Methods of identifying HIV patients sensitive to therapy with GP120 v3 glycan-directed antibodies
A method identifies patients susceptible to HIV therapy by targeting the V3 glycan region of gp120 with specific antibodies, addressing drug resistance and adherence issues, achieving effective HIV suppression.
Patent Information
- Application Number
- JP2025147818
- Authority / Receiving Office
- JP · JP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2019-05-21
- Filing Date
- 2025-09-05
- Publication Date
- 2025-11-28
AI Technical Summary
Current HIV therapies face challenges due to drug resistance, long-term toxicity, and patient adherence issues, and there is a need to identify patients susceptible to therapy with antibodies targeting the V3 glycan region of gp120 to enhance treatment efficacy.
A method to identify patients likely to benefit from therapy with antibodies that target the V3 glycan region of HIV gp120 by administering antibodies or antigen-binding fragments that compete with specific VH and VL regions, tailored to HIV strains expressing specific amino acid residues, and optionally combined with antiretroviral therapy or other therapeutic agents.
The method effectively identifies suitable patients for HIV treatment, potentially achieving long-term viral suppression without antiretroviral therapy, with reduced drug resistance and improved patient adherence.
Smart Images

Figure 2025175053000038 
Figure 2025175053000039 
Figure 2025175053000040
Abstract
Description
[Technical Field]
[0001] (CROSS-REFERENCE TO RELATED APPLICATIONS) This application claims the benefit under 35 U.S.C. §119(e) of U.S. Provisional Application No. 62 / 850,994, filed May 21, 2019, which is hereby incorporated by reference in its entirety for all purposes.
[0002] Sequence Listing This application contains a Sequence Listing that has been submitted electronically in ASCII format and is incorporated herein by reference in its entirety. Created on April 27, 2020, this ASCII document is named 1289PF_SL.txt and is 199,543 bytes in size. [Background technology]
[0003] Human immunodeficiency virus (HIV) infection and related diseases are major public health problems worldwide. Currently approved therapies for HIV infection target the viral reverse transcriptase, protease enzyme, and integrase; however, resistance of HIV to these existing drugs, long-term toxicity, and lack of patient adherence to daily dosing regimens have proven to be problems associated with these therapies. Therefore, it is important to discover and develop novel HIV drugs. International Publication No. 2009 / 066702, International Publication No. 2012 / 030904, International Publication No. 2014 / 063059, International Publication No. 2016 / 149698, International Publication No. 2017 / 106346; International Publication No. 2 018 / 075564 and 2018 / 125813, McCoy, “Retrovirology” (2018) Vol. 15, p. 70; Sok and Burton, “Nat Immunol.” 2018, Vol. 19(11): pp. 1179–1188; Possas et al., “Expert Opin Ther Pat.” July 2018; Vol. 28(issue 7): pp. 551–560; and Stephenson and Barouch, “Curr HIV / AIDS Rep. (2016) Vol. 13:31-37 describes human anti-HIV antibodies derived from memory B cells of HIV-infected donors that target the V3 glycan region of gp120 and can inhibit infection by HIV-1 species from multiple clades. The therapeutic use of antibodies can be limited by the need to identify patients infected with HIV-1 species that can be targeted by HIV gp120 V3 glycan region antibodies. [Prior art documents] [Patent documents]
[0004] [Patent Document 1] International Publication No. 2009 / 066702 [Patent Document 2] International Publication No. 2012 / 030904 [Patent Document 3] International Publication No. 2014 / 063059 [Patent Document 4] International Publication No. 2016 / 149698 [Patent Document 5] International Publication No. 2017 / 106346 [Patent Document 6] International Publication No. 2018 / 075564 [Patent Document 7] International Publication No. 2018 / 125813 [Non-patent literature]
[0005] [Non-Patent Document 1] McCoy, “Retrovirology” (2018) Vol. 15, p. 70 [Non-patent document 2] Sok and Burton, Nat Immunol. 2018, 19(11):1179-1188 [Non-patent document 2] Possas et al., “Expert Opin Ther Pat.” July 2018; Volume 28 (No. 7): pp. 551-560 [Non-patent document 2] Stephenson and Barouch, Curr HIV / AIDS Rep (2016), vol. 13: 31–37. Summary of the Invention [Means for solving the problem]
[0006] A method is provided to identify patients most likely to benefit from therapy with antibodies that target the V3 glycan region of HIV gp120. Accordingly, in one aspect, there is provided a method of treating or preventing HIV in a human subject in need thereof, the method comprising: (a) glycosylated asparagine at a position corresponding to amino acid residue 332 (N332 glycan), aspartate at a position corresponding to amino acid residue 325 (D325), and threonine at a position corresponding to amino acid residue 63 (T63), leucine at a position corresponding to amino acid residue 179 (L179), threonine at a position corresponding to amino acid residue 320 (T320), and amino acid residue 163 (T63). and (b) identifying a human subject infected with HIV or a population of HIV that expresses gp120 comprising one or more amino acid residues selected from the group consisting of a histidine (H330) at a position corresponding to amino acid residue position 330 of gp120; and (b) administering to the subject an effective amount of an antibody or antigen-binding fragment thereof that competes with or comprises VH and VL regions that bind to an epitope of gp120 within the third variable loop (V3) and / or a high mannose patch comprising an N332 oligomannose glycan, wherein the amino acid positions refer to SEQ ID NO:4.In some embodiments, the methods involve identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycan, D325, and T320; iv. N332 glycan, D325, and H330; v. N332 glycan, D325, T63, and L179; vi. N332 glycan, D325, T63, and T320; vii. N332 glycan, D325, T63, and H330; viii. N332 glycan, D325, T63, and H330; viii. N332 glycan, D325, L 179, and T320; ix. N332 glycan, D325, L179, and H330; x. N332 glycan, D325, T320, and H330; xi. N332 glycan, D325, T63, T320, and H330; xii. N332 glycan, D325, T63, L179, and T320; xiii. N332 glycan, D325, T63, L179, and H330; xiv. N332 glycan, D325, L179, T320, and H330; or xv. N332 glycan, D325, T63, L179, T320, and H330 (amino acid positions refer to SEQ ID NO: 4). In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycan, D325, and T320; or iv. N332 glycan, D325, and H330 (amino acid positions refer to SEQ ID NO:4). In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, T63, and L179; ii. N332 glycan, D325, T63, and T320; iii. N332 glycan, D325, T63, and H330; iv. N332 glycan, D325, L179, and T320; v. N332 glycan, D325, L179, and H330; or vi. N332 glycan, D325, T320, and H330 (amino acid positions refer to SEQ ID NO:4).In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, L179, T320, and H330; ii. N332 glycan, D325, T63, T320, and H330; iii. N332 glycan, D325, T63, L179, and T320; or iv. N332 glycan, D325, T63, L179, and H330 (amino acid positions refer to SEQ ID NO:4). In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, T320, and H330; iii. N332 glycan, D325, L179, T320, and H330; or iv. N332 glycan, D325, T63, L179, T320, and H330 (amino acid positions refer to SEQ ID NO:4). In some embodiments, the subject is infected with HIV or a population of HIV that expresses gp120, further comprising one or more of the following amino acid residues: a glycan at amino acid residue 301 (Glycan 301); amino acid residue lysine 677 (K677); an amino acid residue other than a tryptophan (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, or Y) at position 17 (not_W17); an amino acid residue other than an arginine (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, or Y) at position 747 (not_R747); insertion_321.01 (e.g., insertion of any amino acid (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y) between positions G321 and K322); glutamic acid at position 429 (E429); glutamine at position 442 (Q442); arginine at position 335 (R335); isoleucine at position 165 (I165); serine at position 393 (S393); isoleucine at position 307 (I307); a glycan at position 295 (295glycan); and / or asparagine at position 300 (N300) (amino acid positions refer to SEQ ID NO: 4).In some embodiments, at least 90%, e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of the HIV species in a population of HIV comprise the recited amino acid residue. In some embodiments, the administered antibody or antigen-binding fragment thereof is selected from the group consisting of GS-9722 (elipovimab), GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124, PGT-125, PGT-126, PGT-128, PGT-130, PGT-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138, PGT-139, 10- competes with or comprises the VH and VL regions from an antibody selected from the group consisting of 1074, 10-1074-J, VRC24, 2G12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A, BF520.1, and VRC29.03. In some embodiments, the antibody or antigen-binding fragment thereof competes with or comprises VH and VL regions from an antibody selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-124, PGT-134, GS-2872, 10-1074, 10-1074-J, PGT-122, and PGT-123. In some embodiments, the method comprises administering an antibody comprising an Fc region comprising one or more amino acid substitutions that extend serum half-life. In some embodiments, the method comprises administering an antibody comprising an Fc region comprising the following amino acids at the indicated positions (EU index numbering): i. tyrosine at position 252, threonine at position 254, and glutamic acid at position 256 (YTE); or ii. leucine at position 428 and serine at position 434 (LS).In some embodiments, the method comprises administering an antibody comprising an Fc region comprising the following amino acids at the indicated positions (EU index numbering): i. aspartate at position 239 and glutamate at position 332 (DE); ii. aspartate at position 239, glutamate at position 332, and leucine at position 330 (DEL); iii. aspartate at position 239, glutamate at position 332, and alanine at position 236 (DEA); or iv. aspartate at position 239, glutamate at position 332, alanine at position 236, and leucine at position 330 (DEAL). In some embodiments, the method comprises administering an antigen-binding fragment. In some embodiments, the antigen-binding fragment is selected from the group consisting of an scFv, Fab, Fab2, Fab', F(ab')2, Fv, and a diabody. In some embodiments, the antibody is one or more arms of a multispecific antibody, e.g., a bispecific antibody. In some embodiments, the human subject is acutely infected with HIV. In some embodiments, the antibody is administered to a human subject with HIV infection at Fiebig stage IV or earlier, e.g., Fiebig stage III, Fiebig stage II, or Fiebig stage I. In some embodiments, the antibody is administered to a human subject that has not seroconverted. In some embodiments, the human subject has recently been infected with HIV, e.g., infected within 1, 2, 3, or 4 weeks, or before detection, seroconversion, or sign of symptoms. In some embodiments, the antibody is administered to a human subject with Fiebig stage V or Fiebig stage VI HIV infection. In some embodiments, the human subject is chronically infected with HIV. In some embodiments, the human subject is infected with an HIV clade B virus.In some embodiments, the human subject is infected with an HIV Clade B virus, and the method involves identifying a subject infected with HIV or a population of HIV that expresses a gp120 comprising the following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, L179, T320, and H330; or iii. N332 glycan, D325, T63, L179, T320, and H330. In some embodiments, the human subject is infected with an HIV Clade A virus. In some embodiments, the human subject is infected with an HIV Clade C virus. In some embodiments, the method further comprises administering to the subject one or more additional therapeutic agents for treating HIV infection. In some embodiments, the subject is not receiving antiretroviral therapy (ART), or ART is discontinued prior to administration of the antibody. In some embodiments, ART is discontinued after one or more administrations of the antibody or antigen-binding fragment thereof. In some embodiments, the method further comprises administering to the subject one or more antiretroviral therapy (ART) agents. In some embodiments, the method further comprises administering to the subject a second antibody or antigen-binding fragment thereof that binds to an epitope or region of gp120 selected from the group consisting of: the second variable loop (V2) and / or the Env trimer tip; the CD4 binding site (CD4bs); the gp120 / gp41 interface; or the silent face of gp120. In some embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp120 in the second variable loop (V2) and / or Env trimer tip and is selected from the group consisting of PG9, PG16, PGC14, PGG14, PGT-142, PGT-143, PGT-144, PGT-145, CH01, CH59, PGDM1400, CAP256, CAP256-VRC26.08, CAP256-VRC26.09, CAP256-VRC26.25, PCT64-24E, and VRC38.01. In some embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp120 in the CD4 binding site (CD4bs) and is selected from the group consisting of b12, F105, VRC01, VRC07, VRC07-523, VRC03, VRC06, VRC06b01, VRC08, VRC0801, NIH45-46, GS-9723, GS-5423, 3BNC117, 3BNC60, VRC -PG04, PGV04; CH103, 44-VRC13.01, 1NC9, 12A12, N6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cow1, IOMA, CH235, and CH235.12, N49P6, N49P7, N49P11, N49P9, and N60P25. In some embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp120 at the gp120 / gp41 interface and competes with or comprises the VH and VL regions from an antibody selected from the group consisting of PGT-151, CAP248-2B, 35O22, 8ANC195, ACS202, VRC34, and VRC34.01. In some embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope or region of the gp120 silent face and competes with or comprises the VH and VL regions from antibody VRC-PG05. In some embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp41 in the membrane proximal region (MPER) and competes with or comprises the VH and VL regions from an antibody selected from the group consisting of 10E8, 10E8v4, 10E8-5R-100cF, 4E10, DH511.11P, 2F5, 7b2, and LN01. In some embodiments, the second antibody or antigen-binding fragment thereof binds to an epitope or region of the fusion peptide of gp41 and competes with or comprises the VH and VL regions from an antibody selected from the group consisting of VRC34 and ACS202. In some embodiments, the method further comprises administering a TLR agonist to the subject.In some embodiments, the TLR agonist is a TLR2 agonist, a TLR3 agonist, a TLR7 agonist, a TLR8 agonist, or a TLR9 agonist. In some embodiments, the TLR7 agonist is selected from the group consisting of vesatolimod, imiquimod, and resiquimod. In some embodiments, the method comprises administering the antibody or antigen-binding fragment thereof multiple times, optionally with a TLR agonist, at predetermined intervals. In some embodiments, after one or more administrations of the antibody or antigen-binding fragment thereof, the subject is free of HIV or AIDS symptoms in the absence of antiretroviral therapy (ART) for at least 6 months, at least 1 year, at least 2 years, at least 3 years, at least 4 years, at least 5 years, or longer. In some embodiments, after one or more administrations of the antibody, the subject has an HIV viral load of less than 500, e.g., less than 400, less than 300, less than 200, less than 100, less than 50, HIV viral load copies / mL of blood in the absence of antiretroviral therapy (ART) for at least 6 months, at least 1 year, at least 2 years, at least 3 years, or more. .
