure, size, and stability, facilitating effective therapeutic delivery and commercial production.
Smart Images

Figure 2025118769000001_ABST
Abstract
Description
[Technical Field]
[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of and priority to U.S. Provisional Patent Application No. 62 / 906,442, filed September 26, 2019, and U.S. Provisional Patent Application No. 62 / 825,584, filed March 28, 2019, the contents of both of which are incorporated herein by reference in their entireties.
[0002] FIELD OF THE INVENTION The present invention relates, in part, to a chimeric protein complex comprising a fragment crystallizable domain (Fc), a Clec9A VHH as a targeting moiety, and modified interferon alpha 2 (IFNα2) as a signaling agent. The use of these chimeric protein complexes as therapeutic agents is also disclosed.
[0003] Sequence Listing This application contains a Sequence Listing that was submitted in ASCII format via EFS-Web, which is incorporated by reference in its entirety. The ASCII copy created on March 26, 2020, is named ORN-063PC_ST25.txt and is 139,264 bytes in size. [Background technology]
[0004] Biological agents with effector functions are a group of biological agents that have many potential therapeutic applications.In some cases, these biological agents, such as cytokines, encode effector functions that may cause systemic toxicity when administered to humans.Therefore, maximizing the tolerability and therapeutic index of these biological agents in humans is important to reduce systemic toxicity in humans or subjects.
[0005] In many cases, these biologics must be delivered to their target within a subject with precision and in a controlled manner in order for them to be effective. Therefore, it is necessary to design biomolecules that have a high inherent safety profile, have the ability to reach their target within a subject with precision, and can act in a controlled manner.
[0006] One example of such a biologic is a chimeric protein having a signal transduction agent (having an effector function, e.g., a cytokine) linked to a targeting element (capable of seeking out its target with high precision). In these biologics, the signal transduction agent can be a wild-type signal transduction agent or an altered signal transduction agent (e.g., by mutation). Altered signal transduction agents are typically altered to attenuate the activity of the signal transduction agent (e.g., substantially reduce its ability to interact / bind with its receptor) in such a way that the effector function of the signal transduction agent can be restored upon binding of the targeting element to its target (e.g., an antigen on a target cell).
[0007] However, such chimeric proteins are applicable for therapeutic use only if certain conditions are met, such as the ability to be produced on a large scale, an in vivo half-life that ensures sufficient drug exposure time to induce a therapeutically beneficial effect, an appropriate size to avoid rapid elimination or limited tissue penetration and limited biodistribution, and other properties that ensure adequate solubility, stability, and storage without significant loss of function. Importantly, all, or substantially most, of the above properties must be achieved without compromising the conditional targeting of effector function and the maintenance of conditional binding of the modified signal transduction agent to its receptor. In many cases, it is difficult to achieve all of these goals using a chimeric protein encoding or represented by a single continuous polypeptide chain. There is a need in the art to be able to obtain biologics with such desirable properties while maintaining the tolerability and therapeutic index of the biologic. Summary of the Invention
[0008] The technology of the present invention provides chimeric protein complexes comprising biological therapeutics that can deliver their effector function to a selected target with high precision, limited cross-reactivity, and limited systemic adverse events, while also providing characteristics that confer pharmaceutical properties that allow for the production of therapeutics with, for example, desired in vivo exposure time (e.g., half-life), size (e.g., for biodistribution and clearance characteristics), and bulk production and / or purification characteristics for commercial manufacturing (e.g., suitable solubility, stability, and storage characteristics).
[0009] In one aspect, the present invention relates to a heterodimeric protein complex and its individual polypeptide chain subunits (components), the protein complex comprising C-type lectin domain family 9 member A (Clec9A), modified human IFNα2, and a targeting moiety that specifically binds to a modified Fc domain.
[0010] In one aspect, the present invention relates to a chimeric protein complex comprising: (i) a targeting moiety that specifically binds to C-type lectin domain family 9 member A (Clec9A); (ii) modified human IFNα2; and (iii) a modified Fc domain.
[0011] In one aspect, the present invention relates to a chimeric protein complex, wherein the chimeric protein complex comprises a targeting moiety that specifically binds to C-type lectin domain family 9 member A (Clec9A), modified human IFNα2, and a modified Fc domain.
[0012] In some embodiments, a chimeric protein complex comprises a polypeptide having at least 95% identity to any one of SEQ ID NOs: 1-4 and 43, or at least 98% identity to any one of SEQ ID NOs: 1-4 and 43, or at least 99% identity to any one of SEQ ID NOs: 1-4 and 43. In some embodiments, a chimeric protein complex comprises a polypeptide of any one of SEQ ID NOs: 1-4 and 43, optionally with 0, or 1, or 2, or 3, or 4, or 5 mutations. In some embodiments, a chimeric protein complex comprises a polypeptide of any one of SEQ ID NOs: 1-4 and 43.
[0013] In some embodiments, the chimeric protein complex comprises a polypeptide incorporating consecutive amino acids having at least 95% identity to any one of SEQ ID NOs: 1-4 and 43, or at least 98% identity to any one of SEQ ID NOs: 1-4 and 43.
[0014] In another aspect, the present invention relates to a method for treating or preventing cancer, the method comprising administering to a patient in need thereof an effective amount of a chimeric protein complex disclosed herein. Another aspect of the present invention relates to a pharmaceutical composition comprising a chimeric protein complex disclosed herein and a pharmaceutically acceptable carrier. In another aspect, the present invention relates to a method for treating or preventing cancer, the method comprising administering to a patient in need thereof an effective amount of a pharmaceutical composition disclosed herein. In another aspect, the present invention relates to a recombinant nucleic acid composition encoding one or more polypeptides of the chimeric protein complex disclosed herein. In another aspect, the present invention relates to a host cell comprising a nucleic acid composition encoding one or more chimeric protein complexes disclosed herein. [Brief explanation of the drawings]
[0015] [Figure 1]1A-1C show various non-limiting examples of schematic diagrams of chimeric protein complexes of the invention. In some embodiments, each schematic diagram is a composition of the invention, where "IFN" refers to IFNα2 as described herein, and "VHH" refers to an anti-Clec9A VHH as described herein; [ka] is any "linker" as described herein, and the two long parallel rectangles, one with a protrusion and the other with a recess, are human Fc domains from IgG1 with knobs-in-holes mutations as described herein, and optionally with effector knockout and / or stabilizing mutations as also described herein. While SEQ ID NOs are shown, these are for illustrative purposes only and will vary if another mutation other than, e.g., R149A as described herein, is used. [Figure 2] 1 shows the plasma concentrations of Fc-AFN after intravenous administration to mice. Mean values (+SEM) of three individual samples per time point are plotted. [Figure 3]
[0023] Figure 1 shows plasma concentrations of CLEC9A AFN (construct lacking Fc) after intravenous administration in mice. Mean values (+SEM) of three individual samples per time point are plotted. [Figure 4A-D] Specific binding of the CLEC9A-AFN Fc construct to cells expressing human CLEC9A (HL116-hClec9A) compared to control cells (HL116 and HEK293T) is shown. [Figure 5] Figure 1 shows tumor growth curves in humanized mice after treatment with buffer or four different CLEC9A-AFN Fc constructs. Mean (+SEM) values (in mm) of five animals per time point are plotted. [Figure 6] Figure 1 shows tumor growth curves in humanized mice after treatment with buffer or increasing doses of a single CLEC9A-AFN Fc construct. Mean (+SEM) values (in mm) of five animals per time point are plotted. [Figure 7]The various bivalent orientations and / or configurations encompassed by the present invention are shown. The second VHH moiety to achieve bivalency is shaded and, together with the attached linker, forms an N- or C-terminal extension of the SEQ ID NO shown in the figure. Although SEQ ID NOs are shown, they are for illustrative purposes only and will change if a different mutation other than, for example, R149A described herein is used. Furthermore, the VHHs may be identical. For clarity, see the legend to Figure 1. [Figure 8A] The results of pSTAT1 phosphorylation by IFNα2 in Clec9A− / CD141− and Clec9A+ / CD141+ PBMCs are shown. [Figure 8B] 1 shows the results of pSTAT1 phosphorylation by AFNs harboring the A145G or M148A mutation in Clec9A- / CD141- and Clec9A+ / CD141+ PBMCs. [Figure 9] Figure 1 shows tumor growth curves in humanized mice after treatment with buffer or 7.5 pig doses of two different CLEC9A-AFN Fc constructs. Mean (+SEM) tumor size (in mm) of six animals per time point is plotted. [Figure 10A-C] pSTAT1 activity in CLEC9A- / CD141- and Clec9A+ / CD141+ PBMCs after treatment with Clec9A-targeted AFNs with (Figure 10A) and without (Figure 10B) T106 O-glycosylation in IFNα2, and a non-targeted variant (Figure 10C) is shown. [Figure 11] 1 shows the antitumor activity of Clec9A-targeted AFN Fc carrying the A145G mutation of IFNα2. DETAILED DESCRIPTION OF THE INVENTION
[0016] In one aspect, the present invention relates to a chimeric protein complex, wherein the chimeric protein complex comprises a C-type lectin domain family 9 member A (Clec9A), a modified human IFNα2, and a targeting moiety that specifically binds to the modified Fc domain. In some embodiments, the chimeric protein complex comprises a polypeptide having at least 95% identity to any one of SEQ ID NOs: 1-4 and 43. In some embodiments, the chimeric protein complex comprises a polypeptide having at least 98% identity to any one of SEQ ID NOs: 1-4 and 43, or at least 99% identity to any one of SEQ ID NOs: 1-4 and 43. In some embodiments, the chimeric protein complex comprises a polypeptide of SEQ ID NOs: 1-4 and 43, wherein the sequence has fewer than 10 mutations compared to the selected sequence. In some embodiments, the chimeric protein complex comprises a polypeptide of SEQ ID NOs: 1-4 and 43, wherein the sequence has fewer than 5 mutations compared to the selected sequence.