[0007] In another aspect, a method is provided for identifying human subjects infected with HIV or a population of HIV that are sensitive to antibodies or antigen-binding fragments thereof that compete with or comprise VH and VL regions that bind to a gp120 epitope within the third variable loop (V3) and / or a high mannose patch comprising the N332 oligomannose glycan. In some embodiments, the method includes identifying a gp120 in a biological sample from a human subject that contains the following amino acid residues: a glycosylated asparagine at a position corresponding to amino acid residue 332 (N332 glycan), an aspartate at a position corresponding to amino acid residue 325 (D325), and one or more amino acid residues selected from the group consisting of a threonine at a position corresponding to amino acid residue 63 (T63), a leucine at a position corresponding to amino acid residue 179 (L179), a threonine at a position corresponding to amino acid residue 320 (T320), and a histidine at a position corresponding to amino acid residue 330 (H330) (amino acid positions refer to SEQ ID NO:4). In some embodiments, the methods involve identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycan, D325, and T320; iv. N332 glycan, D325, and H330; v. N332 glycan, D325, T63, and L179; vi. N332 glycan, D325, T63, and T320; vii. N332 glycan, D325, T63, and H330; viii. N332 glycan, D325, T63, and H330; viii. N332 glycan, D325, L 179, and T320; ix. N332 glycan, D325, L179, and H330; x. N332 glycan, D325, T320, and H330; xi. N332 glycan, D325, T63, T320, and H330; xii. N332 glycan, D325, T63, L179, and T320; xiii. N332 glycan, D325, T63, L179, and H330; xiv. N332 glycan, D325, L179, T320, and H330; or xv. N332 glycan, D325, T63, L179, T320, and H330 (amino acid positions refer to SEQ ID NO: 4).In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycan, D325, and T320; or iv. N332 glycan, D325, and H330 (amino acid positions refer to SEQ ID NO:4). In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, T63, and L179; ii. N332 glycan, D325, T63, and T320; iii. N332 glycan, D325, T63, and H330; iv. N332 glycan, D325, L179, and T320; v. N332 glycan, D325, L179, and H330; or vi. N332 glycan, D325, T320, and H330 (amino acid positions refer to SEQ ID NO:4). In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, L179, T320, and H330; ii. N332 glycan, D325, T63, T320, and H330; iii. N332 glycan, D325, T63, L179, and T320; or iv. N332 glycan, D325, T63, L179, and H330 (amino acid positions refer to SEQ ID NO:4). In some embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, T320, and H330; iii. N332 glycan, D325, L179, T320, and H330; or iv. N332 glycan, D325, T63, L179, T320, and H330 (amino acid positions refer to SEQ ID NO:4).In some embodiments, the subject is infected with HIV or a population of HIV that expresses gp120, further comprising one or more of the following amino acid residues: a glycan at amino acid residue 301 (Glycan 301); amino acid residue lysine 677 (K677); an amino acid residue other than a tryptophan (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, or Y) at position 17 (not_W17); an amino acid residue other than an arginine (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, or Y) at position 747 (not_R747); insertion_321.01 (e.g., insertion of any amino acid (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y) between positions G321 and K322); glutamic acid at position 429 (E429); glutamine at position 442 (Q442); arginine at position 335 (R335); isoleucine at position 165 (I165); serine at position 393 (S393); isoleucine at position 307 (I307); a glycan at position 295 (295glycan); and / or asparagine at position 300 (N300) (amino acid positions refer to SEQ ID NO: 4). In some embodiments, the antibody or antigen-binding fragment thereof is selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124, PGT-125, PGT-126, PGT-128, PGT-130, PGT-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138, PGT-139, 10-1074, 10-1084, 10-1094, 10-1114, 10-1115, 10-1116, 10-1117, 10-1118, 10-1119, 10-1121, 10-1122, 10-1123, 10-1124, 10-1125, 10-1126, 10-1127, 10-1128, 10-1130, 10-1131, 10-1132, 10-1133, 10-1144, 10-1145, 10-1146, 10-1147, 10-1148, 10-1149, 10-1151, 10-1152, 10-1153, 10-1154, 10-1155, 10-1156, 10-1161, 10-1162, 10-1163, 10-1164, 10-1165, 10-1166 competes with or comprises the VH and VL regions from an antibody selected from the group consisting of 0-1074-J, VRC24, 2G12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A, BF520.1, and VRC29.03.In some embodiments, the antibody or antigen-binding fragment thereof competes with or comprises VH and VL regions from an antibody selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-124, PGT-134, GS-2872, 10-1074, 10-1074-J, PGT-122, and PGT-123. In some embodiments, the human subject is acutely infected with HIV. In some embodiments, the antibody is administered to a human subject with Fiebig stage IV or earlier HIV infection. In some embodiments, the antibody is administered to a human subject that has not seroconverted. In some embodiments, the human subject is recently infected with HIV. In some embodiments, the antibody is administered to a human subject with Fiebig stage V or Fiebig stage VI HIV infection. In some embodiments, the human subject is chronically infected with HIV. In some embodiments, the human subject is infected with an HIV Clade B virus. In some embodiments, the human subject is infected with an HIV Clade B virus, and the method involves identifying subjects infected with HIV or a population of HIV that express a gp120 comprising the following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, L179, T320, and H330; or iii. N332 glycan, D325, T63, L179, T320, and H330. In some embodiments, the human subject is infected with an HIV Clade A virus. In some embodiments, the human subject is infected with an HIV Clade C virus.
[0008] Regarding further embodiments of the methods described herein, in some embodiments, gp120 amino acids are identified in one or more gp120 polypeptide sequences expressed from HIV or a population of HIV isolated from a subject. In some embodiments, gp120 amino acids are identified in one or more gp120 polynucleotide sequences encoding gp120 polypeptides from HIV or a population of HIV isolated from a subject. In various embodiments, the method involves performing next generation sequencing (NGS) on polynucleotide sequences encoding gp120 from a population of HIV. In some embodiments, gp120 variants are detected to a frequency level of about 1% in the viral population, e.g., about 0.5% in the viral population. In some embodiments, gp120 amino acids are identified in one or more biological samples from the subject, wherein the one or more biological samples are obtained from blood, peripheral blood mononuclear cells (PBMCs), serum, plasma, semen, or lymph nodes. In some embodiments, the method includes identifying a population of HIV RNA in a serum or plasma sample. In some embodiments, the method further includes obtaining one or more biological samples from the subject. In some embodiments, two or more biological samples are obtained from the subject. In some embodiments, the two or more biological samples are obtained from the same tissue or fluid at two or more different time points. In some embodiments, the two or more biological samples are obtained from different tissues or fluids, or from different anatomical locations.
[0009] definition The words "a" and "an" refer to one or more unless otherwise specified.
[0010] "About" means an amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length that varies by 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1% relative to a reference amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length. In any embodiment discussed in the context of a numerical value used in conjunction with the term "about," it is specifically contemplated that the term about can be omitted.
[0011] Unless otherwise required by context, throughout this specification and claims, the word "comprise" and variations thereof, such as "comprises" and "including" "Comprising" should be interpreted as "including, but not limited to." When the terms "comprise" or "comprising" are used herein, it is to be understood that these terms "consist of" or "consist essentially of" or "consisting of" or "essentially of." The embodiments in which "consisting essentially of" can be replaced with "consisting essentially of" are also included in the present disclosure. It is understood that the term further includes:
[0012] "Consisting of" means including, and limited to, everything that follows the phrase "consisting of." Thus, the phrase "consisting of" indicates that the listed elements are required or mandatory, and that no other elements may be present.
[0013] "Consisting essentially of" means that the phrase The phrase "consisting essentially of" means that the recited elements are inclusive of any recited elements and are limited to other elements that do not interfere with or contribute to the activity or function specified in this disclosure for the recited elements. Thus, the phrase "consisting essentially of" does not necessarily mean that the recited elements are not present. "essential" or "mandatory" indicates that one element is essential, while other elements are optional and may or may not be present depending on whether they affect the activity or function of the listed element.
[0014] References throughout this specification to "one embodiment" or "an embodiment" mean that a particular feature, structure, or characteristic described in connection with an embodiment is included in at least one embodiment described herein. Thus, the appearances of the phrase "in one embodiment" or "in an embodiment" in various places throughout this specification do not necessarily all refer to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments.
[0015] An "increased" or "enhanced" amount is typically a "statistically significant" amount and can include an increase that is 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50 times or more (e.g., 100, 500, 1000 times) (including all integers and decimal points therebetween, and greater than 1, e.g., 2.1, 2.2, 2.3, 2.4, etc.) of the amounts or levels described herein. This can also include an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 150%, at least 200%, at least 500%, or at least 1000% of the amounts or levels described herein.
[0016] A "decreased" or "reduced" amount is typically a "statistically significant" amount and can include a reduction that is about 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, or 50 times or more (e.g., 100, 500, 1000 times) (including all integers and decimal points therebetween, and greater than 1, e.g., 1.5, 1.6, 1.7, 1.8, etc.) of the amounts or levels described herein. This can also include a reduction of the amounts or levels described herein by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%, at least 100%, at least 150%, at least 200%, at least 500%, or at least 1000%.
[0017] A "composition" can include an active agent, e.g., an imaging agent, and a carrier, inert or active substance, e.g., a pharmaceutically acceptable carrier, diluent, or excipient. The composition can be a pharmaceutical composition. In certain embodiments, the composition is sterile and substantially free of endotoxin or non-toxic to a recipient at the dosage or concentration used.
[0018] A "pharmaceutically acceptable carrier, diluent, or excipient" includes, but is not limited to, any adjuvant, carrier, excipient, lubricant, sweetener, diluent, preservative, dye / colorant, flavoring, surfactant, wetting agent, dispersing agent, suspending agent, stabilizer, isotonic agent, solvent, or emulsifier approved by the U.S. Food and Drug Administration as acceptable for use in humans or domestic animals.
[0019] "Biological sample" or "sample" refers to any fluid, cell, or solid tissue sample from a subject having or suspected of having detectable HIV.
[0020] "Subject," "individual," or "patient" refers to any mammal, including humans and non-human primates. In certain embodiments, the mammal is a human.
[0021] The term "buffer" as used herein refers to a pharmaceutically acceptable excipient that stabilizes the pH of pharmaceutical preparations.Suitable buffers are well known in the art.Suitable pharmaceutically acceptable buffers include, but are not limited to, acetate buffer, histidine buffer, citrate buffer, succinate buffer, Tris buffer, and phosphate buffer. In certain embodiments, the concentration of the buffering agent is 0.01 mM to about 1000 mM, about 0.1 mM to about 1000 mM, about 0.1 mM to about 500 mM, about 0.1 to about 200 mM, about 0.1 to about 100 mM, about 1 mM to about 1000 mM, about 1 mM to about 500 mM, about 1 mM to about 200 mM, about 1 mM to about 100 mM, about 1 mM to about 50 mM, about 2 mM to about 60 mM, about 4 mM to about 60 mM, or about 4 mM to about 40 mM, about 5 mM to about 20 mM, or about 5 mM to about 25 mM.
[0022] "Optional" or "optionally" means that the subsequently described circumstance event may or may not occur, and that the description includes instances in which the event or circumstance occurs and instances in which it does not occur.
[0023] A "pharmaceutical composition" refers to a formulation of a compound and medium generally accepted in the art for delivering a biologically active compound to a mammal, such as a human. Such a medium may include any pharmaceutically acceptable carrier, diluent, or excipient.
[0024] An "effective amount" or "therapeutically effective amount" refers to the amount of an antibody or antigen-binding fragment thereof that, when administered to a cell, tissue, or subject, alone or in combination with another therapeutic agent, is sufficient to treat or produce a beneficial result in a subject. What constitutes an "effective amount" will vary depending on the antibody or antigen-binding fragment thereof and its specific use, and potentially the condition and its severity, mode of administration, and age of the subject being treated, but can be routinely determined by one of ordinary skill in the art in light of their own knowledge and this disclosure. A therapeutically effective dose further refers to an amount of an antibody or antigen-binding fragment thereof sufficient to treat, prevent, or ameliorate an infection or disease state, or the progression of an infection or disease, and an amount sufficient to increase the rate of treatment, cure, prevention, or remission of such a condition. When applied to an individual antibody or antigen-binding fragment thereof administered alone, a therapeutically effective dose refers to that active ingredient alone. When applied to a combination, a therapeutically effective dose refers to the combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, sequentially, or simultaneously.
[0025] As used herein, "treat," "treating," or "treatment" includes the treatment of a disease, injury, or condition of interest (e.g., an HIV-1 infection in a subject (e.g., a mammal, such as a human, having the disease or condition of interest)) and includes: (i) inhibiting the progression of the disease, injury, or condition, i.e., halting its development; (ii) reducing or alleviating the disease, injury, or condition, i.e., causing regression of the disease or condition; or (iii) alleviating the symptoms resulting from the disease, injury, or condition. As used herein, the terms "disease," "disorder," and "condition" can be used interchangeably. As used herein, "inhibition," "treatment," "treating," and "ameliorating" are used interchangeably and refer, for example, to the cessation of symptoms, the prolongation of survival, the partial or complete remission of symptoms, and the partial or complete eradication of the condition, disease, or disorder.
[0026] As used herein, "preventing" or "prevention" includes (i) preventing or inhibiting a disease, injury, or condition in a subject, especially where such subject is predisposed to the condition but has not yet been diagnosed with the condition; or (ii) reducing the likelihood of a disease, injury, or condition occurring in a subject.
[0027] As used herein, the term "antibody" refers to an isolated or recombinant binding agent that comprises the necessary variable region sequences to specifically bind to an antigen epitope. Thus, an antibody is any form of antibody or fragment thereof that exhibits a desired biological activity, e.g., binding to a specific target antigen. Thus, the term is used in the broadest sense and encompasses monoclonal antibodies (including full-length monoclonal antibodies), polyclonal antibodies, human antibodies, humanized antibodies, chimeric antibodies, nanobodies, diabodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments (including, but not limited to, scFv, Fab, and Fab2), so long as they exhibit the desired biological activity.
[0028] The term "human antibody" refers to an antibody that contains sequences of human origin, with the exception of possible non-human CDR regions, and does not imply that the complete structure of an Ig molecule is present, only that the antibody has minimal immunogenic effect in humans.
[0029] An "antibody fragment" comprises a portion of an intact antibody, e.g., the antigen-binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (e.g., Zapata et al., Protein Eng., 8(10):1057-1062 (1995)); single-chain antibody molecules (e.g., scFv); and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab" fragments, each with a single antigen-binding site, and a residual "Fc" fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment produces an F(ab')2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
[0030] An "Fv" is the minimum antibody fragment containing a complete antigen-recognition and binding site. This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association. In this configuration, the three CDRS of each variable domain typically interact to define an antigen-binding site on the surface of the VH-VL dimer. Generally, the six CDRs collectively confer antigen-binding specificity to the antibody; however, there are instances in which antigen-binding specificity is maintained when one or more of the six CDRs are deleted or modified, e.g., by altering the amino acid sequence of one or more CDRs, e.g., by amino acid insertion, deletion, or substitution. In addition, even a single variable domain (or half of an Fv containing only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site. Residues other than those present in the CDRs may also be important or play a role in antigen binding and / or specificity as shown for PGT121 and closely related somatic variants that interact with the gp120 antigen using residues in light chain framework 3 (Julien et al., Science 342:1477-83 (2013); Julien et al., PLOS Pathog. 9:e1003342 (2013)). These residues arise in part from three amino acid insertions that extend other short surface loops in PGT121 and related somatic variants (e.g., PGT122, PGT123, PGT124, PGT133, PGT134, 10-1074), which contact both the N332-linked glycan and protein residues on the HIV Env, effectively forming an additional (e.g., fourth) complementarity determining region (CDR) loop within the PGT121 light chain between LC CDR2 and LC CDR3.
[0031] The term "hypervariable region" refers to the amino acid residues of an antibody that are typically responsible for antigen binding. The hypervariable region generally includes amino acid residues from the "complementarity determining regions" or "CDRs" (e.g., about 24-34 (L1), 50-56 (L2), and 89-97 (L3) residues in the VL and about 31-35 (H1), 50-65 (H2), and 95-102 (H3) residues in the VH), numbered according to the Kabat numbering system; Kabat et al., "Sequences of Proteins of Immunological Interest," vol. 1, pp. 111-114, 2002. and / or those residues from the "hypervariable loops" (e.g., residues 24-34 (L1), 50-56 (L2), and 89-97 (L3) in VL, and residues 26-32 (H1), 52-56 (H2), and 95-101 (H3) in VH), numbered according to the Chothia numbering system; Chothia and Lefranc, M. P. et al., J. Mol. Biol. 196:901-917 (1987); and / or these residues from the "hypervariable loops" comprising the VCDR (e.g., residues 27-38 (L1), 56-65 (L2), and 105-120 (L3) in VL, and residues 27-38 (H1), 56-65 (H2), and 105-120 (H3) in VH), numbered according to the IMGT numbering system; Lefranc, M. P. et al., Nucl. Acids Res. 27:209-212 (1999); Ruiz, M. et al., Nucl. Acids Res. 28:219-221 (2000)). Optionally, the antibody has symmetric insertions at one or more of the following points (28, 36 (L1), 63, 74-75 (L2), and 123 (L3) in the VL, and 28, 36 (H1), 63, 74-75 (H2), and 123 (H3) in the VH (numbered according to AHo); Honneger, A. and Plunkthun, A., J. Mol. Biol. 309:657-670 (2001)).
[0032] A "Fab" fragment is the region of an antibody that binds to an antigen. It consists of one constant domain and one variable domain from each of the heavy and light chains. These domains form a paratope (antigen-binding site) at the amino terminus of the monomer. The two variable domains bind to epitopes on their specific antigens. Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain, including one or more cysteines from the antibody hinge region. Fab'-SH is the designation used herein for Fab' fragments in which the cysteine residues in the constant domains bear free thiol groups. F(ab')2 antibody fragments were originally produced as pairs of Fab' fragments with hinge cysteines between them. Other chemical linkages of antibody fragments are also known.
[0033] The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their variable or constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, several of which may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2.
[0034] "Single-chain Fv" or "scFv" or "sFv" antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. In some embodiments, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding.
[0035] The term "diabody" refers to a small antibody fragment having two antigen-binding sites, which fragment comprises a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains pair with complementary domains on another chain, creating two antigen-binding sites. Diabodies are more fully described in, e.g., European Patent No. 404,097; International Publication No. WO 93 / 11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993).
[0036] An "isolated" antibody or antigen-binding fragment thereof is one that has been identified and separated and / or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In some embodiments, the antibody is (1) greater than 95% by weight, e.g., 99% or more by weight, of the antibody as determined by the Lowry method; (2) isolated from an N-terminal or internal amino acid sequence by use of a spinning cup sequenator; or (3) purified to a degree sufficient to obtain at least 15 residues of the desired sequence, or to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or silver staining. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
[0037] An antibody or antigen-binding fragment thereof that "specifically binds" or is "specific for" a particular polypeptide or epitope on a particular polypeptide binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptides or polypeptide epitopes. In some embodiments, the antibodies of the disclosure are in the form of a monoclonal antibody, scFv, Fab, or other form of antibody that specifically binds to an antigen, such as an HIV-1 gp120 polypeptide, and has a dissociation constant, Kd, of 100 nM or less, optionally less than 10 nM, optionally less than 1 nM, optionally less than 0.5 nM, optionally less than 0.1 nM, optionally less than 0.01 nM, or optionally less than 0.005 nM, measured at a temperature of about 4°C, 25°C, 37°C, or 42°C. The affinity of an antibody can be readily determined using techniques described in the prior art, such as, for example, Scatchard et al. (Ann. NY Acad. Sci. USA 51:660 (1949)), ELISA assays, biolayer interferometry (BLI) assays, and surface plasmon resonance (SP) assays. RI) Assays). The binding properties of an antibody to an antigen, cell, or tissue are generally determined by immunodetection techniques, such as immunohistochemistry (IHC) and / or fluorescence-activated cell sorting. Immunofluorescence-based assays such as fluorescence-activated cell sorting (FACS) etc. may be used to determine and evaluate.
[0038] As used herein, an "internalizing" antibody is one that is taken up (i.e., enters) into a mammalian cell upon binding to an antigen (e.g., a cell surface polypeptide or receptor) on the cell. Internalizing antibodies, of course, include antibody fragments, human or chimeric antibodies, and antibody conjugates. In certain therapeutic applications, in vivo internalization is contemplated. The number of internalized antibody molecules is sufficient or appropriate to kill or inhibit the proliferation of a cell (especially an infected cell). Depending on the potency of the antibody or antibody conjugate, in some instances, the uptake of a single antibody molecule into a cell is sufficient to kill the target cell to which the antibody binds. For example, certain toxins are so potent at killing that the internalization of one molecule of the toxin conjugated to an antibody is sufficient to kill an infected cell.
[0039] The term "antagonist" antibody is used in the broadest sense and includes antibodies that partially or completely block, inhibit, or neutralize the biological activity of the epitope, polypeptide, or cell to which it specifically binds. Methods of identifying antagonist antibodies may include contacting a polypeptide or cell specifically bound by a candidate antagonist antibody with the candidate antagonist antibody and measuring a detectable change in one or more biological activities normally associated with the polypeptide or cell.
[0040] An "antibody that inhibits the growth of infected cells" or a "growth inhibitory" antibody is an antibody that binds to infected cells that express or are capable of expressing the HIV-1 epitope bound by the antibody and results in measurable growth inhibition thereof. Preferred growth inhibitory antibodies inhibit the growth of infected cells by more than 20%, preferably about 20% to about 50%, and even more preferably more than 50% (e.g., about 50% to about 100%), compared to an appropriate control, which is typically infected cells not treated with the antibody being tested. Growth inhibition can be measured in cell culture at antibody concentrations of about 0.1 to about 30 μg / mL or about 0.5 nM to about 200 nM, with the growth inhibition being determined 1 to 10 days after exposure of infected cells to the antibody. In vivo growth inhibition of infected cells can be determined by a variety of methods known in the art. An antibody is growth inhibitory in vivo if administration of the antibody at about 1 μg / kg to about 100 mg / kg body weight reduces the percent of infected cells or the total number of infected cells within about 5 days to 3 months, preferably about 5 to 30 days, of the first administration of the antibody.
[0041] An "apoptosis-inducing" antibody is one that induces programmed cell death as determined by annexin V binding, DNA fragmentation, cell shrinkage, endoplasmic reticulum dilation, cell fragmentation, and / or the formation of membrane vesicles (called apoptotic bodies). Preferably, the cells are infected cells. Various methods are available for assessing cellular events associated with apoptosis. For example, phosphatidyl serine (PS) translocation can be measured by annexin binding, DNA fragmentation can be assessed by DNA laddering, and nuclear / chromatin condensation associated with DNA fragmentation can be assessed by any increase in hypodiploid cells. Preferably, an apoptosis-inducing antibody is one that induces approximately 2- to 50-fold, preferably approximately 5- to 50-fold, and most preferably approximately 10- to 50-fold, increased annexin binding compared to untreated cells in an annexin binding assay.
[0042] Antibody "effector functions" refer to biological activities attributable to the Fc region of an antibody (a native sequence Fc region or an amino acid sequence variant Fc region) and vary depending on the antibody isotype. Examples of antibody effector functions include Clq binding and complement-dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis (e.g., antibody-dependent cell-mediated phagocytosis (ADC)); and phospholipid production (e.g., antibody-dependent cell-mediated phagocytosis (ADC)). DCP); down-regulation of cell surface receptors (e.g., B cell receptors); and B cell activation.
[0043] "Antibody-dependent cell-mediated cytotoxicity" or "ADCC" refers to the activity of certain cytotoxic cells (e.g., natural killer (NK) cells, neutrophils, and macrophages) in the production of antibodies against inflammatory cytokines. This refers to a form of cytotoxicity in which secreted or exogenously administered Ig bound to Fc receptors (FcR) present on antigen-carrying target cells enables these cytotoxic effector cells to specifically bind to antigen-bearing target cells and subsequently kill the target cells with cytotoxins. Antibodies "arm" the cytotoxic cells and are required for such killing. ACC, The primary mediators of NK cells express FcγRIII only, whereas monocytes express FcγRI, FcγRII, and FcγRIII. FcR expression on hematopoietic cells is summarized in Table 4 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in U.S. Pat. No. 5,500,362 or U.S. Pat. No. 5,821,337, may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and natural killer (NK) cells. Alternatively, or in addition, ADCC activity of an antibody or antigen-binding fragment thereof may be assessed in vivo, for example, in an animal model such as that disclosed in Clynes et al., Proc. Natl. Acad. Sci. (USA) 95:652-656 (1998).
[0044] "Fc receptor" or "FcR" describes a receptor that binds to the Fc region of an antibody. In certain embodiments, the FcR is a native-sequence human FcR. Furthermore, preferred FcRs are those that bind IgG antibodies (gamma receptors), including receptors of the FcγRI, FcγRII, and FcγRIII subclasses, including allelic variants, or splice forms of these receptors. FcγRII receptors include FcγRIIA ("activating receptors") and FcγRIIB ("inhibiting receptors"), which have amino acid sequences that differ primarily in their cytoplasmic domains, including FcγRIIC, which contains an FcγRIIB extracellular domain fused to an activating cytoplasmic domain. Activating receptor FcγRIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) within its cytoplasmic domain. Inhibiting receptor FcγRIIB contains an immunoreceptor tyrosine-based activation motif (ITAM) within its cytoplasmic domain. The main component contains an immunoreceptor tyrosine-based inhibition motif (ITIM) (Daeron, "Annu. Rev. Immunoglobulins"). (See review M in J. Lab. Clin. Med., Vol. 15:203-234 (1997)). FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol. 9:457-92 (1991); Capel et al., Immunomethods, Vol. 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med., Vol. 126:330-41 (1995). Other FcRs, including those yet to be identified, are encompassed herein by the term "FcR." The term also includes FcRn, a neonatal receptor involved in the transfer of maternal IgG to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), which plays a role in the salvage of IgG from lysosomal degradation by FcRn-dependent recycling after endocytosis. FcRn binding following pinocytosis in endothelial cells has been shown to be important for maintaining a long pharmacokinetic half-life of antibodies. In vitro assessment of pH-dependent human FcRn binding of antibodies can be performed to obtain predictions of potential favorable clinical pharmacokinetics (Datta-Mannan and Wroblewski, Drug Metab. Dispos. 42:1867-1872 (2014)).
[0045] "Human effector cells" are leukocytes that express one or more FcRs and perform effector function. Preferably, the cells express at least FcγRIII and perform ADCC effector function. Examples of human leukocytes that mediate ADCC include PBMCs, NK cells, monocytes, cytotoxic T cells, and neutrophils, with PBMCs and NK cells being preferred. Effector cells may be isolated from a native source, such as blood.
[0046] "Complement-dependent cytotoxicity" or "CDC" refers to the lysis of target cells in the presence of complement. Activation of the canonical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) that are bound to their cognate antigen. To assess complement activation, a CDC assay (e.g., as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996)) may be performed.
[0047] A "neutralizing antibody" is an antibody that can neutralize a pathogen's ability to initiate and / or perpetuate infection in a host and / or in vitro target cell. Neutralizing monoclonal human antibodies and antigen-binding fragments thereof are described herein, which recognize antigens derived from HIV, such as the gp120 polypeptide. In certain embodiments, a "neutralizing antibody" can inhibit the entry of HIV-1 viruses, such as SF162 and / or JR-CSF, with a neutralization index greater than 1.5 or greater than 2.0 (Kostrikis LG et al., Virol. 1996; 70(1):445-458). A "broadly neutralizing antibody" refers to an antibody that neutralizes two or more HIV-1 virus species (from various clades and different strains within a clade) in a neutralization assay. A broadly neutralizing antibody may neutralize at least 2, 3, 4, 5, 6, 7, 8, 9, or more different strains of HIV-1, and may neutralize strains belonging to the same or different clades. In certain embodiments, a broadly neutralizing antibody can neutralize multiple HIV-1 species belonging to at least 2, 3, 4, 5, or 6 different clades. In certain embodiments, the inhibitory concentration of a monoclonal antibody can be less than about 0.0001 μg / mL, less than about 0.001 μg / mL, less than about 0.01 μg / mL, less than about 0.1 μg / mL, less than about 0.5 μg / mL, less than about 1.0 μg / mL, less than about 5 μg / mL, less than about 10 μg / mL, less than about 25 μg / mL, less than about 50 μg / mL, or less than about 100 μg / mL to neutralize about 50% of the input virus in a neutralization assay.
[0048] The HIV virus is divided into specific groups, M, N, O, and P, of which M is the "major" group and accounts for the majority of HIV / AIDS cases overall. Based on their genetic sequences, group M is further subdivided into subtypes (also called clades) with prevalence in different geographic locations.
[0049] Group M "subtypes" or "clades" are subtypes of HIV-1 group M identified by genetic sequence data. Examples of group M subtypes include subtypes A through K. Some subtypes are known to be more virulent or resistant to different drug therapies. There are also "circulating recombinant forms" or CRFs resulting from recombinations between viruses of different subtypes, each of which is individually numbered. CRF12_BF, for example, is a recombination of subtypes B and F. Subtype A is common in West Africa. Subtype B is the predominant form in Europe, America, Japan, Thailand, and Australia. Subtype C is the predominant form in South Africa, East Africa, India, Nepal, and parts of China. Subtype D is generally found only in East and Central Africa. Subtype E has not been identified as a non-recombinant and recombines only with subtype A, as CRF01_AE. Subtype F is found in Central Africa, South America, and Eastern Europe. Subtype G (and CRF02_AG) is found in Africa and Central Europe. Subtype H is restricted to Central Africa. Subtype I was originally used to describe the strain considered here as CRF04_cpx, which has a cpx due to "complex" recombination of several subtypes. Subtype J is found mainly in North, Central, and West Africa, and Caribbean subtype K is restricted to the Democratic Republic of the Congo and Cameroon. These subtypes are divided into sub-subtypes such as A1 and A2 or F1 and F2. In 2015, the strain CRF19, a recombinant of subtypes A, D, and G with a subtype D protease, was found to be strongly associated with the rapid progression of AIDS in Cuba.
[0050] "HIV tropism" refers to the specificity of the HIV virus for a particular host cell, determined in part by the interaction of viral surface structures with receptors present on the surface of the host cell. The HIV tropism of a patient's virus can be measured, for example, by sequencing analysis or by the TROFILE® assay (monogrambio.com) (see, e.g., Lee et al., "AIDS Res Hum Retroviruses." (2013) Vol. 29(6):979-84).