[0017] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 1. This sequence comprises a single domain antibody (VHH) against Clec9A (i.e., R1CHCL50(opt4)), a linker (i.e., 5 * VHH-Fc R1CHCL50(opt4)-5*GGS-Fc hole Ridgway sequence with the LALA-KQ mutation (i.e., Fc hole Ridgway(LALA-KQ), see Ridgway et al., Protein Engineering 1996;9:617-621, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 1 is represented as follows: Variation 1 VHH-Fc R1CHCL50(opt4)-5*GGS-Fc hole Ridgway(LALA-KQ).
[0018] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 2, which comprises a single domain antibody (VHH) against Clec9A (i.e., R1CHCL50(opt4)), a linker (i.e., 5*GGS), and an Fc hole Merchant sequence with a LALA-KQ mutation (i.e., Fc hole Merchant(LALA-KQ), see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety). This SEQ ID NO: 2 construct is represented as follows: VHH-Fc:R1CHCL50(opt4)-5*GGS-Fc hole Merchant(LALA-KQ).
[0019] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 3, which comprises a single domain antibody (VHH) against Clec9A (i.e., 3LEC89(opt4)), a linker (i.e., 5*GGS), and an Fc hole Ridgway sequence with a LALA-KQ mutation (i.e., Fc hole Ridgway(LALA-KQ), see Ridgway et al., Protein Engineering 1996;9:617-621, which is incorporated by reference in its entirety). This SEQ ID NO: 3 construct is represented as follows: VHH-Fc:3LEC89(opt4)-5*GGS-Fc hole Ridgway(LALA-KQ).
[0020] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 4, which comprises a single domain antibody (VHH) against Clec9A (i.e., 3LEC89(opt4)), a linker (i.e., 5*GGS), and an Fc hole Merchant sequence with a LALA-KQ mutation (i.e., Fc hole Merchant(LALA-KQ), see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety). This SEQ ID NO: 4 construct is represented as follows: VHH-Fc:3LEC89(opt4)-5*GGS-Fc hole Merchant(LALA-KQ).
[0021] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 43, which comprises a single domain antibody (VHH) against Clec9A (i.e., R1CHCL50(opt4)), a linker (i.e., 5*GGS), and an Fc hole Merchant sequence with a LALA-KQ mutation and no C-terminal lysine (i.e., Fc hole Merchant(LALA-KQ), see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety).
[0022] The chimeric protein complexes of the present invention further comprise an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 5-8, 29-36, or 41-42. In some embodiments, the chimeric protein complex comprises a polypeptide having at least 98% identity to any one of SEQ ID NOs: 5-8, 29-36, or 41-42, or at least 99% identity to any one of SEQ ID NOs: 5-8, 29-36, or 41-42. In some embodiments, the chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 5-8, 29-36, or 41-42, wherein the sequence has fewer than 10 mutations compared to the selected sequence. In some embodiments, the chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 5-8, 29-36, or 41-42, wherein the sequence has fewer than 5 mutations compared to the selected sequence.
[0023] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 5. This sequence comprises a modified human interferon alpha 2b with an R149A mutation (i.e., huIFNa2B_R149A), a linker (i.e., 10*GGS-G), and an Fc knob Ridgway sequence with a LALA-KQ mutation (i.e., Fc knob Ridgway(LALA-KQ); see Ridgway et al., Protein Engineering 1996;9:617-621, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 5 is represented as follows: Variation 1 Fc-AFN:Fc knob Ridgway(LALA-KQ)-10*GGS-G-huIFNa2B_R149A.
[0024] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 6. This sequence includes a modified human interferon alpha 2b with R149A and T106E mutations (i.e., huIFNa2B_R149A_T106E), a linker (i.e., 10*GGS-G), and an Fc knob Ridgway sequence with a LALA-KQ mutation (i.e., Fc knob Ridgway(LALA-KQ); see Ridgway et al., Protein Engineering 1996;9:617-621, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 6 is represented as follows: Variation 2 Fc-AFN:Fc knob Ridgway(LALA-KQ)-10*GGS-G-huIFNa2B_R149A_T106E.
[0025] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 7. This sequence includes a modified human interferon alpha 2b with an R149A mutation (i.e., huIFNa2B_R149A), a linker (i.e., 10*GGS-G), and an Fc knob Merchant sequence with a LALA-KQ mutation (i.e., Fc knob Merchant(LALA-KQ) - see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 7 is represented as follows: Variation 3 Fc-AFN:Fc knob Merchant(LALA-KQ)-10*GGS-G-huIFNa2B_R149A.
[0026] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 8. This sequence includes a modified human interferon alpha 2b with R149A and T106E mutations (i.e., huIFNa2B_R149A_T106E), a linker (i.e., 10*GGS-G), and an Fc knob Merchant sequence with a LALA-KQ mutation (i.e., Fc knob Merchant(LALA-KQ) - see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 8 is represented as follows: Variation 4 Fc-AFN:Fc knob Merchant(LALA-KQ)-10*GGS-G-huIFNa2B_R149A_T106E.
[0027] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 41. This sequence includes a modified interferon alpha 2b with an A145G mutation, a linker (i.e., 10*GGS-G), and an Fc knob Merchant sequence with a LALA-KQ mutation (i.e., Fc knob Merchant (LALA-KQ), see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 41 is represented as follows: Fc4'-IFNa2b_A145G.
[0028] In some embodiments, the chimeric protein complex comprises a polypeptide having the amino acid sequence of SEQ ID NO: 42. This sequence comprises modified interferon alpha 2b with T106A and A145G mutations, a linker (i.e., 10*GGS-G), and an Fc knob Merchant sequence with a LALA-KQ mutation (i.e., Fc knob Merchant (LALA-KQ), see Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated by reference in its entirety). This construct of the sequence of SEQ ID NO: 42 is represented as follows: Fc4'-IFNa2a_T106E_A145G.
[0029] In one embodiment, the chimeric protein complex comprises (i) an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 1 or 3, and (ii) an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 5 or 6. In another embodiment, the chimeric protein complex comprises (i) an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 1 or 3, and (ii) an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 5 or 6. In another embodiment, the chimeric protein complex comprises (i) an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 1 or 3, and (ii) an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 5 or 6. In an embodiment, the chimeric protein complex comprises (i) an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 2 or 4, and (ii) an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 7 or 8. In one embodiment, the chimeric protein complex comprises (i) an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 2 or 4, and (ii) an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 7 or 8. In another embodiment, the chimeric protein complex comprises (i) an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 2 or 4, and (ii) an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 7 or 8.
[0030] In some embodiments, a chimeric protein complex comprises (i) a polypeptide having an amino acid sequence having at least 95% identity to SEQ ID NO:2, and (ii) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs:31 or 32. In some embodiments, a chimeric protein complex comprises (i) a polypeptide having an amino acid sequence having at least 98% identity to SEQ ID NO:2, and (ii) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs:31 or 32. In some embodiments, a chimeric protein complex comprises (i) a polypeptide having an amino acid sequence having at least 99% identity to SEQ ID NO:2, and (ii) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs:31 or 32. In some embodiments, a chimeric protein complex comprises (i) a polypeptide having an amino acid sequence having at least 95% identity to SEQ ID NO:43, and (ii) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs:41 or 42. In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence having at least 98% identity to SEQ ID NO: 43, and (ii) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 41 or 42. In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence having at least 99% identity to SEQ ID NO: 43, and (ii) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 41 or 42.
[0031] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 1 or 3, and (ii) a polypeptide having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 5 or 6.
[0032] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 1 or 3, and (ii) a polypeptide having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 5 or 6.
[0033] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 99% identical to any one of SEQ ID NOs: 1 or 3, and (ii) a polypeptide having an amino acid sequence at least 99% identical to any one of SEQ ID NOs: 5 or 6.
[0034] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 2 or 4, and (ii) a polypeptide having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 7 or 8.
[0035] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 2 or 4, and (ii) a polypeptide having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 7 or 8.
[0036] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 99% identical to any one of SEQ ID NOs: 2 or 4, and (ii) a polypeptide having an amino acid sequence at least 99% identical to any one of SEQ ID NOs: 7 or 8.
[0037] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 95% identical to SEQ ID NO: 2, and (ii) a polypeptide having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 31 or 32.
[0038] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 98% identical to SEQ ID NO: 2, and (ii) a polypeptide having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 31 or 32.
[0039] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 99% identical to SEQ ID NO: 2, and (ii) a polypeptide having an amino acid sequence at least 99% identical to any one of SEQ ID NOs: 31 or 32.
[0040] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 95% identical to SEQ ID NO: 43, and (ii) a polypeptide having an amino acid sequence at least 95% identical to any one of SEQ ID NOs: 41 or 42.
[0041] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 98% identical to SEQ ID NO: 43, and (ii) a polypeptide having an amino acid sequence at least 98% identical to any one of SEQ ID NOs: 41 or 42.
[0042] In some embodiments, the chimeric protein complex comprises (i) a polypeptide having an amino acid sequence at least 99% identical to SEQ ID NO: 43, and (ii) a polypeptide having an amino acid sequence at least 99% identical to any one of SEQ ID NOs: 41 or 42.
[0043] In some embodiments, the present invention relates to a multivalent or bivalent chimeric protein complex comprising: a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 17 and a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7; a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 2 and a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 19; a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 18 and a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7. or 99% identical to the amino acid sequence of SEQ ID NO: 7; a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 20 and a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7; a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 2 and a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 22; a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 21 and a polypeptide having a sequence at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7. In some embodiments, the present invention relates to a method for treating or preventing cancer, the method comprising administering to a patient in need thereof an effective amount of a multivalent or bivalent chimeric protein complex described herein.
[0044] In some embodiments, the present invention relates to a chimeric protein complex comprising at least two polypeptides having sequences at least 95%, or 97%, or 98%, or 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1-43. In some embodiments, the present invention relates to a method for treating or preventing cancer, the method comprising administering to a patient in need thereof an effective amount of a chimeric protein complex comprising at least two polypeptides having sequences at least 95%, or 97%, or 98%, or 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1-43.
[0045] In some embodiments, the chimeric protein complex comprises a modified human interferon α2. In some embodiments, the modified IFNα2 agent has reduced affinity and / or activity for the IFNα / β receptor (IFNAR), i.e., the IFNAR1 and / or IFNAR2 chains. In some embodiments, the modified IFNα2 agent has substantially reduced or eliminated affinity and / or activity for the IFNα / β receptor (IFNAR), i.e., the IFNAR1 and / or IFNAR2 chains. In some embodiments, the modified human interferon α2 disclosed herein has an amino acid sequence having at least 95% identity to SEQ ID NO: 9 or 10. In other embodiments, the modified human IFNα2 has an amino acid sequence having at least 98% identity or at least 99% identity to SEQ ID NO: 9 or 10. In some embodiments, the modified human IFNα2 has one to three mutations relative to the amino acid sequence of SEQ ID NO: 9 or 10. In one embodiment, the modified human IFNα2 comprises an R149A mutation relative to SEQ ID NO: 9 or 10. In one embodiment, the modified human IFNα2 comprises an A145G mutation relative to SEQ ID NO:9 or 10.
[0046] In some embodiments, the targeting moiety of the chimeric protein complex disclosed herein comprises a recombinant heavy chain-only antibody (VHH). In some embodiments, the VHH has an amino acid sequence at least 95% identical to one of SEQ ID NOs: 11 or 12. In other embodiments, the VHH has an amino acid sequence at least 98% identical to one of SEQ ID NOs: 11 or 12 or at least 99% identical to one of SEQ ID NOs: 11 or 12. In some embodiments, the VHH has the amino acid sequence of any one of SEQ ID NOs: 11 and 12.
[0047] In some embodiments, the chimeric protein complexes disclosed herein comprise two targeting moieties. In some embodiments, the chimeric protein complexes disclosed herein comprise two identical targeting moieties. In some embodiments, these bivalent modes are oriented as shown in Figure 7.
[0048] In some embodiments, the chimeric protein complexes disclosed herein comprise two targeting moieties. In some embodiments, the chimeric protein complexes disclosed herein comprise two non-identical targeting moieties. In some embodiments, these bivalent modes are oriented as shown in Figure 7. For example, in some embodiments, the chimeric protein complexes disclosed herein comprise targeting moieties (including but not limited to, VHHs) against Clec9A and PD-L1.
[0049] In some embodiments, an R149A mutation is present in IFNα2.
[0050] In some embodiments, the R149A mutation is absent in IFNα2, and instead, another mutation is present. For example, this alternative mutation may be at one of positions R33, R144, A145, M148, and L153. In some embodiments, the alternative mutation is one of R33A, R144A, R144I, R144L, R144S, R144T, R144Y, A145D, A145G, A145H, A145K, A145Y, M148A, and L153A. For clarity, in some embodiments, any reference herein to R149A can be replaced with one of R33A, R144A, R144I, R144L, R144S, R144T, R144Y, A145D, A145G, A145H, A145K, A145Y, M148A, and L153A. In some embodiments, any reference herein to R149A can be replaced with A145G.