[0051] HIV can infect a variety of cells, including CD4+ helper T cells, and macrophages that express CD4 molecules on their surface. HIV-1 entry into macrophages and T helper cells is mediated not only by interaction of the virion envelope glycoprotein (e.g., gp120) with the CD4 molecule on the target cell, but also by interaction with its chemokine co-receptors. Macrophage (M-tropic) strains of HIV-1 or non-syncitia-inducing (NSI) strains require the β-chemokine receptor CC1 for entry. These strains are called R5 viruses. This CCR5 coreceptor is used by almost all primary HIV-1 isolates, regardless of viral genetic subtype. T-tropic isolates, or syncytia-inducing (SI) strains, are able to replicate in primary CD4+ T cells. They replicate in macrophages and in cells and use the alpha chemokine receptor, CSCR4, for entry. These strains are called X4 viruses. Viruses that use only the CCR5 receptor are called R5, viruses that use only CXCR4 are called X4, and viruses that use both are called X4R5 or dual / mixed tropism. However, the use of a coreceptor alone does not explain viral tropism, as not all R5 viruses can use CCR5 on macrophages for productive infection.
[0052] Also described herein is "non-neutralizing antibody", which in certain embodiments is an antibody that binds to one or more strains of virus but does not neutralize the virus.However, in terms of Fc-mediated killing, non-neutralizing antibody can still eliminate the cells that express the virus antigen that is bound by antibody but not neutralized.Therefore, in certain embodiments, antibody can bind to virus antigen and eliminate virus-infected cells without neutralizing the virus.
[0053] The term "nucleic acid molecule" refers to polymeric forms of nucleotides, including both sense and antisense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. In certain embodiments, nucleotides refer to ribonucleotides, deoxyribonucleotides, or modified forms of any type of nucleotide, and combinations thereof. The term also includes, but is not limited to, single- and double-stranded forms of DNA. In addition, polynucleotides, such as cDNA or mRNA, can contain either or both naturally occurring and modified nucleotides linked together by naturally occurring and / or non-naturally occurring nucleotide linkages. Nucleic acid molecules may be chemically or biochemically modified or contain non-natural or derivatized nucleotide bases, as will be readily understood by those skilled in the art. Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with analogs, internucleotide modifications such as uncharged linkages (e.g., methylphosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), pendant moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralens, etc.), chelators, alkylating agents, and modified linkages (e.g., α-anomeric nucleic acids, etc.). The above terms also refer to any topological conformation, including single-stranded, double-stranded, partially duplexed, triplexed, hairpinned, circular, and padlocked conformations. Reference to a nucleic acid sequence is also intended to include other topological conformations. Unless otherwise specified, the complement thereof is included. Thus, a reference to a nucleic acid molecule having a particular sequence should be understood to encompass the complementary strand, having the complementary sequence. This term also includes codon-optimized nucleic acids.
[0054] The term "operably linked" refers to two or more nucleic acid sequence elements that are typically physically linked and in a functional relationship to each other. By way of example, a promoter is operably linked to a coding sequence if the promoter is capable of initiating or regulating the transcription or expression of the coding sequence, in which case the coding sequence should be understood to be "under the control of the promoter."
[0055] As used herein, a "substitution" refers to the replacement of one or more amino acids or nucleotides by different amino acids or nucleotides, respectively.
[0056] An "isolated" nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. Isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but where the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0057] An "isolated nucleic acid encoding an antibody or fragment thereof" refers to one or more such nucleic acid molecules encoding the heavy and light chains (or fragments thereof) of an antibody, including nucleic acid molecules in a single vector or separate vectors, and such nucleic acid molecules present in one or more locations within a host cell.
[0058] As used herein, the term "vector" refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes vectors as self-replicating nucleic acid structures and vectors that integrate into the genome of a host cell into which they are introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operably linked. Such vectors are referred to as:
[0059] Polynucleotide "variants," as that term is used herein, are polynucleotides that typically differ from the polynucleotides specifically disclosed herein by one or more substitutions, deletions, additions, and / or insertions. Such variants may be naturally occurring or may be synthetically produced, for example, by modifying one or more of the polynucleotide sequences described herein, by assessing one or more biological activities of the encoded polypeptides described herein, and / or by using any of a number of techniques well known in the art.
[0060] Polypeptide "variants," as that term is used herein, are polypeptides that typically differ from the polypeptides specifically disclosed herein by one or more substitutions, deletions, additions, and / or insertions. Such variants may be naturally occurring or may be synthetically produced, for example, by modifying one or more of the above polypeptide sequences of the invention, by assessing one or more biological activities of the polypeptides described herein, and / or by using any of a number of techniques well known in the art.
[0061] The term "variant" may also refer to any naturally occurring or genetically engineered molecule that contains one or more nucleotide or amino acid mutations. In one embodiment, the molecule is an antibody. For example, somatic variants may include all related naturally occurring antibodies that are part of or derived from the same B-cell lineage. Genetically engineered variants may include all single or combinatorial mutations made to an antibody.
[0062] Modifications can be made in the structure of the polynucleotides and polypeptides of the invention to obtain functional molecules that encode variant or derivative polypeptides with desirable characteristics. When it is desired to alter the amino acid sequence of a polypeptide to produce an equivalent or even improved variant or portion of a polypeptide of the invention, one skilled in the art will typically change one or more of the codons in the encoding DNA sequence.
[0063] For example, certain amino acids can be substituted for other amino acids in the protein structure without appreciable loss of its ability to bind to other polypeptides (e.g., antigens) or cells. Because it is the binding ability and properties of a protein that define its biological functional activity, certain amino acid sequence substitutions can be made in the protein sequence, and of course, the underlying DNA coding sequence, and still obtain a protein with similar properties. Thus, it is contemplated that various changes can be made in the polypeptide sequences of the disclosed antibodies and antigen-binding fragments thereof, or the corresponding DNA sequences encoding such polypeptides, without appreciable loss of their biological utility or activity.
[0064] Often, a polypeptide variant contains one or more conservative substitutions, which are substitutions of an amino acid with another amino acid of similar properties that one skilled in the art of peptide chemistry would expect to result in substantially no change in the secondary structure and hydropathic properties of the polypeptide.
[0065] When comparing polynucleotide and polypeptide sequences, two sequences are said to be "identical" if, when aligned for maximum correspondence as described below, the sequences of nucleotides or amino acids in the two sequences are identical. Comparison between two sequences is typically performed by comparing over a comparison window to identify and compare local regions of sequence similarity. As used herein, a "comparison window" refers to a segment of at least about 20 contiguous positions, usually 30 to about 75, 40 to about 50, and a sequence can be compared to a reference sequence over the same number of contiguous positions after the two sequences are optimally aligned.
[0066] Alignment of sequences for comparison may be performed using the Megalign program in the Lasergene suite of bioinformatics software (DNASTAR, Inc., Madison, WI) using default parameters. This program compiles several alignment schemes described in the following references: Dayhoff, "MO" (1978) "A model of evolutionary change in proteins - Matrices for detecting distant relationships."; In Dayhoff, MO (ed.), Atlas of Protein Sequence and Structure, National Biomedical Research Foundation (Washington DC), Vol. 5, Supplement 3, pp. 345-358; Hein J. (1990), Unified Approach to Alignment and Phylogenes, pp. 626-645; Methods in Enzymology, Vol. 183, Academic Press, Inc. (San Diego, CA); Higgins, DG and Sharp, PM (1989), CABIOS, Vol. 5: pp. 151-153; Myers, EW and Muller W. (1988), “CABIOS” Vol. 4: No. 11-17; Robinson, ED (1971), “Comb. Theor” Vol. 77: No. 105; Santou, N. .Nes, M. (1987) “Mol.Biol.Evol.” Vol. 4: pp. 406-425; Sneath, PHA and Sokal, RR (1973) “Numerical "Taxonomy-the Principles and Practice of Numerical Taxonomy", Freeman Press (San Francisco, CA); Wilbur, WJ and Lipman, DJ (1983) "Proc. Natl. Acad., Sci. USA" Vol. 80: pp. 726-730.
[0067] Alternatively, alignment of sequences for comparison may be performed by the local identity algorithm of Smith and Waterman (1981), Add. APL. Math. 2:482, by the identity alignment algorithm of Needleman and Wunsch (1970), J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988), Proc. Natl. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA, Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, WI), or by inspection.
[0068] Examples of suitable algorithms for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, described in Altschul et al. (1977) Nucl. Acids Res. 25:3389-3402 and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. BLAST and BLAST 2.0 can be used, for example, with the parameters described herein, to determine percent sequence identity for the polynucleotides and polypeptides described herein. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
[0069] In one illustrative example, the cumulative score is calculated based on a parameter M (reward score for a pair of matching residues) for nucleotide sequences. The word hits can be calculated using a score (X; always > 0) and N (penalty score for mismatched residues; always < 0). Extension of the word hits in each direction is stopped when: the cumulative alignment score falls by an amount X from its maximum achieved value; the cumulative score falls below zero due to the accumulation of alignments of one or more negative-scoring residues; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 11 and an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915). Alignment defaults are (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
[0070] For amino acid sequences, a scoring matrix can be used to calculate the cumulative score. Extension of the word hits in each direction is halted when: the cumulative alignment score falls by an amount X from its maximum achieved value; the cumulative score falls below zero due to the accumulation of alignments of one or more negative-scoring residues; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
[0071] In one approach, "percentage of sequence identity" is determined by comparing two optimally aligned sequences over a comparison window of at least 20 positions, where the portion of the polynucleotide or polypeptide sequence in the comparison window may contain 20% or less, typically 5-15%, or 10-12% additions or deletions (i.e., gaps) compared to the reference sequence for alignment of the two sequences (which does not include additions or deletions). This percentage is calculated by determining the number of positions where the same nucleic acid base or amino acid residue occurs in both sequences to obtain the number of matched positions, dividing this number of matched positions by the total number of positions in the reference sequence (i.e., the window size), and multiplying the result by 100 to obtain the percentage of sequence identity.
[0072] "Homology" refers to the percentage of residues in a polynucleotide or polypeptide sequence variant that are identical to the non-variant sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent of homology.
[0073] "Binding affinity" can refer to the binding dissociation constant (Kd) or apparent affinity (e.g., EC50) value. In an embodiment of the present invention, for example, the following items are provided: (Item 1) 1. A method of treating or preventing HIV in a human subject in need thereof, the method comprising: (a) identifying a human subject infected with HIV or a population of HIV that expresses gp120 comprising the following amino acid residues: N332 glycan, D325, and one or more amino acid residues selected from the group consisting of T63, L179, T320, and H330, wherein said amino acid positions refer to SEQ ID NO:4; (b) administering to the subject an effective amount of an antibody or antigen-binding fragment thereof that competes with or comprises the VH and VL regions and binds to an epitope of gp120 within the third variable loop (V3) and / or the high mannose patch including the N332 oligomannose glycan. (Item 2) The following amino acid residues: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycans, D325, and T320; iv. N332 glycan, D325, and H330; v. N332 glycan, D325, T63, and L179; vi. N332 glycan, D325, T63, and T320; vii. N332 glycan, D325, T63, and H330; viii. N332 glycan, D325, L179, and T320; ix. N332 glycan, D325, L179, and H330; x. N332 glycan, D325, T320, and H330; xi. N332 glycan, D325, T63, T320, and H330; xii. N332 glycan, D325, T63, L179, and T320; xiii. N332 glycan, D325, T63, L179, and H330; xiv. N332 glycan, D325, L179, T320, and H330; or xv. The method of item 1, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, T320, and H330. (Item 3) The following amino acid residues: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycan, D325, and T320; or iv. The method of item 1, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycans, D325, and H330. (Item 4) The following amino acid residues: i. N332 glycan, D325, T63, and L179; ii. N332 glycans, D325, T63, and T320; iii. N332 glycan, D325, T63, and H330; iv. N332 glycan, D325, L179, and T320; v. N332 glycan, D325, L179, and H330; or vi. The method of item 1 or 2, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycans, D325, T320, and H330. (Item 5) The following amino acid residues: i. N332 glycan, D325, L179, T320, and H330; ii. N332 glycan, D325, T63, T320, and H330; iii. N332 glycan, D325, T63, L179, and T320; or iv. The method of any one of items 1 to 5, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, and H330. (Item 6) The following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, T320, and H330; iii. N332 glycan, D325, L179, T320, and H330; or iv. The method of any one of items 1 to 5, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, T320, and H330. (Item 7) The target is an amino acid residue: i. Glycan 301; ii. K677; iii. not_W17; iv. not_R747; v. insertion_321.01; vi. E429; vii. Q442; viii. R335; ix. I165; x. S393; xi. I307; xii. 295 glycans; and / or xiii. N300. (Item 8) 8. The method of any one of items 1 to 7, wherein at least 90%, e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of the HIV species in the HIV population comprise the recited amino acid residue. (Item 9) The administered antibody or antigen-binding fragment thereof is selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124, PGT-125, PGT-126, PGT-128, PGT-130, PGT-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138, PGT-139, GS-2872, 10-1074, 10-1074-J 9. The method of any one of items 1 to 8, wherein the antibody competes with or comprises a VH and VL region from an antibody selected from the group consisting of: 354BG1, 354BG2, 354BG3, 354BG4, 354BG5, 354BG6, 354BG7, 354BG8, 354BG9, 354BG10, 354BG11, 354BG12, 354BG13, 354BG14, 354BG15, 354BG16, 354BG17, 354BG18, 354BG19, 354BG20, 354BG21, 354BG22, 354BG23, 354BG24, 2G12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A, BF520.1, and VRC29.03. (Item 10) 10. The method of any one of items 1 to 9, wherein the antibody or antigen-binding fragment thereof competes with or comprises a VH and VL region from an antibody selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-124, PGT-134, GS-2872, 10-1074, 10-1074-J, PGT-122, and PGT-123. (Item 11) 10. The antibody comprises, at the indicated positions (EU index numbering), the following amino acids: i. tyrosine at position 252, threonine at position 254, and glutamic acid at