[0051] In some embodiments, the chimeric protein complexes disclosed herein comprise at least one Fc domain. In some embodiments, the chimeric protein complexes comprise a modified Fc domain, wherein the modified Fc domain comprises one or more of the following mutations: P329G, K322Q, K322A, or P331S relative to any one of SEQ ID NOs: 13-16. In some embodiments, the modified Fc domain comprises one or more of the following mutations: P329G, K322Q, K322A, or P331S relative to IgG1 Fc.
[0052] In some embodiments, the chimeric protein complex comprises a modified Fc domain having an amino acid sequence at least 90% identical to SEQ ID NOs: 13-16. In some embodiments, the modified Fc domain has an amino acid sequence at least 93% identical to SEQ ID NOs: 13-16. In some embodiments, the modified Fc domain has an amino acid sequence at least 95% identical to SEQ ID NOs: 13-16.
[0053] In another aspect, the present invention relates to a method for treating or preventing cancer, the method comprising administering to a patient in need thereof an effective amount of a chimeric protein complex disclosed herein. The method can be used to treat or prevent cancer selected from one or more of the following: basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; peritoneal cancer; cervical cancer; choriocarcinoma; colon and rectal cancer; connective tissue cancer; digestive system cancer; endometrial cancer; esophageal cancer; eye cancer; head and neck cancer; gastric cancer (including gastrointestinal cancer); glioblastoma; liver cancer; hepatoma; intraepithelial neoplasia; kidney or renal cancer. cancer); laryngeal cancer; leukemia; liver cancer; lung cancer (e.g., small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma, and lung squamous cell carcinoma); melanoma; myeloma; neuroblastoma; oral cancer (lip, tongue, tonsil, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; respiratory system cancer; salivary gland carcinoma; sarcoma (e.g., Kaposi's sarcoma); skin cancer; squamous cell carcinoma; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulvar cancer; Hodgkin's lymphoma and non-Hodgkin's lymphoma; and lymphomas, including B-cell lymphomas (including low-grade / follicular non-Hodgkin's lymphoma (NHL)); small lymphocytic (SL)NHL; intermediate-grade / follicular NHL; intermediate-grade diffuse NHL; high-grade immunoblastic NHL; high-grade lymphoblastic NHL; high-grade small non-cleaved cell NHL; bulky mass disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphocytic leukemia (ALL); hairy cell leukemia; chronic myeloblastic leukemia; and other carcinomas and sarcomas; and post-transplant lymphoproliferative disorder (PTLD); and abnormal vascular proliferation associated with phacomatosis; edema (e.g., associated with brain tumors); and Meigs syndrome.
[0054] Another aspect of the present invention relates to a pharmaceutical composition comprising a chimeric protein complex disclosed herein and a pharmaceutically acceptable carrier. In some embodiments, the present invention relates to a pharmaceutical composition comprising a chimeric protein complex of the present invention.
[0055] Another aspect of the present invention relates to a method for treating or preventing cancer, the method comprising administering to a patient in need thereof an effective amount of a pharmaceutical composition disclosed herein. The pharmaceutical composition can be used to treat or prevent cancer selected from one or more of the following: basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; peritoneal cancer; cervical cancer; choriocarcinoma; colon and rectal cancer; connective tissue cancer; digestive system cancer; endometrial cancer; esophageal cancer; eye cancer; head and neck cancer; gastric cancer (including gastrointestinal cancer); glioblastoma; liver cancer; hepatoma; intraepithelial neoplasia; kidney or renal cancer. cancer); laryngeal cancer; leukemia; liver cancer; lung cancer (e.g., small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma, and lung squamous cell carcinoma); melanoma; myeloma; neuroblastoma; oral cancer (lip, tongue, tonsil, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; respiratory system cancer; salivary gland carcinoma; sarcoma (e.g., Kaposi's sarcoma); skin cancer; squamous cell carcinoma; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulvar cancer; Hodgkin's lymphoma and non-Hodgkin's lymphoma; and lymphomas, including B-cell lymphomas (including low-grade / follicular non-Hodgkin's lymphoma (NHL)); small lymphocytic (SL)NHL; intermediate-grade / follicular NHL; intermediate-grade diffuse NHL; high-grade immunoblastic NHL; high-grade lymphoblastic NHL; high-grade small non-cleaved cell NHL; bulky mass disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphocytic leukemia (ALL); hairy cell leukemia; chronic myeloblastic leukemia; and other carcinomas and sarcomas; and post-transplant lymphoproliferative disorder (PTLD); and abnormal vascular proliferation associated with phacomatosis; edema (e.g., associated with brain tumors); and Meigs syndrome.
[0056] In another aspect, the present invention relates to recombinant nucleic acid compositions encoding one or more chimeric protein complexes disclosed herein, e.g., encoding the entire chimeric protein complex or its component polypeptides. In another aspect, the present invention relates to host cells comprising the recombinant nucleic acid composition complexes disclosed herein.
[0057] definition As used herein, "a," "an," or "the" may mean one (one) or more than one (one). Furthermore, the term "about" when used in connection with a reference numerical designation means the reference numerical designation plus or minus up to 10% of the reference numerical designation. For example, the term "about 50" covers a range of 45 to 55.
[0058] As used herein, the term "effective amount" refers to an amount sufficient to achieve the intended therapeutic and / or prophylactic effect, e.g., an amount that results in the prevention or alleviation of a disease or disorder or one or more signs or symptoms associated with a disease or disorder. For therapeutic or prophylactic applications, the amount of a composition administered to a subject will depend on the extent, type, and severity of the disease, as well as individual characteristics such as overall health, age, sex, weight, and drug tolerance. Those skilled in the art will be able to determine the appropriate dosage based on these and other factors. The composition can also be administered in combination with one or more additional therapeutic compounds. In the methods described herein, a therapeutic compound can be administered to a subject with one or more signs or symptoms of a disease or disorder. As used herein, something is "reduced" when, in the presence of a substance or stimulus, the activity and / or effect output value is reduced by a significant amount, e.g., at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, or more, up to at least about 100% (including about 100%), compared to the absence of such modulation. As will be understood by one of skill in the art, in some embodiments, activity is decreased and some downstream output values are decreased, while others may increase.
[0059] Conversely, activity is "higher" if the activity and / or effect output value increases by a significant amount, e.g., at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, or more, up to at least about 100% (including about 100%) or more, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 50-fold, or at least about 100-fold, in the presence of a substance or stimulus compared to the absence of such substance or stimulus.
[0060] Although the invention is described and claimed herein using the open-ended term "comprising" as a synonym for terms such as including, containing, or having, the invention, or embodiments thereof, may alternatively be described using alternative terms such as "consisting of" or "consisting essentially of."
[0061] The amount of the compositions described herein required to achieve a therapeutic effect may be empirically determined according to conventional procedures for a particular purpose. Generally, when a therapeutic agent is administered for therapeutic purposes, the therapeutic agent is administered in a pharmacologically effective amount. A "pharmacologically effective amount," "pharmacologically effective dose," "therapeutically effective amount," or "effective amount" refers to an amount sufficient to produce a desired physiological effect or achieve a desired result, particularly for treating a disorder or disease. As used herein, an effective amount can include, for example, an amount sufficient to slow the progression of symptoms of a disorder or disease, alter the course of symptoms of a disorder or disease (e.g., slow the progression of symptoms of a disease), reduce or eliminate one or more symptoms or onset of a disorder or disease, and reverse symptoms of a disorder or disease. A therapeutic effect also includes halting or slowing the progression of the underlying disease or disorder, regardless of whether improvement is achieved.
[0062] As used herein, "method of treatment" is equally applicable to compositions for the treatment of a disease or disorder described herein and / or compositions for use in the manufacture of a medicament and / or multiple uses for the treatment of a disease or disorder described herein.