position 256 (YTE); or ii. The method according to any one of items 1 to 10, comprising an Fc region comprising leucine at position 428 and serine at position 434 (LS). (Item 12) 10. The antibody comprises, at the indicated positions (EU index numbering), the following amino acids: i. asparaginate at position 239 and glutaminate at position 332 (DE); ii. asparaginate at position 239, glutamate at position 332, and leucine at position 330 (DEL); iii. asparaginate at position 239, glutamate at position 332, and alanine at position 236 (DEA); or iv. The method of any one of items 1 to 11, comprising an Fc region comprising asparaginate at position 239, glutamate at position 332, alanine at position 236, and leucine at position 330 (DEAL). (Item 13) 11. The method of any one of items 1 to 10, comprising administering an antigen-binding fragment. (Item 14) 14. The method of claim 13, wherein the antigen-binding fragment is selected from the group consisting of scFv, Fab, Fab2, Fab', F(ab')2, Fv, and diabody. (Item 15) 15. The method according to any one of items 1 to 14, wherein the antibody is a multispecific antibody. (Item 16) 16. The method of any one of items 1 to 15, wherein the human subject is acutely infected with HIV. (Item 17) 17. The method of claim 16, wherein the antibody is administered to a human subject with Fiebig stage IV or earlier HIV infection. (Item 18) 17. The method of claim 16, wherein the antibody is administered to a non-seroconverted human subject. (Item 19) 16. The method of any one of items 1 to 15, wherein the human subject is recently infected with HIV. (Item 20) 20. The method of item 19, wherein the antibody is administered to a human subject with Fiebig stage V or Fiebig stage VI HIV infection. (Item 21) 16. The method of any one of items 1 to 15, wherein the human subject is chronically infected with HIV. (Item 22) 22. The method of any one of items 1 to 21, wherein the human subject is infected with an HIV clade B virus. (Item 23) The following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, L179, T320, and H330; or iii. The method of claim 22, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, T320, and H330. (Item 24) 24. The method of any one of items 1 to 23, wherein the human subject is infected with an HIV clade A virus. (Item 25) 25. The method of any one of items 1 to 24, wherein the human subject is infected with an HIV clade C virus. (Item 26) 26. The method of any one of items 1 to 25, further comprising administering to the subject one or more additional therapeutic agents for treating HIV infection. (Item 27) 27. The method of any one of items 1 to 26, wherein the subject is not receiving antiretroviral therapy (ART) or ART is discontinued prior to administration of the antibody. (Item 28) 27. The method of any one of items 1 to 26, wherein ART is discontinued after one or more administrations of the antibody or antigen-binding fragment thereof. (Item 29) 27. The method of any one of items 1 to 26, further comprising administering to the subject one or more antiretroviral therapy (ART) agents. (Item 30) The subject: i. the second variable loop (V2) and / or the Env trimer tip; ii. CD4 binding site (CD4bs); iii. the gp120 / gp41 interface; or iv. a silent face of gp120. (Item 31) 31. The method of claim 30, wherein the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp120 in the second variable loop (V2) and / or Env trimer tip and competes with or comprises VH and VL regions from an antibody selected from the group consisting of PG9, PG16, PGC14, PGG14, PGT-142, PGT-143, PGT-144, PGT-145, CH01, CH59, PGDM1400, CAP256, CAP256-VRC26.08, CAP256-VRC26.09, CAP256-VRC26.25, PCT64-24E, and VRC38.01. (Item 32) the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp120 in the CD4 binding site (CD4bs), and is selected from the group consisting of b12, F105, VRC01, VRC07, VRC07-523, VRC03, VRC06, and VRC06b01; 31. The method of claim 30, wherein the antibody competes with or comprises a VH and VL region from an antibody selected from the group consisting of VRC08, VRC0801, NIH45-46, GS-9723, GS-5423, 3BNC117, 3BNC60, VRC-PG04, PGV04, CH103, 44-VRC13.01, 1NC9, 12A12, N6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cowl, IOMA, CH235, and CH235.12, N49P6, N49P7, N49P11, N49P9, and N60P25. (Item 33) 31. The method of claim 30, wherein the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp120 at the gp120 / gp41 interface and competes with or comprises a VH and VL region from an antibody selected from the group consisting of PGT-151, CAP248-2B, 35O22, 8ANC195, ACS202, VRC34, and VRC34.01. (Item 34) 31. The method of claim 30, wherein the second antibody or antigen-binding fragment thereof binds to an epitope or region of the gp120 silent face and competes with or comprises the VH and VL regions from antibody VRC-PG05. (Item 35) 31. The method of claim 30, wherein the second antibody or antigen-binding fragment thereof binds to an epitope or region of gp41 in the membrane proximal region (MPER) and competes with or comprises a VH and VL region from an antibody selected from the group consisting of 10E8, 10E8v4, 10E8-5R-100cF, 4E10, DH511.11P, 2F5, 7b2, and LN01. (Item 36) 31. The method of claim 30, wherein the second antibody or antigen-binding fragment thereof binds to an epitope or region of the fusion peptide of gp41 and competes with or comprises a VH and VL region from an antibody selected from the group consisting of VRC34 and ACS202. (Item 37) 37. The method of any one of items 1 to 36, further comprising administering a TLR agonist to the subject. (Item 38) 38. The method of claim 37, wherein the TLR agonist is a TLR2 agonist, a TLR3 agonist, a TLR7 agonist, a TLR8 agonist, or a TLR9 agonist. (Item 39) 39. The method of claim 38, wherein the TLR7 agonist is selected from the group consisting of vesatolimod, imiquimod, and resiquimod. (Item 40) 40. The method of any one of items 1 to 39, comprising multiple administrations of the antibody or antigen-binding fragment thereof, and optionally administering a TLR agonist at predetermined intervals. (Item 41) 41. The method of any one of paragraphs 1-40, wherein after one or more administrations of the antibody or antigen-binding fragment thereof, the subject does not exhibit symptoms of HIV or AIDS in the absence of antiretroviral therapy (ART) for at least 6 months, at least 1 year, at least 2 years, at least 3 years, or longer. (Item 42) 42. The method of any one of items 1-41, wherein after one or more administrations of the antibody, the subject has a viral load copies / mL of blood of less than 500, e.g., less than 400, less than 300, less than 200, less than 100, less than 50, for at least 6 months, at least 1 year, at least 2 years, at least 3 years, or more, in the absence of antiretroviral therapy (ART). (Item 43) A method for identifying human subjects infected with HIV or a population of HIV that are susceptible to an antibody or antigen-binding fragment thereof that competes with or comprises VH and VL regions that bind to an epitope of gp120 within the third variable loop (V3) and / or high mannose patch comprising the N332 oligomannose glycan, the method comprising identifying, in a biological sample from the human subject, HIV that expresses gp120 comprising the following amino acid residues: N332 glycan, D325, and one or more amino acid residues selected from the group consisting of T63, L179, T320, and H330, wherein the amino acid positions refer to SEQ ID NO: 4. (Item 44) The target is an amino acid residue: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycans, D325, and T320; iv. N332 glycan, D325, and H330; v. N332 glycan, D325, T63, and L179; vi. N332 glycan, D325, T63, and T320; vii. N332 glycan, D325, T63, and H330; viii. N332 glycan, D325, L179, and T320; ix. N332 glycan, D325, L179, and H330; x. N332 glycan, D325, T320, and H330; xi. N332 glycan, D325, T63, T320, and H330; xii. N332 glycan, D325, T63, L179, and T320; xiii. N332 glycan, D325, T63, L179, and H330; xiv. N332 glycan, D325, L179, T320, and H330; or xv. The method of item 43, wherein the infected HIV or population of HIV expresses gp120 comprising N332 glycan, D325, T63, L179, T320, and H330. (Item 45) The target is an amino acid residue: i. N332 glycan, D325, and T63; ii. N332 glycan, D325, and L179; iii. N332 glycan, D325, and T320; or iv. The method of any one of items 43 to 44, wherein the infected HIV or population of HIV expresses gp120, comprising N332 glycans, D325, and H330. (Item 46) The target is an amino acid residue: i. N332 glycan, D325, T63, and L179; ii. N332 glycans, D325, T63, and T320; iii. N332 glycan, D325, T63, and H330; iv. N332 glycan, D325, L179, and T320; v. N332 glycan, D325, L179, and H330; or vi. The method of any one of items 43 to 45, wherein the HIV or population of HIV infected expresses gp120 comprising N332 glycan, D325, T320, and H330. (Item 47) The following amino acid residues: i. N332 glycan, D325, L179, T320, and H330; ii. N332 glycan, D325, T63, T320, and H330; iii. N332 glycan, D325, T63, L179, and T320; or iv. The method of any one of paragraphs 43 to 46, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, and H330. (Item 48) The following amino acid residues: i. N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, T320, and H330; iii. N332 glycan, D325, L179, T320, and H330; or iv. The method of any one of paragraphs 43 to 47, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, T320, and H330. (Item 49) The following amino acid residues: i. Glycan 301; ii. K677; iii. not_W17; iv. not_R747; v. insertion_321.01; vi. E429; vii. Q442; viii. R335; ix. I165; x. S393; xi. I307; xii. 295 glycans; and / or xiii. The method of any one of items 43 to 48, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120, including N300. (Item 50) 50. The method of any one of items 43 to 49, wherein at least 90%, e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of the HIV species in the HIV population comprise the recited amino acid residue. (Item 51) The antibody or antigen-binding fragment thereof is selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124, PGT-125, PGT-126, PGT-128, PGT-130, PGT-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138, PGT-139, 10-1074, 10-1074-J, VRC24, 2 51. The method of any one of items 43 to 50, wherein the antibody competes with or comprises a VH and VL region from an antibody selected from the group consisting of: BG12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A, BF520.1, and VRC29.03. (Item 52) 52. The method of any one of items 43 to 51, wherein the antibody or antigen-binding fragment thereof competes with or comprises a VH and VL region from an antibody selected from the group consisting of GS-9722, GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-124, PGT-134, GS-2872, 10-1074, 10-1074-J, PGT-122, and PGT-123. (Item 53) 53. The method of any one of items 43 to 52, wherein the human subject is acutely infected with HIV. (Item 54) 54. The method of claim 53, wherein the antibody is administered to a human subject with Fiebig stage IV or earlier HIV infection. (Item 55) 54. The method of claim 53, wherein the antibody is administered to a non-seroconverted human subject. (Item 56) 53. The method of any one of items 43 to 52, wherein the human subject is recently infected with HIV. (Item 57) 57. The method of claim 56, wherein the antibody is administered to a human subject with Fiebig stage V or Fiebig stage VI HIV infection. (Item 58) 53. The method of any one of items 43 to 52, wherein the human subject is chronically infected with HIV. (Item 59) 59. The method of any one of items 43 to 58, wherein the human subject is infected with an HIV clade B virus. (Item 60) The following amino acid residues: i.N332 glycan, D325, T63, and H330; ii. N332 glycan, D325, L179, T320, and H330; or iii. The method of paragraph 59, comprising identifying a subject infected with HIV or a population of HIV that expresses gp120 comprising N332 glycan, D325, T63, L179, T320, and H330. (Item 61) 61. The method of any one of items 43 to 60, wherein the human subject is infected with an HIV clade A virus. (Item 62) 62. The method of any one of items 43 to 61, wherein the human subject is infected with an HIV clade C virus. (Item 63) 64. The method of any one of items 1 to 63, wherein the gp120 amino acid is identified in one or more gp120 polypeptide sequences expressed from HIV or a population of HIV isolated from the subject. (Item 64) 65. The method of any one of items 1 to 64, wherein the gp120 amino acid is identified in one or more gp120 polynucleotide sequences from HIV isolated from the subject or a population of HIV. (Item 65) 65. The method of claim 64, comprising performing next-generation sequencing (NGS) on polynucleotide sequences encoding gp120 from a population of HIV. (Item 66) 66. The method of claim 65, wherein the gp120 variant is detected to a frequency level of about 1% in the viral population. (Item 67) 67. The method of any one of items 1 to 66, wherein the gp120 amino acids are identified in one or more biological samples from the subject, wherein the one or more biological samples are obtained from blood, peripheral blood mononuclear cells (PBMCs), serum, plasma, semen, or lymph nodes. (Item 68) 68. The method of any one of items 1 to 67, comprising identifying a population of HIV RNA in a serum or plasma sample. (Item 69) 69. The method of any one of items 1 to 68, further comprising the step of obtaining one or more biological samples from the subject. (Item 70) 70. The method of claim 69, wherein two or more biological samples are obtained from the subject. (Item 71) 71. The method of item 70, wherein the two or more biological samples are obtained from the same tissue or fluid at two or more different time points. (Item 72) 71. The method of claim 70, wherein the two or more biological samples are obtained from different tissues or fluids or different anatomical locations. [Brief explanation of the drawings]
[0074] [Figure 1] The number of screened subjects from the Zurich Primary HIV Infection Cohort Study with genotypes predictive of susceptibility to GS-9722 (elipovimab) is shown. Pre-ART plasma samples from 92 individuals were analyzed in the GenoSure HIV Envelope RNA Assay. "None" indicates all screened individuals who were not selected for a specific amino acid in the HIV envelope gene. The amino acid position is shown for each category.
[0075] [Figure 2] The number of screened clade B subjects from the Zurich Primary HIV Infection Cohort Study with genotypes predictive of susceptibility to GS-9722 is shown. Pre-ART plasma samples from 59 clade B-infected individuals were analyzed in the GenoSure HIV Envelope RNA Assay. "None" indicates all screened individuals who were not selected for a specific amino acid in the HIV envelope gene. The amino acid position is indicated for each category.
[0076] [Figure 3] Figure 1 shows the sensitivity of swarm viruses from pre-ART plasma samples from the Zurich Primary HIV Infection Cohort Study to GS-9722. Viruses from 29 samples with a positive predictive value of 80.7% or higher were analyzed using the PHENOSENSE® HIV Entry Assay (Monogram Biosciences). Amino acid positions are indicated for each category.
[0077] [Figure 4]Figure 4 shows the susceptibility to GS-9722 of viruses subcloned from swarm viruses derived from pre-ART plasma samples from the Zurich Primary HIV Infection Cohort Study. Twenty individual viruses from four pre-ART plasma samples in which swarm viruses were predicted to be susceptible by genotyping and tested susceptible by phenotyping were analyzed with the PHENOSENSE® HIV Entry Assay (Monogram Biosciences). The solid line indicates the IC50 against swarm viruses. DETAILED DESCRIPTION OF THE INVENTION
[0078] 1. Introduction The method is based, in part, on the unexpected discovery of a population of HIV-infected patients who respond to administration of anti-HIV gp120V3-glycan-directed antibodies or antigen-binding fragments thereof in the absence of co-administration of additional anti-HIV antibodies directed against other HIV antigens (e.g., gp41) or non-overlapping epitopes of the same HIV antigen (e.g., directed against gp120 within the CD4 binding site or V2 apical region). Such patients are infected with a strain of HIV that has a gp120 protein that is bound by the V3 glycan-directed antibodies or antigen-binding fragments thereof.
[0079] Generally, the methods involve identifying human subjects infected with HIV or a population of HIV that express gp120 that includes the following: a glycosylated asparagine at a position corresponding to amino acid residue 332 (N332 glycan), an aspartate at a position corresponding to amino acid residue 325 (D325), and one or more of the following amino acids (amino acid positions refer to SEQ ID NO:4 (i.e., residues 1-511 of NCBI Reference SEQ ID NO: NP_057856.1)): a threonine at a position corresponding to amino acid residue 63 (T63), a leucine at a position corresponding to amino acid residue 179 (L179), a threonine at a position corresponding to amino acid residue 320 (T320), and a histidine at a position corresponding to amino acid residue 330 (H330) (amino acid positions refer to SEQ ID NO:4 (i.e., residues 1-511 of NCBI Reference SEQ ID NO: NP_057856.1)). In various embodiments, the glycan is oligomannose.