[0063] As used herein, Fc domain mutations are numbered according to EU regulations (Edelman et al., PNAS 1969;63(1)78-85, incorporated by reference in its entirety). As used herein, the term "LALA" mutation refers to a double mutant Fc domain with L234A and L235A mutations. As used herein, the term "KQ" mutation refers to a double mutant Fc domain with K322Q mutation.
[0064] The knobs-in-holes mutant is that described in Ridgway et al., Protein Engineering 1996;9:617-621, which is incorporated herein by reference in its entirety, namely Y407T / T366Y.
[0065] Alternatively, the knobs-in-holes mutant is that described in Merchant et al., Nature Biotechnology 1998;16:677-681, which is incorporated herein by reference in its entirety, i.e., S354C:T366W / Y349C:T366S:L368A:Y407V.
[0066] Unless otherwise specified, Fc is derived from human IgG1.
[0067] array [ka] TIFF2025118769000004.tif226161TIFF2025118769000005.tif164162Other sequences are identified elsewhere in the text.
[0068] Example In some examples, two variants of the knobs-in-holes technique are used: Ridgway (derived from Ridgway et al., Protein Engineering 1996;9:617-621) and Merchant (derived from Merchant et al., Nature Biotechnology 1998;16:677-681).
[0069] The "standard" effector mutation in the Ridgway construct is LALA-PG(P329G), which is referred to herein. The "standard" effector mutation in the Merchant construct is LALA-KQ(K322Q), which is referred to herein.
[0070] The term "AcTaferon (AFN)", or "AcTakine", as appropriate, is used herein to refer to the chimeric proteins described herein (details are provided in the Examples regarding chimeric protein formats).
[0071] Example 1: Fc-based AcTaferon To increase the half-life of CLEC9A-specific antibodies (CLEC9A is a highly specific cDC1 marker), the AcTaferon human CLEC9A-VHH_huIFNa2 fusion protein was converted into an Fc fusion. For this, human IgG1-Fc was fused to AcTaferon (VHH 3LEC89-20*GGS-huIFNa2_R149) via a 20*GGS linker. In the second version, an Fc domain was constructed between the VHH and IFN moieties. The effector function of the human IgG1-Fc was reduced by introducing the LALA-P329G mutation.
[0072] The sequence for expression in mammalian cells is as follows: [ka]
[0073] The constructs were generated using GeneArt (Thermo Fisher) according to the manufacturer's instructions and transiently expressed in the ExpiCHO Expression System (Thermo Fisher). Ten days posttransfection, supernatants were collected and cells were removed by centrifugation. Recombinant proteins were purified from the culture medium using rProtein A Sepharose Fast Flow resin (GE Healthcare) according to the manufacturer's instructions. Surprisingly, although proteins were expressed at 70–170 mg / L, they exhibited severe solubility issues, tending to aggregate and precipitate even at concentrations below 1 mg / mL when stored at 4°C or after a single freeze-thaw cycle. Similar observations were made when VHH 3LEC89 was replaced with the unrelated VHH 2LIG99, specific for human PD-L1, indicating that the Fc-based AcTakine format has manufacturability disadvantages.
[0074] Surprisingly, the solubility issue was resolved by designing different types of Fc constructs. In this novel format, heterodimeric Fc complexes were generated by combining a VHH-Fc fusion with an Fc-IFN fusion using either the knob-into-hole mutations Y407T / T366Y or S354C:T366W / Y349C:T366S:L368A:Y407V. An additional variant included the optional knockout of the O-glycosylation site in huIFNα2 by the T106E mutation. A total of eight constructs were designed based on two different VHH-specific humanized human CLEC9A constructs. The mutation LALA-K322Q was used to reduce the effector function of the IgG1-Fc protein. The sequences of the mature proteins are represented by SEQ ID NOs: 1–8. This results in a total of eight Fc complexes that can be generated by combining knob-into-hole constructs, as shown in Figure 1.
[0075] For expression in mammalian cells, the sequence was ligated to a leader sequence, and constructs were generated by GeneArt (Thermo Fisher). Production was carried out in ExpiCHO cells as described above. The recombinant protein was purified from the supernatant using Hitrap Protein A HP (GE Healthcare). After neutralization, the eluted protein was desalted on a G25 column (GE Healthcare), followed by a final 0.22 μm filtration. The protein was shown to remain soluble at a concentration of at least 10 mg / mL at 4°C or after repeated freeze / thaw cycles.
[0076] Example 2: PK effects of chimeras with and without Fc PK study in mice using four different variants of R1CHCL50-based Fc proteins A total of nine mice were intravenously administered 1 mg / kg of each construct. K-EDTA blood was collected from the first group of three mice at 5 min, 8 h, and 6 days, from the second group of three mice at 15 min, 1 day, and 10 days, and from the third group of three mice at 2 h, 3 days, and 14 days. The concentration of the intact CLEC9A-AFN Fc construct was measured by ELISA. Briefly, MAXISORP Nunc Immune plates (Thermo Scientific) were coated overnight with anti-human interferon alpha mAb (clone MMHA-13; PBL Assay Science) at 0.5 μg / ml in PBS. After washing four times with PBS + 0.05% Tween-20, the plates were blocked with 0.1% casein in PBS for at least 1 hour at room temperature. Diluted samples and standards were then incubated in PBS containing 0.1% casein for 2 hours at room temperature. After another wash cycle, custom-made rabbit anti-VHH (diluted 1:20,000 in 0.1% PBS) was incubated for 2 hours at room temperature, followed by an additional wash cycle and a 1-hour incubation at room temperature with HRP-conjugated goat anti-rabbit (Jackson-111-035-144; diluted 1:5,000 in 0.1% casein). After the final wash cycle, peroxidase activity was measured using KPL substrate (5120-0047; SeraCare) according to the manufacturer's instructions. Concentrations from the samples were calculated using GraphPad Prism. The measured concentrations are plotted in Figure 2 and show that all four constructs have similar PK profiles, except for a somewhat faster elimination of the Ridgway-based Fc construct at the last sampling time point. Terminal half-lives were estimated to average approximately 3 days for the Ridgway construct and 4.5 days for the Merchant construct.
[0077] PK study in mice using CLEC9A AcTaferon without Fc fusion In another study, the PK of Fc-less AFN (3LEC89-20*GGS-huIFNa2_R149A-his6) was evaluated in mice. This chimera has the following sequence: P-602 sequence QVQLQESGGGLVQPGGSLRLSCAASGRIFSVNAMGWYRQAPGKQRELVAAITNQGAPTYADSVKGRFTISRDNAGNTVYLQMNSLRPEDTAVYYCKAFTRGDDYWGQGTQVTVSSVDGGSGGSGGSGGSGGSGGSRSGGSGGSGGSGGSGGSGGSGGSGGSGGSGGSGGSGGSGGSGGSAAAMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMASFSLSTNLQESLRSKELEHHHHHH (SEQ ID NO: 25).
[0078] Nine mice were administered a 3 mg / kg intravenous dose. K-EDTA blood was collected at 5 min and 1 h from the first group of three mice, at 15 min and 3 h from the second group of three mice, and finally at 8 h from the last group. Plasma concentrations were measured using the same ELISA described for Fc-fusion proteins. The measured concentrations (Figure 3) demonstrated rapid elimination of this type of molecule, resulting in concentrations below the detection limit (0.12 μg / ml) at 8 h. The estimated terminal half-life was in the range of only 2 h, clearly demonstrating the excellent half-life characteristics of the Fc-based AcTakine.
[0079] Example 3: Binding and in vivo effects of constructs To measure relative binding affinity, the same four molecules shown in Example 2 were incubated with serially diluted CLEC9A-AFN Fc constructs on HL116-hClec9A cells. To assess binding specificity, parental HL116 cells and parental HEK293T cells (both lacking detectable expression of Clec9A) were also incubated with the same serially diluted CLEC9A-AFN Fc constructs. Binding was detected by subsequent incubation with an FITC-labeled anti-human secondary Ab, measured on a MACSQuant X instrument (Miltenyi Biotech), and analyzed using FlowLogic software (Miltenyi Biotech). The data in Figure 4 show that the Fc-based AFNs had similar binding EC50s to HL116-hClec9A cells, while no binding was detected on cell lines that do not express Clec9A.