[0080] 2. Identification of subjects who will respond to treatment with anti-HIV gp120V3-glycan directed antibodies or antigen-binding fragments thereof. In some embodiments, the patient is identified by receiving a report of the HIV strain infecting the patient that identifies an HIV gpl20 amino acid residue present at a designated amino acid position of interest, e.g., one or more amino acid positions from the group consisting of 332 and 325, and 63, 179, 320, and 330, where the amino acid positions are referenced to SEQ ID NO:4. In some embodiments, the patient is identified by performing one or more assays (e.g., polynucleotide sequencing or polypeptide sequencing) to determine the amino acid sequence of gpl20 or the amino acid residues present at the designated amino acid positions of interest of the gpl20 protein of the HIV strain infecting the patient. Identification of the full-length or partial sequence of the gpl20 protein obtained from the subject can be determined at the polynucleotide or polypeptide level. In some embodiments, the amino acid present at the gpl20 residue position of interest is determined at the polypeptide level.
[0081] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising N332 glycans, D325, and T63, the amino acid positions referencing SEQ ID NO:4.
[0082] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising N332 glycans, D325, and L179, the amino acid positions referencing SEQ ID NO:4.
[0083] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising N332 glycans, D325, and T320, the amino acid positions referencing SEQ ID NO:4.
[0084] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising N332 glycan, D325, and H330, the amino acid positions referencing SEQ ID NO:4.
[0085] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising the N332 glycan, D325, T63, and L179, the amino acid positions referencing SEQ ID NO:4.
[0086] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising the N332 glycan, D325, T63, and T320, the amino acid positions referencing SEQ ID NO:4.
[0087] In some embodiments, the subject is infected with an HIV Clade B virus. In various embodiments, the method involves identifying a subject infected with HIV or a population of HIV that expresses a gp120 comprising the N332 glycan, D325, T63, and H330, where the amino acid positions are referenced to SEQ ID NO: 4. In various embodiments, the method involves identifying a subject infected with HIV or a population of HIV that expresses a gp120 comprising the N332 glycan, D325, T63, L179, T320, and H330, where the amino acid positions are referenced to SEQ ID NO: 4.
[0088] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising the N332 glycan, D325, T320, and H330, the amino acid positions referencing SEQ ID NO:4.
[0089] In various embodiments, the methods involve identifying a subject infected with HIV or a population of HIV that expresses a gp120 comprising the N332 glycan, D325, L179, T320, and H330, where the amino acid positions refer to SEQ ID NO: 4. In some embodiments, the subject is infected with an HIV Clade A and / or HIV Clade C virus. In some embodiments, the subject is infected with an HIV Clade A, Clade B, and / or HIV Clade C virus.
[0090] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising the N332 glycan, D325, T63, L179, and T320, the amino acid positions referencing SEQ ID NO:4.
[0091] In various embodiments, the method involves identifying subjects infected with HIV or a population of HIV that express gp120 comprising the N332 glycan, D325, T63, L179, and H330, the amino acid positions referencing SEQ ID NO:4.
[0092] In some embodiments, the subject is an HIV-infected subject or a population of HIV that expresses gp120 further comprising one or more of the following amino acid residues: a glycan at amino acid residue 301 (Glycan 301); amino acid residue lysine 677 (K677); an amino acid residue other than tryptophan (Trp, W) (e.g., alanine (Ala, A); cysteine (Cys, C); aspartate or aspartic acid (Asp, D); glutamate or glutamic acid (Glu, E); phenylalanine (Phe, F); glycine (Gly, G); histidine (His, H); isoleucine (Ile, I); lysine (Lys, K); leucine (Leu, L); methionine (Met, M); asparagine (Asn, N); proline (Pro, P); glutamine (Gln, Q); arginine (Arg, R); serine (Ser, S); threonine (Thr, T) valine (Val, V) or tyrosine (Tyr, Y) at position 17 (not_W17); an amino acid residue other than arginine at position 747 (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, S, T, V, W, or Y) (not_R747); insertion_321.01 (e.g., any amino acid (e.g., A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, or Y) ) between positions G321 and K322; glutamic acid at position 429 (E429); glutamine at position 442 (Q442); arginine at position 335 (R335); isoleucine at position 165 (I165); serine at position 393 (S393); isoleucine at position 307 (I307); glycan at position 295 (295glycan); and / or asparagine at position 300 (N300) (amino acid positions refer to SEQ ID NO: 4).
[0093] gp120 The envelope glycoprotein gp120 (or gp120) is a 120 kDa glycoprotein that is part of the outer layer of HIV. It exists as a viral membrane spike consisting of three molecules of gp120 linked to each other and anchored to the membrane by the gp41 protein. gp120 is essential for viral infection because it facilitates HIV entry into host cells through interactions with cell surface receptors. These receptors include DC-SIGN, heparan sulfate proteoglycans, and the CD4 receptor. Binding to CD4 on helper T cells induces the initiation of a cascade of conformational changes in gp120 and gp41, which results in viral fusion with the host cell membrane.
[0094] gp120 is encoded by the HIV env gene, which encodes a gene product of approximately 850 amino acids. The major env product is the protein gp160, which is cleaved in the endoplasmic reticulum by the cellular protease furin into gp120 (approximately 480 amino acids) and gp41 (approximately 345 amino acids).
[0095] The V3 glycan site on gp120 is formed in part by a portion of the CCR5 coreceptor site and in part by surrounding camouflaging glycans (the so-called "high mannose patch") (Sok et al., Immunity (2016) 45:31-45). Broadly neutralizing antibodies (bnAbs) against the V3 glycan site are the most common of all antibodies found in HIV infection (Walker et al., PLoS Pathog. (2010) 6:e1001028 (2010); Landais et al., PLoS Pathog. (2016) 12:e1005369; Georgiev et al., Science (2013) 340:751-756). The consensus sequence of the V3 region of gp120 (Milich et al., J Virol. 67(9):5623-5634 (1993)) is provided below: CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC (SEQ ID NO: 1).
[0096] The amino acid sequence of an exemplary gp160 polypeptide of HIV clone WITO is provided below (the V3 hypervariable loop is bolded, and the potential N-linked glycosylation site at N332 is bolded and underlined): [Table 1]
[0097] The amino acid sequence of an exemplary gp160 polypeptide of the HIV clone identified in NCBI Reference SEQ ID NO: NP_057856.1 is provided below (the V3 hypervariable loop is bolded, and the potential N-linked glycosylation site at N332 is bolded and underlined): [Table 2]
[0098] The amino acid sequence of an exemplary gp120 polypeptide of an HXB2 subtype B HIV-1 isolate (corresponding to residues 1-511 of GenBank Accession No.: K0345; NCBI Reference SEQ ID NO: NP_057856.1) is provided below (the V3 hypervariable loop is bolded, the potential N-linked glycosylation site at N332 is bolded and underlined; the signal peptide is underlined): [Table 3]
[0099] The amino acid sequence of an exemplary gp120 polypeptide is provided below: [Table 4]
[0100] The amino acid sequence of another exemplary gp120 polypeptide (see bioafrica.net / proteomics / ENV-GP120prot.html) is provided below: [Table 5]
[0101] Genomic diversity among independent human immunodeficiency virus type 1 (HIV-1) isolates, and to a lesser extent between successive isolates from the same patient, and even within isolates from a single patient, is a well-known characteristic of HIV-1. While this sequence heterogeneity is distributed throughout the genome, the majority of the heterogeneity is located within the env gene. Comparison of predicted amino acid sequences from several different isolates shows that the sequence heterogeneity is clustered in five variable regions (designated V1–V5) of the surface glycoprotein, gp120. The V3 region, although only 35 amino acids long, exhibits considerable sequence variability. Interestingly, despite this variability, the V3 region is the most abundant HIV-1 protein in the CD4 + These include determinants that mediate interactions with cells. Increased gp120 variability leads to higher levels of viral replication, suggesting increased viral fitness in individuals infected with diverse HIV-1 variants. Variability in potential N-linked glycosylation sites (PNGS) also leads to increased viral fitness. PNGS allow the attachment of long-chain carbohydrates to the highly variable region of gp120. Thus, the number of PNGS in the env may affect viral fitness by rendering it more or less susceptible to neutralizing antibodies.
[0102] biological samples The HIV gp120 amino acid residues of interest are determined from HIV present or suspected to be present in a biological sample from a subject. The biological sample can be solid tissue or a biological fluid from a subject known to contain or suspected to contain HIV. In various embodiments, the biological sample comprises or is derived from blood, peripheral blood mononuclear cells (PBMCs), serum, plasma, semen, or lymph nodes. In some embodiments, the biological sample comprises or is derived from bile, blood, plasma, serum, breast milk, feces, pus, saliva, sebum, semen, sweat, tears, urine, or vomit. For example, in patients whose viral levels are suppressed by antiretroviral (ART) therapy, biological samples include solid tissues or biofluids from subjects known or suspected to contain HIV reservoirs, such as solid tissues and / or biofluids containing latently HIV-infected CD4+ T cells (including memory and non-memory effector CD4+ T cells), hematopoietic progenitors of CD4+ T cells, γδ T cells (including memory and memory effector γδ T cells), natural killer (NK) cells, myeloid cells (including monocytes and macrophages), hematopoietic progenitors of myeloid cells, and follicular dendritic cells. Anatomical reservoirs that may harbor latently HIV-infected cells include lymphoid tissues, the brain, and central nervous system, the gastrointestinal tract and gut-associated lymphoid tissue (GALT), the genital tract, the lungs, and the skin. Tissues and cells found to harbor latently HIV-infected cells and HIV reservoirs are described in, for example, Kuo et al., "Curr Opinion," 2004, 103(1):101-112, 2004. HIV AIDS. (2018) Vol. 13(No. 2): pp. 137-142; Mzingwane et al., Rev Med Virol. (2017) March; Vol. 27(No. 2), doi:10.1002 / rmv.1924 (PMID 28128885); Churchill et al., Nat Rev Microbiol. (2016) Vol. 14(No. 1): pp. 55-60; Barton et al., Trends Microbiol. (2016) Vol. 24(No. 5): pp. 345-355, which are incorporated by reference in their entireties for all purposes.
[0103] In some embodiments, multiple biological samples are evaluated from a single patient, for example, in some embodiments, two or more biological samples from two or more different tissues or two or more different anatomical reservoirs are evaluated from a single patient.
[0104] Stages of infection In various embodiments, the human subject is an adult, adolescent, or infant. The subject may be symptomatic (e.g., viremia) or asymptomatic (e.g., acute infection or ART suppression). In some embodiments, the human subject is acutely or recently infected with HIV. In certain embodiments, the subject has not seroconverted. In some embodiments, the human subject is chronically infected with HIV. The subject may or may not be on an antiretroviral therapy (ART) regimen.
[0105] Patients can be classified into Fiebig stages I through VI, based on successive increases in positive HIV-1 clinical diagnostic assays (viral RNA measured by PCR, p24 and p31 viral antigens measured by enzyme-linked immunosorbent assay (ELISA)). p24 antigen is a viral core protein that appears transiently in the blood during the rising phase of HIV-1 RNA levels, once they exceed 10,000 copies / mL, before the onset of detectable HIV antibodies. In Fiebig stage I, only HIV-1 RNA can be detected in the blood during rising viremia. Fiebig stage II begins approximately 7 days after a positive test result for p24 antigen. In Fiebig stage III, IgM anti-HIV-1 antibodies can be detected with sufficiently sensitive enzyme immunoassays (EIAs) (e.g., third-generation EIA) within approximately 5 days of a positive p24 antigen test result. Stage III typically occurs 1 to 2 weeks after the onset of acute retroviral symptoms. Fiebig stage IV represents the progression of an indeterminate Western blot test and occurs approximately three days after a positive EIA test result. Conversion to a clearly positive Western blot test, Fiebig stage V, generally occurs an additional seven days, or approximately one month, after initial infection. Fiebig stages of HIV infection are described in, e.g., Fiebig et al., AIDS. (2003) 17(13):1871-9; Cohen et al., J Infect Dis. (2010) 202, Suppl. 2:S270-7; and McMichael et al., Nature Reviews Immunology (2010) 10:11-23, which are incorporated herein by reference in their entireties for all purposes. In some embodiments, the biological sample evaluated is from a human subject with HIV infection at Fiebig stage IV or earlier, for example, Fiebig stage I, Fiebig stage II, Fiebig stage III, or Fiebig stage IV.In some embodiments, the biological sample assessed is from a human subject with Fiebig stage V HIV infection or Fiebig stage VI HIV infection.
[0106] In some embodiments, the method further comprises obtaining a biological sample from the subject. In some embodiments, the method involves receiving a report of HIV gp120 amino acid residues present at designated positions of interest, e.g., 332 and 325, and one or more amino acid positions from the group consisting of 63, 179, 320, and 330, wherein the amino acid positions are referenced to SEQ ID NO:4.
[0107] Determining the gp120 amino acid of interest Determination of amino acid residues in a subject's HIV gp120 sequence at designated positions of interest, e.g., one or more amino acid positions from the group consisting of 332 and 325, and 63, 179, 320, and 330 (amino acid positions refer to SEQ ID NO:4), can be performed at the polynucleotide or polypeptide level. At the polynucleotide level, HIV RNA or proviral DNA isolated from one or more biological samples can be sequenced using methods well known in the art. In some embodiments, HIV RNA or proviral DNA isolated from two or more biological samples from a subject is sequenced. In some embodiments, the two or more biological samples are obtained from different tissue sources (e.g., blood peripheral blood mononuclear cells, lymph nodes, and / or semen). In some embodiments, the two or more biological samples are obtained at different time points, e.g., 1, 2, 3, 4, 5, 6, 7, or 8 weeks apart, or 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months apart.