[0080] To evaluate the efficacy of Fc-based AFNs, the molecules were tested in a humanized mouse tumor model. Briefly, neonatal NSG mice (1-2 days old) were sublethally irradiated with 100 cGy and then injected with 1x10 5 CD34+ human stem cells (HLA-A2 positive umbilical cord blood derived) were delivered intrahepatically. After 13 weeks, 25x10 cells were delivered to the stem cell-transferred mice. 5Human RL follicular lymphoma cells (ATCC CRL-2261; insensitive to the direct antiproliferative effects of IFN) were inoculated subcutaneously. Mice were treated intraperitoneally daily with 30 μg of human Flt3L protein from days 10 to 19 after tumor inoculation. Weekly intravenous injections with buffer or Fc-AFN (8 or 75 μg) began on day 11 after tumor inoculation, when palpable tumors were present (n = 5 mice per group). Tumor size (caliper measurements), body weight, and temperature were assessed daily. Data in Figures 5 and 6 show tumor growth up to 6 days after the second treatment. Figure 5 shows that all constructs induced similar levels of tumor growth inhibition at a low dose of 8 μg. Figure 6 shows the results of higher doses for the Merchant construct, which resulted in increased tumor growth inhibition. Body weight and temperature data did not show any significant differences between buffer and AFN treatments, confirming that all AFN treatments were well tolerated.
[0081] Example 4: Bivalent and bispecific variants To further enhance the targeting capabilities of the molecule, additional VHH moieties are added, resulting in constructs whose non-limiting configurations are shown in Figure 7. These new constructs target CLEC9A in a bivalent fashion or co-target both CLEC9A and PD-L1, for example. As an example, the following constructs are based on the R1CHCL50(opt4) VHH against CLEC9A and / or the 2LIG99 VHH against PD-L1 and huIFNa2B_R149A. A similar series can be generated by replacing R1CHCL50(opt4) with 3LEC89(opt4). Alternatively, huIFNa2B_R149A can be replaced with huIFNa2B_R149A_T106E. Finally, the following examples are based on Fc moieties containing Merchant-based knob-into-hole mutations, which can be exchanged for Ridgway-based knob-into-hole mutations. New Construction [ka] TIFF2025118769000008.tif213161
[0082] For expression in mammalian cells, the sequence was linked to a leader sequence, and expression constructs were generated by GeneArt (Thermo Fisher). Production was carried out in ExpiCHO cells as described above. The recombinant protein was purified from the supernatant using Hitrap Protein A HP (GE Healthcare), and the eluted protein was neutralized and desalted on a G25 column (GE Healthcare), followed by a final 0.22 μm filtration. More specifically, the following expression constructs were combined to produce Fc-based AcTaferon: construct comprising SEQ ID NO: 17 + construct comprising SEQ ID NO: 7 A construct comprising SEQ ID NO: 2 + a construct comprising SEQ ID NO: 19 A construct comprising SEQ ID NO: 18 + a construct comprising SEQ ID NO: 7 A construct comprising SEQ ID NO: 20 + a construct comprising SEQ ID NO: 7 A construct comprising SEQ ID NO: 2+a construct comprising SEQ ID NO: 22 A construct comprising SEQ ID NO: 21 + a construct comprising SEQ ID NO: 7
[0083] Example 5: A145G and M148A AFN mutations In this example, the potential of IFN variations A145G and M148A as IFN mutations (i.e., warhead mutations resulting in reduced biological activity that can be restored upon warhead targeting) was evaluated.
[0084] Mutations were evaluated in a heterodimeric "knobs-in-holes" Fc AFN context, where the Clec9A VHH R1CHCL50 sequence was fused via a flexible 20*GGS linker and in the pcDNA3.4 expression vector to a human IgG1 Fc sequence containing the L234A_L235A_K322Q effector mutation and the "hole" modification Y349C_T366S_L368A_Y407V (see sequence R1CHCL50-Fc3 below). The second AFN partner, also cloned into the pcDNA3.4 vector, consists of a fusion between a human IgG1 Fc sequence containing the L234A_L235A_K322Q effector mutations and the "knob" modification S354C_T366W and hIFNα2 with the AFN mutations A145G or M148A and the O-glycosylation mutation T106E (see sequence below).
[0085] To produce the heterodimeric "knob-in-hole" AFN, a combination of both the "hole" and "knob" plasmids was transfected into ExpiCHO™ cells (ThermoFisher) according to the manufacturer's instructions. Seven days after transfection, the recombinant protein was purified using Protein A spin plates (ThermoFisher), quantified, and tested for purity using SDS-PAGE.
[0086] The resulting A145G and M148 AFNs were tested for STAT1 phosphorylation in primary cDC1 cells (Clec9A-expressing, a target of AFNs) and compared with other PBMC populations. Briefly, PBMCs from the buffy coats of healthy donors were isolated by density gradient centrifugation using Lymphoprep™ (StemCell Technologies). Cells were washed twice with FACS buffer (2% FBS, 1 mM EDTA in PBS) and stained with anti-Clec9A and anti-CD141 Abs (both Miltenyi) to identify the cDC1 population for 20 minutes at 4°C. After two washes, cells were stimulated with serial dilutions of wild-type IFNα2 or both AFNs for 15 minutes at 37°C. After fixation (10 min, 37°C, Fix Buffer I; BD Biosciences), permeabilization (30 min, on ice, Perm III Buffer I; BD Biosciences), and washing, cells were stained with anti-STAT1 pY701 Ab (BD Biosciences). Samples were acquired on a MACSQuant® X instrument (Miltenyi Biotec) and analyzed using FlowLogic™ software (Miltenyi Biotec). The data in Figure 8A-B show that (i) Clec9A- / CD141- and Clec9A+ / CD141+ cells are equally sensitive to wild-type IFNα2, and (ii) both the A145G and M148A mutations abolish most signaling in non-cDC1 PBMCs (Clec9A- / CD141-), whereas targeting to Clec9A-positive cells (Clec9A+ / CD141+) significantly restores this signaling, resulting in at least a 100-fold increase in AFN efficacy for both the A145G and M148A mutations, demonstrating the potential of these mutations for AFN design.
[0087] array: [ka]
[0088] Example 6: A145G and M148A AFN mutations in vivo To evaluate the efficacy of Fc-based AFNs, the molecules were tested in a humanized mouse tumor model. Briefly, neonatal NSG mice (1-2 days old) were sublethally irradiated with 100 cGy and then immunized with 1x10 5 CD34+ human stem cells (HLA-A2 positive umbilical cord blood derived) were delivered intrahepatically. 13 weeks after stem cell transfer, 25x10 5 Human RL follicular lymphoma cells (ATCC CRL-2261; not susceptible to the direct antiproliferative effects of IFN) were inoculated subcutaneously. Mice were treated intraperitoneally with 30 μg of human Flt3L protein from days 9 to 22 after tumor inoculation. Weekly intravenous injections with buffer or the Fc-AFN (7.5 μg) construct described in Example 5 were initiated on day 9 after tumor inoculation, when palpable tumors were observed (n = 6 mice per group). Tumor size (caliper measurements), body weight, and body temperature were assessed daily. Data in Figure 9 show tumor growth up to 1 week after the third treatment, demonstrating that both constructs induced potent levels of tumor growth inhibition. Body weight and body temperature data did not show any significant differences between buffer and AFN treatments, confirming that all AFN treatments were well tolerated.