[0108] Optionally, primers that anneal and amplify the HIV env coding sequence, particularly the V3 variable region of gp120, can be used. In some embodiments, a nested set of primers can be used. In various embodiments, RNA can be sequenced directly or reverse-transcriptase polymerase chain reaction (RT-PCR) can be performed. In some embodiments, Sanger sequencing can be performed, for example, when sequencing to determine amino acid residues within the V3 region, or when sequencing samples from patients at an early Fiebig stage of disease, for example, earlier than Fiebig stage III, e.g., Fiebig stage I or II. In various embodiments, single genome amplification (SGA) and sequencing is performed. Single genome Methods for sequence amplification (SGA) and sequencing of plasma HIV virion RNA are described, for example, in Salazar-Gonzalez et al., (2008) J Virol 82:3952-3970; and Keele et al., Proc Natl Acad Sci USA. (2008) 105(21):7552-7557. The application of SGA to determine amino acid sequence variations in HIV gp120 sequences, which can be used in the methods described herein, is described, for example, in Bar et al., N Engl J Med. (2016) 375(21):2037-2050; and Mendoza et al., Nature. (2018) 561(7724):479-484. In various embodiments, high-throughput, next-generation sequencing (NGS), massively parallel, or deep sequencing technologies are used to sequence gp120, including at least the V3 variable region, from a population of HIV strains in one or more biological samples from a single patient or subject. In such cases, multiple nucleic acid sequences encoding at least the V3 variable region of gp120 are sequenced and aligned. In some embodiments, the entire length of gp120 is sequenced. Exemplary platforms for performing NGS sequencing that can be used to determine the gp120 sequence of HIV strains in one or more biological samples from a patient include Illumina (Solexa) (illumina.com), Ion torrent: Proton / PGM sequencing (thermofisher.com), SOLiD (thermofisher.com), and Single and Molecule, Real-Time (SMRT) Sequencing (Pacific Biosciences, pacb.com). Methods for isolating and sequencing HIV gp120, including at least the V3 glycan region, from a patient, which can be applied to the present method, are described in, for example, Shioda et al., J Virol. (1997) 71(7):4871-81; Colon et al., J Virol Antivir Res. (2015) 4(3):p.i.:143 (PMID:27358904); Kafando et al., PLoS One. (2017) 12(12):e0189999; Hebberecht et al., PLoS One. (2018) 13(4):e0195679; Andrews et al., Sci. Rep. (2018) Vol. 8(1): 5743, and Landais et al., "Immunity." (2017) Vol. 47(5): 990-1003. Optionally, shorter sequence reads of nucleic acid sequences ("contigs") can be assembled into longer sequences that include at least the V3 variable region of gp120. Methods for contig assembly of HIV genome sequences that can be applied in the present method are described in, for example, Huang et al., Bioinformation. (2018) Vol. 14 (No. 8): pp. 449-454; Hiener et al., J Vis Exp. (2018) October 16; (No. 140), doi:10.3791 / 58016; and Wymant et al., Virus Evol. (2018) May 18; Vol. 4 (No. 1): vey007. doi:10.1093 / ve / vey007.
[0109] In some embodiments, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of the sequenced V3 variable regions of gp120 in a population of HIV obtained from one or more biological samples from a single patient comprise an amino acid sequence that includes a glycosylated asparagine at a position corresponding to amino acid residue 332 (N332 glycan), an aspartate at a position corresponding to amino acid residue 325 (D325), and one or more of the following: a threonine at a position corresponding to amino acid residue 63 (T63), a leucine at a position corresponding to amino acid residue 179 (L179), a threonine at a position corresponding to amino acid residue 320 (T320), and a histidine at a position corresponding to amino acid residue 330 (H330) (amino acid positions are referenced in SEQ ID NO:4). As used herein, the numbering of a given amino acid polymer or nucleic acid polymer "corresponds to," "corresponding to," or "relative to" the numbering of a selected or referenced amino acid polymer or nucleic acid polymer when the position of any given polymer component (e.g., amino acid, nucleotide, also collectively referred to as "residue") is designated by reference to the same or equivalent position in the selected amino acid or nucleic acid polymer (e.g., based on optimal alignment or consensus sequence) rather than the actual numerical position of the component in the given polymer. In some embodiments, HIV gp120 variants are detected to a frequency level of about 1% in the viral population (e.g., 1% mutant or variant frequency). In some embodiments, HIV gp120 variants are detected to a frequency level of about 0.5% in the viral population. As a rule of thumb, HIV RNA levels of at least 1000 copies / mL are required to reliably detect variants at a frequency of 1%. See below.See, for example, Casadella et al., Virus Research, Vol. 239 (2017), pp. 69-81; Noguera-Julian et al., J Infect Dis., 2017, Vol. 216 (Suppl. 9): S829-S833; and Lee et al., Sci Rep., 2020, Vol. 10 (Issue 1): 1634.
[0110] 3. Administration of anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof In certain embodiments, the methods involve administering an anti-HIV antibody or antigen-binding fragment thereof, or antigen-binding molecule that targets the V3 glycan-binding region of gp120.
[0111] HIV-1 is the predominant family of HIV and accounts for 95% of all infections worldwide, while HIV-2 is found primarily in a few West African countries.
[0112] The HIV virus is divided into specific groups, M, N, O, and P, of which M is the "major" group and accounts for the majority of HIV / AIDS cases. Based on their genetic sequences, group M is further subdivided into subtypes (also called clades) with prevalence in different geographic locations.
[0113] Group M "subtypes" or "clades" are subtypes of HIV-1 group M identified by genetic sequence data. Examples of group M subtypes include subtypes A through K. Some subtypes are known to be more virulent or resistant to different drug therapies. There are also "recombinant epidemic strains" or CRFs resulting from recombinations between viruses of different subtypes, each of which is numbered. For example, CRF12_BF is a recombination of subtypes B and F. Subtype A is common in West Africa. Subtype B is the predominant form in Europe, the Americas, Japan, Thailand, and Australia. Subtype C is the predominant form in South Africa, East Africa, India, Nepal, and parts of China. Subtype D is generally found only in East and Central Africa. Subtype E has not been identified as a non-recombinant and has recombined only with subtype A, known as CRF01_AE. Subtype F is found in Central Africa, South America, and Eastern Europe. Subtype G (and CRF02_AG) is found in Africa and Central Europe. Subtype H is restricted to Central Africa. Subtype I was originally used to describe the strain considered here as CRF04_cpx, which has a cpx due to "complex" recombination of several subtypes. Subtype J is found primarily in North, Central, and West Africa, and Caribbean subtype K is restricted to the Democratic Republic of the Congo and Cameroon. These subtypes may be further divided into sub-subtypes such as A1 and A2 or F1 and F2. In 2015, strain CRF19, a recombinant of subtypes A, D, and G with a subtype D protease, was found to be strongly associated with the rapid progression of AIDS in Cuba.
[0114] The present disclosure provides, inter alia, methods for administering human anti-HIV neutralizing antibodies (e.g., broadly neutralizing antibodies) that target the V3-glycan region of the gp120 polypeptide on the surface of HIV-infected cells. Neutralizing antibodies against viral envelope proteins provide adaptive immune defense against HIV-1 challenge by preventing infection of susceptible cells. Broad neutralization indicates that the antibody can neutralize HIV-1 isolates from different clades. Thus, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein have cross-clade binding activity.
[0115] Antibodies and their antigen-binding fragments directed against the V3 glycan region of HIV gp120 In certain embodiments of the methods described herein, the subject is administered an HIV antigen within the V3 glycan region, e.g., an epitope or region of the third variable loop (V3) of gp120. An antibody or antigen-binding fragment thereof, or an antigen-binding molecule that binds to the gp120 protein and / or the high-mannose patch containing the N332 oligomannose glycan is administered. In certain embodiments, the administered antibody or antigen-binding fragment thereof, or antigen-binding molecule binds to an HIV-1 antigen expressed on the cell surface and eliminates or kills infected cells.
[0116] In certain embodiments, the administered antibody or antigen-binding fragment thereof, or antigen-binding molecule is or is derived from a human neutralizing antibody (e.g., monoclonal) that targets HIV-1. A "neutralizing antibody" is an antibody that can neutralize the ability of HIV to initiate and / or perpetuate infection in host and / or in vitro target cells. The present disclosure provides neutralizing monoclonal human antibodies, which recognize antigens derived from HIV, such as the gp120 polypeptide. In certain embodiments, a "neutralizing antibody" can inhibit entry of HIV-1 viruses, such as SF162 and / or JR-CSF, with a neutralization index of greater than 1.5 or greater than 2.0 (Kostrikis LG et al., J. Virol. 70(1):445-458 (1996)).
[0117] In some embodiments, the administered antibody or antigen-binding fragment thereof, or antigen-binding molecule is or is derived from a human broadly neutralizing antibody (e.g., monoclonal) that targets HIV-1. A "broadly neutralizing antibody" refers to an antibody that neutralizes two or more HIV-1 viral species (from various clades and different strains within a clade) in a neutralization assay. A broadly neutralizing antibody may neutralize at least 2, 3, 4, 5, 6, 7, 8, 9, or more different strains of HIV-1, and may neutralize strains belonging to the same or different clades. In certain embodiments, a broadly neutralizing antibody may neutralize multiple HIV-1 species belonging to at least 2, 3, 4, 5, or 6 different clades. In certain embodiments, the inhibitory concentration of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment can be less than about 0.0001 μg / mL, less than about 0.001 μg / mL, less than about 0.01 μg / mL, less than about 0.1 μg / mL, less than about 0.5 μg / mL, less than about 1.0 μg / mL, less than about 5 μg / mL, less than about 10 μg / mL, less than about 25 μg / mL, less than about 50 μg / mL, or less than about 100 μg / mL to neutralize about 50% of input virus in a neutralization assay.
[0118] Exemplary broadly neutralizing antibodies that bind to gp120 and / or the high mannose patch containing the N332 oligomannose glycan in the third variable loop (V3) and that can be used in the methods described herein include, but are not limited to, GS-9722 (elipovimab), GS-9721, PGT-121, PGT-121.66, PGT-121.414, PGT-122, PGT-123, PGT-124, PGT-125, PGT-126, PGT-128, PGT-130, PG ... T-133, PGT-134, PGT-135, PGT-136, PGT-137, PGT-138, PGT-139, 10-1074, 10-1074-J, VRC24, 2G12, BG18, 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188, 354BG411, 354BG426, DH270.1, DH270.6, PGDM12, VRC41.01, PGDM21, PCDN-33A, BF520.1, and VRC29.03. Additional broadly neutralizing antibodies that bind to gp120 and / or high mannose patches containing N332 oligomannose glycans within the third variable loop (V3) and can be used in the methods described herein are described, for example, in WO 2012 / 030904; WO 2014 / 063059; WO 2016 / 149698; WO 2017 / 106346; WO 2018 / 075564, WO 2018 / 125813; WO 2018 / 237148, WO 2019 / 226829, WO 2020 / 023827, WO 2020 / 056145, and Kerwin et al., J Pharm Sci. January 2020; 109(1):233-246. No. 6,239,999, filed on Oct. 1, 2003, which are incorporated herein by reference in their entirety for all purposes.
[0119] Exemplary sequences of complementarity determining regions (CDRs) of antibodies or antigen-binding fragments targeting the HIV gp120 V3 glycan region are provided in Tables A1-A4. Exemplary sequences of VH and VL of antibodies or antigen-binding fragments targeting the HIV gp120 V3 glycan region are provided in Table B. [Table 6-1] Table 6-2 Table 6-3 Table 6-4 Table 7-1 Table 7-2 Table 7-3 Table 7-4 Table 8-1 Table 8-2 Table 8-3 Table 8-4 Table 9-1 Table 9-2 Table 9-3 Table 9-4 Table 9-5 Table 10-1 Table 10-2 Table 10-3 Table 10-4 Table 10-5 Table 10-6
[0120] In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof comprises a VH comprising VH-CDR1, VH-CDR2, and VH-CDR3; and a VL comprising VL-CDR1, VL-CDR2, and a second VH-CDR3; wherein VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VH-CDR3 comprise the sequences set forth below: SEQ ID NOs: 7, 8, 9, 10, 11, and 12; SEQ ID NOs: 7, 13, 9, 10, 11, and 12; SEQ ID NOs: 14, 15, 16, 17, 11, and 12. SEQ ID NOs: 8; SEQ ID NOs: 14, 19, 20, 17, 11, and 18; SEQ ID NOs: 21, 22, 23, 24, 25, and 26; SEQ ID NOs: 21, 22, 27, 24, 25, and 26; SEQ ID NOs: 28, 29, 30, 31, 32, and 33; SEQ ID NOs: 34, 35, 36, 37, 25, and 38; SEQ ID NOs: 39, 40, 41, 42, 43, and 44; SEQ ID NOs: 45, 46, 47, 48, 49, and 50; SEQ ID NOs: 45, 51, 52, 53, 49, and 54; SEQ ID NOs: 55, 56, 57, 58, 59, and 44; SEQ ID NO: 6 SEQ ID NOs: 1, 46, 63, 58, 49, and 44; SEQ ID NOs: 64, 65, 66, 67, 68, and 69; SEQ ID NOs: 70, 71, 72, 73, 74, and 75; SEQ ID NOs: 76, 77, 78, 79, 80, and 75; SEQ ID NOs: 81, 82, 83, 84, 85, and 75; SEQ ID NOs: 85, 86, 87, 88, 89, and 90; SEQ ID NOs: 85, 91, 92, 93, 94, and 90; SEQ ID NOs: 85, 96, 92, 93, 94, and 90; SEQ ID NOs: 85, 86, 87, 97, 98, and 90; SEQ ID NOs: 85, 99, 100 , 101, 102, and 95; SEQ ID NOs: 85, 99, 100, 101, 102, and 103; SEQ ID NOs: 85, 99, 100, 104, 102, and 90; SEQ ID NOs: 85, 105, 92, 93, 94, and 90; SEQ ID NOs: 85, 99, 100, 101, 102, and 107; SEQ ID NOs: 108, 109, 110, 111, 112, 113; SEQ ID NOs: 108, 114, 115, 111, 116, and 117; or SEQ ID NOs: 108, 118, 119, 111, 120, and 121 (CDRs according to Kabat).
[0121] In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof comprises a VH comprising VH-CDR1, VH-CDR2, and VH-CDR3; and a VL comprising VL-CDR1, VL-CDR2, and a second VH-CDR3; wherein VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VH-CDR3 comprise the sequences set forth below: SEQ ID NOs: 123, 124, 9, 10, 11, and 12; SEQ ID NOs: 125, 126, 16, 17, 11, and 18; SEQ ID NOs: 127, 128, 20, SEQ ID NOs: 17, 11, and 18; SEQ ID NOs: 129, 130, 23, 24, 25, and 26; SEQ ID NOs: 129, 130, 27, 24, 25, and 26; SEQ ID NOs: 131, 132, 30, 31, 32, and 33; SEQ ID NOs: 133, 134, 36, 37, 25, and 38; SEQ ID NOs: 135, 136, 41, 42, 43, and 44; SEQ ID NOs: 137, 138, 47, 48, 49, and 50; SEQ ID NOs: 137, 138, 52, 53, 49, and 54; SEQ ID NOs: 139, 56, 57, 58, 59, and 44; SEQ ID NO: 141 , 138, 63, 58, 49, and 44; SEQ ID NOs: 142, 143, 66, 67, 68, and 69; SEQ ID NOs: 144, 145, 72, 73, 74, and 75; SEQ ID NOs: 146, 147, 78, 79, 80, and 75; SEQ ID NOs: 146, 147, 83, 84, 85, and 75; SEQ ID NOs: 149, 150, 87, 88, 89, and 90; SEQ ID NOs: 151, 150, 87, 88, 89, and 90; SEQ ID NOs: 152, 153, 92, 93, 94, and 90; SEQ ID NOs: 151, 150, 87, 97, 98, and 90 ;SEQ ID NOs:152, 153, 100, 101, 102, and 95; SEQ ID NOs:152, 153, 100, 101, 102, and 103; SEQ ID NOs:152, 153, 100, 104, 102, and 90; SEQ ID NOs:152, 153, 100, 101, 102, and 107; SEQ ID NOs:154, 155, 110, 111, 116, and 117; SEQ ID NOs:156, 157, 115, 111, 116, and 117; or SEQ ID NOs:158, 159, 119, 111, 120, and 121 (CDRs according to Chothia).