[0089] Example 7: Additional Fc-AFN constructs based on the A145G and M148A mutations The following additional Fc constructs with attenuated human interferon alpha 2 were generated: [ka] TIFF2025118769000011.tif225161
[0090] To generate human CLEC9A-targeted AFNs, any of constructs A to D above were combined with CLEC9A VHH-Fc fusions of SEQ ID NOs: 2 or 4 to generate eight new constructs. In addition, any of constructs E to H above were combined with CLEC9A VHH-Fc fusions of SEQ ID NOs: 1 or 3 to generate an additional set of eight new constructs. Proteins were expressed and purified as described in Example 5.
[0091] Example 8: A145G mutation with or without O-glycosylation on T106 This experiment compared Clec9A-targeted AFNs with and without T106 O-glycosylation in IFNα2 (R1CHCL50-Fc3+Fc4-IFNa2_A145G vs. R1CHCL50-Fc3+Fc4-IFNa2_T106E_A145G), and a non-targeted variant (Fc3+Fc4-IFNa2_A145G). Proteins were produced as described in Example 5 and purified by Protein A chromatography followed by size exclusion chromatography.
[0092] To assess efficacy, the constructs were tested for STAT1 phosphorylation in primary cDC1 (Clec9A / CDC141) and non-cDC1 (Clec9A / CDC141) populations in human PBMCs, as described in Example 5. Figure 10 shows the specificity of the CLEC9A-targeted construct with or without O-glycosylation on T106, as this construct is much more potent in activating IFN signaling in cDC1 cells compared to non-cDC1 cells, and much more potent on cDC1 cells compared to cDC1 cells treated with the non-targeted variant.
[0093] To evaluate the efficacy of the heterodimeric, "knobs-in-holes" Fc AFN constructs described above, they were tested in a humanized mouse tumor model. Briefly, newborn NSG mice (1-2 days old) were sublethally irradiated with 100 cGy and then immunized with 1x10 5CD34+ human stem cells (HLA-A2 positive umbilical cord blood derived) were delivered intrahepatically. 13 weeks after stem cell transfer, 25x10 5 Human RL follicular lymphoma cells (ATCC CRL-2261; not susceptible to the direct antiproliferative effects of IFN) were inoculated subcutaneously. Mice were treated intraperitoneally with 30 μg of human Flt3L protein from days 7 to 17 after tumor inoculation. Weekly intravenous injections with buffer or the Fc-AFN (2.5 μg) construct began on day 9 after tumor inoculation, when palpable tumors were observed (n = 5 mice per group). Tumor size (caliper measurements), body weight, and body temperature were assessed daily. Data in Figure 11 show tumor growth up to 1 week after the third treatment, demonstrating that both targeted AFNs induced robust levels of tumor growth, while no significant effect was observed with the non-targeted variant. Body weight and body temperature data did not show any significant differences between buffer and AFN treatments, confirming that all AFN treatments were well tolerated.
[0094] array [ka]
[0095] Example 9: Fc-AFN constructs Mass spectrometry analysis showed that the C-terminal lysine K residue in the R1CHCL50-Fc3 chain was cleaved in almost all mature proteins. Therefore, variants were constructed in which this lysine residue was removed from both Fc chains. The resulting proteins are referred to as Fc' proteins. As an example, the chimeric protein combinations of R1CHCL50-Fc3' and Fc4'-AFN fusions, in which residue A145 in IFNα2b was mutated to G, or residues T106 and A145 in IFNα2a were mutated to E and G, respectively, are shown below.
[0096] array: [ka]
Claims
1. 1. A chimeric protein complex comprising: (i) a targeting moiety that specifically binds to C-type lectin domain family 9 member A (Clec9A); (ii) modified human IFNα2, and (iii) a modified Fc domain; A chimeric protein complex comprising:
2. The chimeric protein complex of claim 1 , wherein the chimeric protein complex is a heterodimer.
3. The chimeric protein complex of claim 2, wherein the chimeric protein complex comprises a polypeptide having an amino acid sequence that is at least 95%, or at least 98%, or at least 99% identical to any one of SEQ ID NOs: 1 to 4 and 43.
4. The chimeric protein complex of claim 1, wherein the chimeric protein complex comprises an amino acid sequence selected from SEQ ID NOs: 1 to 4 and 43 and a polypeptide having fewer than 10 mutations relative to the amino acid sequence.
5. The chimeric protein complex of claim 4, wherein the chimeric protein complex comprises an amino acid sequence selected from SEQ ID NOs: 1 to 4 and 43 and a polypeptide having fewer than five mutations relative to the amino acid sequence.
6. The chimeric protein complex of claim 1, wherein the chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 1-4 and 43.
7. The chimeric protein complex of any one of claims 1 to 6, wherein the chimeric protein complex further comprises a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 5 to 8, 29 to 36, or 41 to 42.
8. The chimeric protein complex of claim 7, wherein the chimeric protein complex further comprises a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 5-8, 29-36, or 41-42.
9. The chimeric protein complex of claim 8, wherein the chimeric protein complex further comprises a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 5-8, 29-36, or 41-42.
10. (i) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 1 or 3; and (ii) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 5 or 6; The chimeric protein complex according to any one of claims 7 to 9, comprising:
11. (i) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 1 or 3; and (ii) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 5 or 6; The chimeric protein complex of claim 10, comprising:
12. (i) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 1 or 3; and (ii) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 5 or 6; The chimeric protein complex of claim 11, comprising:
13. (i) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 2 or 4; and (ii) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 7 or 8; The chimeric protein complex according to any one of claims 7 to 9, comprising:
14. (i) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 2 or 4; and (ii) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 7 or 8; The chimeric protein complex of claim 13, comprising:
15. (i) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 2 or 4; and (ii) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 7 or 8; The chimeric protein complex of claim 14, comprising:
16. (i) a polypeptide having an amino acid sequence having at least 95% identity to SEQ ID NO:2; and (ii) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 31 or 32; The chimeric protein complex according to any one of claims 7 to 9, comprising:
17. (i) a polypeptide having an amino acid sequence having at least 98% identity to SEQ ID NO:2; and (ii) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 31 or 32; The chimeric protein complex of claim 16, comprising:
18. (i) a polypeptide having an amino acid sequence having at least 99% identity to SEQ ID NO:2; and (ii) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 31 or 32; 18. The chimeric protein complex of claim 17, comprising:
19. (i) a polypeptide having an amino acid sequence having at least 95% identity to SEQ ID NO: 43; and (ii) a polypeptide having an amino acid sequence having at least 95% identity to any one of SEQ ID NOs: 41 or 42; The chimeric protein complex according to any one of claims 7 to 9, comprising:
20. (i) a polypeptide having an amino acid sequence having at least 98% identity to SEQ ID NO: 43; and (ii) a polypeptide having an amino acid sequence having at least 98% identity to any one of SEQ ID NOs: 41 or 42; The chimeric protein complex of claim 16, comprising:
21. (i) a polypeptide having an amino acid sequence having at least 99% identity to SEQ ID NO: 43; and (ii) a polypeptide having an amino acid sequence having at least 99% identity to any one of SEQ ID NOs: 41 or 42; 18. The chimeric protein complex of claim 17, comprising:
22. The chimeric protein complex of any one of claims 1 to 21, wherein the modified human IFNα2 has an amino acid sequence having at least 95% identity to SEQ ID NO: 9 or 10.
23. The chimeric protein complex of claim 22, wherein the modified human IFNα2 has an amino acid sequence having at least 98% identity to SEQ ID NO: 9 or 10.
24. The chimeric protein complex of claim 23, wherein the modified human IFNα2 has an amino acid sequence having at least 99% identity to SEQ ID NO: 9 or 10.
25. The chimeric protein complex of any one of claims 1 to 24, wherein the modified human IFNα2 has 1 to 3 mutations with respect to the amino acid sequence of SEQ ID NO: 9 or 10.
26. 26. The chimeric protein complex of claim 25, wherein the modified human IFNα2 comprises an R149A mutation relative to SEQ ID NO: 9 or 10 or one of the following mutations relative to SEQ ID NO: 9 or 10: R33A, R144A, R144I, R144L, R144S, R144T, R144Y, A145D, A145G, A145H, A145K, A145Y, M148A and L153A, optionally A145G.
27. The chimeric protein complex of any one of claims 1 to 26, comprising a recombinant heavy chain-only antibody (VHH).
28. The chimeric protein complex of claim 27, wherein the VHH has an amino acid sequence at least 95% identical to one of SEQ ID NOs: 11 or 12.
29. The chimeric protein complex of claim 28, wherein the VHH has an amino acid sequence that is at least 98% identical to one of SEQ ID NOs: 11 or 12.
30. The chimeric protein complex of claim 29, wherein the VHH has an amino acid sequence that is at least 99% identical to one of SEQ ID NOs: 11 or 12.
31. The chimeric protein complex of claim 30, wherein the VHH has an amino acid sequence of any one of SEQ ID NOs: 11 and 12.
32. The chimeric protein complex of any one of claims 1 to 31, wherein the modified Fc domain comprises one or more of the following mutations: P329G, K322Q, K322A, or P331S relative to any one of SEQ ID NOs: 13 to 16.
33. 33. The chimeric protein complex of claim 32, wherein the modified Fc domain comprises one or more of the following mutations: P329G, K322Q, K322A, or P331S relative to human IgG1 Fc.
34. The chimeric protein complex of claim 32 or 33, wherein the modified Fc domain has an amino acid sequence that is at least 90% identical to SEQ ID NOs: 13 to 16.
35. The chimeric protein complex of claim 32 or 33, wherein the modified Fc domain has an amino acid sequence that is at least 93% identical to SEQ ID NOs: 13 to 16.
36. The chimeric protein complex of claim 32 or 33, wherein the modified Fc domain has an amino acid sequence that is at least 95% identical to SEQ ID NOs: 13 to 16.
37. A method for treating or preventing cancer, comprising administering to a patient in need thereof an effective amount of the chimeric protein complex of any one of claims 1 to 36.
38. The cancer is basal cell carcinoma, biliary tract cancer; bladder cancer; Bone cancer; brain and central nervous system cancer; breast cancer; peritoneal cancer; cervical cancer; choriocarcinoma; colon and rectal cancer; connective tissue cancer; digestive system cancer; endometrial cancer; esophageal cancer; eye cancer; Head and neck cancer; gastric cancer (including gastrointestinal cancer); glioblastoma; liver cancer; hepatoma; intraepithelial neoplasia; kidney or renal cancer; laryngeal cancer; leukemia; liver cancer; Lung cancer (e.g., small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma, and lung squamous cell carcinoma); melanoma; myeloma; neuroblastoma; oral cancer (lip, tongue, tonsil, mouth, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; Respiratory system cancer; salivary gland carcinoma; sarcoma (e.g., Kaposi's sarcoma); skin cancer; squamous cell carcinoma; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulvar cancer; Hodgkin's lymphoma and non-Hodgkin's lymphoma; and lymphomas, including B-cell lymphomas (including low-grade / follicular non-Hodgkin's lymphoma (NHL)); small lymphocytic (SL) NHL; intermediate-grade / follicular NHL; intermediate-grade diffuse NHL; high-grade immunoblastic NHL; high-grade lymphoblastic NHL; high-grade small non-cleaved cell 38. The method of claim 37, wherein the lymphoma is selected from one or more of: chronic NHL; bulky mass disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphocytic leukemia (ALL); hairy cell leukemia; chronic myeloblastic leukemia; and other carcinomas and sarcomas; and post-transplant lymphoproliferative disorder (PTLD); and abnormal blood vessel proliferation associated with phacomatosis; edema (e.g., associated with brain tumors); and Meigs' syndrome.
39. A pharmaceutical composition comprising the chimeric protein complex of any one of claims 1 to 36 and a pharmaceutically acceptable carrier.
40. 40. A method for treating or preventing cancer, comprising administering to a patient in need thereof an effective amount of the pharmaceutical composition of claim 39.
41. where the cancer is basal cell carcinoma, biliary tract cancer; bladder cancer; Bone cancer; brain and central nervous system cancer; breast cancer; peritoneal cancer; cervical cancer; choriocarcinoma; colon and rectal cancer; connective tissue cancer; digestive system cancer; endometrial cancer; esophageal cancer; eye cancer; Head and neck cancer; gastric cancer (including gastrointestinal cancer); glioblastoma; liver cancer; hepatoma; intraepithelial neoplasia; kidney or renal cancer; laryngeal cancer; leukemia; liver cancer; Lung cancer (e.g., small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma, and lung squamous cell carcinoma); melanoma; myeloma; neuroblastoma; oral cancer (lip, tongue, tonsil, mouth, and pharynx); ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma; rhabdomyosarcoma; rectal cancer; Respiratory system cancer; salivary gland carcinoma; sarcoma (e.g., Kaposi's sarcoma); skin cancer; squamous cell carcinoma; stomach cancer; testicular cancer; thyroid cancer; uterine or endometrial cancer; cancer of the urinary system; vulvar cancer; Hodgkin's lymphoma and non-Hodgkin's lymphoma; and lymphomas, including B-cell lymphomas (including low-grade / follicular non-Hodgkin's lymphoma (NHL)); small lymphocytic (SL) NHL; intermediate-grade / follicular NHL; intermediate-grade diffuse NHL; high-grade immunoblastic NHL; high-grade lymphoblastic NHL; high-grade small non-cleaved cell 41. The method of claim 40, wherein the lymphoma is selected from one or more of: chronic NHL; bulky mass disease NHL; mantle cell lymphoma; AIDS-related lymphoma; and Waldenstrom's macroglobulinemia; chronic lymphocytic leukemia (CLL); acute lymphocytic leukemia (ALL); hairy cell leukemia; chronic myeloblastic leukemia; and other carcinomas and sarcomas; and post-transplant lymphoproliferative disorder (PTLD); and abnormal blood vessel proliferation associated with phacomatosis; edema (e.g., associated with brain tumors); and Meigs' syndrome.
42. A recombinant nucleic acid composition encoding one or more chimeric protein complexes, or components thereof, according to any one of claims 1 to 36.
43. 43. A host cell comprising the nucleic acid of claim 42.
44. The chimeric protein complex of any one of claims 1 to 36, wherein the chimeric protein complex has an orientation and / or configuration as shown in Figure 1 or Figure 7.
45. A multivalent or bivalent chimeric protein complex, a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 17 and a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7; a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO:2 and a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO:19; a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 18 and a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7; a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO:20 and a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO:7; a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO:2 and a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO:22; or a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 21 and a polypeptide having a sequence that is at least 95%, or 97%, or 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 7; A multivalent or bivalent chimeric protein complex comprising:
46. A method for treating or preventing cancer, comprising administering to a patient in need thereof an effective amount of the multivalent or bivalent chimeric protein complex of claim 45.
47. A chimeric protein complex comprising at least two polypeptides having sequences that are at least 95%, or 97%, or 98%, or 99%, or 100% identical to the amino acid sequence of any one of SEQ ID NOs: 1-43.
48. A method for treating or preventing cancer, comprising administering to a patient in need thereof an effective amount of the chimeric protein complex of claim 47.
Citation Information
Patent Citations
CLEC9A bound material
JP2019506867A
CLEC9A-based chimeric protein complexes
JP7773371B2
Multispecific and multifunctional molecules and uses thereof
WO2017165464A1
CLEC9a binding agents and use thereof
WO2019032662A1