[0122] In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof comprises a VH comprising VH-CDR1, VH-CDR2, and VH-CDR3; and a VL comprising VL-CDR1, VL-CDR2, and a second VH-CDR3; wherein VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VH-CDR3 comprise the sequences set forth below: SEQ ID NOs: 160, 161, 162, 163, 164, and 12; SEQ ID NOs: 165, 166, 167, 168, 164, and 18; SEQ ID NOs: 165, 166, 167, 168, 164, and 18; SEQ ID NOs: 168, 164, and 18; SEQ ID NOs: 169, 170, 171, 168, 164, and 18; SEQ ID NOs: 172, 173, 174, 175, 164, and 26; SEQ ID NOs: 172, 173, 176, 175, 164, and 26; SEQ ID NOs: 177, 178, 179, 180, 164, and 38; SEQ ID NOs: 181, 182, 183, 184, 185, and 33; SEQ ID NOs: 186, 187, 188, 189, 190, and 44; SEQ ID NOs: 191, 192, 193, 194, 195, and 50; SEQ ID NOs: 191, 196, 197, 198, 199, 200, and 201; SEQ ID NOs: 98, 195, and 54; SEQ ID NOs: 199, 200, 201, 202, 399, and 44; SEQ ID NOs: 203, 204, 205, 202, 195, and 44; SEQ ID NOs: 206, 207, 208, 209, 210, and 69; 211, 212, 213, 214, 215, and 75; SEQ ID NOs: 216, 217, 218, 219, 220, and 75; SEQ ID NOs: 221, 217, 83, 223, 224, and 75; SEQ ID NOs: 225, 226, 87, 227, 228, and 90; SEQ ID NOs: 229, 226, 87, 227, 228, and 90; SEQ ID NOs: 230, 231, 92, 232, 233, and 90; SEQ ID NOs: 230, 234, 92, 232, 233, and 90; SEQ ID NOs: 229, 226, 87, 235, 398, and 90; SEQ ID NOs: 230, 236, 100, 232, 233, and 95; SEQ ID NOs: 230, 236, 100, 232, 233, and 103; SEQ ID NOs: 230, 236, 100, 237, 233, and 90; SEQ ID NOs: 230, 238, 92, 232, 233, and 107; SEQ ID NOs: 239, 240, 110, 241, 242, and 113;SEQ ID NOs: 243, 244, 115, 241, 245, and 117; or SEQ ID NOs: 243, 246, 119, 241, 247, and 121 (CDRs according to IMGT).
[0123] In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof comprises a VH comprising VH-CDR1, VH-CDR2, and VH-CDR3; and a VL comprising VL-CDR1, VL-CDR2, and a second VH-CDR3; wherein VH-CDR1, VH-CDR2, VH-CDR3, VL-CDR1, VL-CDR2, and VH-CDR3 comprise the sequences set forth below: SEQ ID NOs: 248, 249, 250, 251, 252, and 253; SEQ ID NOs: 248, 254, 250, 251, 252, and 253; SEQ ID NOs: 255, 256, 257, 258, 259, 260, 261, 262, and 263; SEQ ID NOs: 260, 261, 262, 258, 252, and 259; SEQ ID NOs: 263, 264, 265, 266, 267, and 268; SEQ ID NOs: 263, 264, 397, 266, 267, and 268; SEQ ID NOs: 269, 270, 271, 272, 273, and 274; SEQ ID NOs: 275, 276, 277, 278, 279, and 280; SEQ ID NOs: 281, 282, 283, 284, 285, and 286; SEQ ID NOs: 287, 288, 289, 290, 291, and 286; SEQ ID NO: 287 , 292, 293, 294, 295, and 296; SEQ ID NOs: 297, 298, 299, 300, 301, and 286; SEQ ID NOs: 302, 288, 303, 300, 295, and 286; SEQ ID NOs: 304, 305, 306, 307, 308, and 309; SEQ ID NOs: 310, 311, 312, 313, 314, and 315; SEQ ID NOs: 316, 316, 318, 319, 320, and 315; SEQ ID NOs: 321, 322, 323, 324, 325, and 315; 326, 327, 328, 329, 330, and 331; SEQ ID NO: 3 32, 327, 328, 329, 330, and 331; SEQ ID NOs: 333, 334, 335, 336, 337, and 338; SEQ ID NOs: 333, 339, 335, 336, 337, and 338; SEQ ID NOs: 332, 327, 328, 340, 341, and 338; SEQ ID NOs: 342, 343, 344, 336, 345, and 346; SEQ ID NOs: 342, 343, 344, 336, 347, and 348; SEQ ID NOs: 342, 343, 344, 349, 350, and 338; SEQ ID NOs: 333, 351, 335, 336, 337, and 338;SEQ ID NOs: 342, 343, 344, 336, 347, and 352; SEQ ID NOs: 353, 354, 355, 356, 357, and 358; SEQ ID NOs: 359, 360, 361, 356, 362, and 363; or SEQ ID NOs: 359, 364, 365, 356, 366, and 358 (CDRs according to Honegger).
[0124] Exemplary embodiments of CDR sequences for anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof useful in the methods described herein are provided in Tables A1-A4.
[0125] In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof comprises a VH and a VL comprising an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical, respectively, to the set forth amino acid sequence, as selected from the following SEQ ID NOs: SEQ ID NOs: 400 and 401; SEQ ID NOs: 402 and 403; SEQ ID NOs: 402 and 404; SEQ ID NOs: 462 and 463; SEQ ID NOs: 464 and 465; SEQ ID NOs: 405 and 406; SEQ ID NOs: 466 and 467; SEQ ID NOs: 407 and 408; SEQ ID NOs: 409 and 410; SEQ ID NOs: 411 and 412. 2; SEQ ID NOs: 413 and 414; SEQ ID NOs: 415 and 416; SEQ ID NOs: 417 and 418; SEQ ID NOs: 419 and 420; SEQ ID NOs: 421 and 422; SEQ ID NOs: 423 and 424; SEQ ID NOs: 425 and 426; SEQ ID NOs: 427 and 428; SEQ ID NOs: 429 and 430; SEQ ID NOs: 431 and 432; SEQ ID NOs: 433 and 434; SEQ ID NOs: 435 and 436; SEQ ID NOs: 437 and 438; SEQ ID NOs: 439 and 440; SEQ ID NOs: 441 and 442; SEQ ID NOs: 443 and 444; SEQ ID NOs: 445 and 446; SEQ ID NOs: 447 and 448; SEQ ID NOs: 449 and 450; SEQ ID NOs: 451 and 452; SEQ ID NOs: 453 and 454; SEQ ID NOs: 455 and 456; SEQ ID NOs: 457 and 458; or SEQ ID NOs: 459 and 460. Exemplary embodiments of variable domain VH and VL sequences of anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof useful in the methods described herein are provided in Table B.
[0126] In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody comprises a VH and VL amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth below, respectively, and that comprises one or more of the following amino acids at the indicated positions (position numbering according to Kabat): SEQ ID NO:400 or 402 (Ser-Ser-Val (SSV) or Thr at positions 82a-82c) -Gly-Val (TGV), Gln (Q) at position 39, Asn (N) at position 60, His (H) at position 68, any one of Lys (K), His (H), or Thr (T) at position 105, Leu (L) at position 2, Ala (A) at position 32, and / or Ala (A) at position 95; and SEQ ID NO: 401, 403, or 404 (containing one or more of Gly (G) at position 67, Tyr (Y), Phe (F), or Thr (T) at position 67a, Arg (R) at position 67b, Pro (P) at position 67c, and / or Lys (K) at position 103). In some embodiments, an anti-HIV gp120 antibody is V3 glycan-directed antibodies comprise VH and VL amino acid sequences that are at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical, respectively, to the amino acid sequences set forth below and that contain one or more of the following amino acids at the indicated positions (position numbering according to Kabat): SEQ ID NO: 400 or 402 (containing one or more of Thr-Gly-Val (TGV) at positions 82a to 82c, Asn (N) at position 60, His (H) at position 68, and any one of Lys (K), His (H), and / or Thr (T) at position 105); and SEQ ID NO: 401, 403, or 404 (containing one or more of Gly (G) at position 67, Tyr (Y), Phe (F), or Thr (T) at position 67a, Arg (R) at position 67b, and Pro (P) at position 67c).
[0127] Fc mutations that increase serum half-life In some embodiments, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody comprises an amino acid modification that promotes an increase in the serum half-life of the anti-binding molecule. Mutations that increase the half-life of antibodies have been described. In one embodiment, the Fc region or Fc domain of one or both of the CD3-targeting heavy chain and the HIV antigen-targeting heavy chain comprises a methionine to tyrosine substitution at position 252 (EU numbering), a serine to threonine substitution at position 254 (EU numbering), and a threonine to glutamic acid substitution at position 256 (EU numbering). See, e.g., U.S. Patent No. 7,658,921. Variants of this type, designated "YTE variants," exhibit a four-fold increased half-life compared to the wild-type version of the same antibody (Dall'Acqua et al., J Biol Chem 281:23514-24 (2006); Robbie et al., Antimicrob Agents Chemotherap. 57(12):6147-6153 (2013)). In certain embodiments, the Fc region or Fc domain of one or both of the CD3-targeting heavy chain and the HIV antigen-targeting heavy chain comprises an IgG constant domain comprising one, two, three, or more amino acid substitutions at amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436 (EU numbering). Alternatively, the M428L and N434S ("LS") substitutions can increase the pharmacokinetic half-life of the multispecific antigen-binding molecule. In other embodiments, the Fc region or Fc domain of one or both of the CD3-targeting heavy chain and the HIV-antigen-targeting heavy chain comprises M428L and N434S substitutions (EU numbering). In other embodiments, the Fc region or Fc domain of one or both of the CD3-targeting heavy chain and the HIV-antigen-targeting heavy chain comprises T250Q and M428L (EU numbering) mutations. In other embodiments, the Fc region or Fc domain of one or both of the CD3-targeting heavy chain and the HIV-antigen-targeting heavy chain comprises H433K and N434F (EU numbering) mutations.
[0128] Fc mutations that enhance effector activity In some embodiments, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody comprises post-translational and / or amino acid modifications that increase effector activity, e.g., improved FcγIIIa binding and increased antibody-dependent cellular cytotoxicity (ADCC). In some embodiments, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody comprises DE modifications in the Fc region (i.e., S239D and I332E according to EU numbering). In some embodiments, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody comprises DEL modifications in the Fc region (i.e., S239D, I332E, and A330L according to EU numbering). In some embodiments, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody comprises a DEA modification in the Fc region (i.e., S239D, I332E, and G236A according to EU numbering). In some embodiments, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody comprises a DEAL modification in the Fc region (i.e., S239D, I332E, G236A, and A330L according to EU numbering). See, e.g., U.S. Patent Nos. 7,317,091; 7,662,925; 8,039,592; 8,093,357; 8,093,359; 8,383,109; 8,388,955; 8,735,545; 8,858,937; 8,937,158; 9,040,041; 9,353,187; 10,184,000; and 10,584,176.Additional amino acid modifications that increase effector activity, for example, improved FcγIIIa binding and increased antibody-dependent cellular cytotoxicity (ADCC), include, but are not limited to, (EU numbering): F243L / R292P / Y300L / V305I / P396L; S298A / E333A / K334A; or L234Y / L235Q / G236W / S239M / H268D / D270E / S298A in the first Fc domain and D270E / K326D / A330M / K334E in the second Fc domain. Amino acid mutations that increase C1q binding and complement-dependent cytotoxicity (CDC) include, but are not limited to, (EU numbering): S267E / H268F / S324T, or K326W / E333S. Fc region mutations that enhance effector activity are reviewed in, e.g., Wang et al., Protein Cell (2018) 9(1):63-73; and Saunders, Front Immunol. (2019) 10:1296.
[0129] In other embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof have modified glycosylation, which can be introduced, for example, post-translationally or by genetic engineering. In some embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof are afucosylated, for example, at glycosylation sites present in the antibody or antigen-binding fragment. Most approved The monoclonal antibody is of the IgG1 isotype and has two N-linked biantennary complex-type oligosaccharides attached to the Fc region. The Fc region performs the ADCC effector function through interaction with the FcγR family of leukocyte receptors. Defucosylated monoclonal antibodies are monoclonal antibodies that have been genetically engineered so that the oligosaccharides in the Fc region of the antibody do not contain any fucose sugar units.
[0130] In some embodiments, optionally, the Fc region or Fc domain of an anti-HIV gp120 V3 glycan-directed antibody may comprise post-translational and / or amino acid modifications to increase serum half-life and enhance effector activity.
[0131] 4. Combination therapy with two or more anti-HIV antibodies In certain embodiments, the present disclosure provides a method for treating or preventing HIV infection in a human subject having or at risk of having HIV infection. The method comprises administering to the human subject a therapeutically effective amount of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof, or a pharmaceutical composition thereof as disclosed herein, in combination with a therapeutically effective amount of one or more (e.g., one, two, three, one or two, or one to three) additional therapeutic agents. In one embodiment, a method is provided for treating HIV infection in a human subject having or at risk of having an infection, the method comprising administering to the human subject a therapeutically effective amount of an antibody or antibody disclosed herein, or a pharmaceutically acceptable salt thereof, in combination with a therapeutically effective amount of one or more (e.g., one, two, three, one or two, or one to three) additional therapeutic agents.
[0132] Antibody combination therapy In some embodiments, the anti-V3-glycan antibody or antigen-binding fragment thereof is co-administered with a second anti-HIV antibody. In some embodiments, the anti-V3-glycan antibody or antigen-binding fragment thereof is co-administered with a second anti-HIV antibody that binds to an epitope or region of gp120 selected from the group consisting of: (i) the second variable loop (V2) and / or the Env trimer tip; (ii) the CD4 binding site (CD4bs); (iii) the gp120 / gp41 interface; or (v) the silent face of gp120. The aforementioned epitopes or regions of gp120 bound by broadly neutralizing antibodies are described in, for example, McCoy, Retrovirology (2018) 15:70; Sok and Burton, Nat Immunol. 2018, 19(11):1179-1188; Possas et al., Expert Opin Ther. Pat." July 2018; 28(7):551-560; and Stephenson and Barouch, "Curr HIV / AIDS Rep" (2016) 13:31-37, which are incorporated herein by reference in their entirety for all purposes.
[0133] In some embodiments, the combination therapy involves co-administration of an anti-V3 glycan antibody or antigen-binding fragment thereof with another anti-HIV broadly neutralizing antibody or bNAb (i.e., a neutralizing antibody that neutralizes multiple HIV-1 virus strains). Various bnAbs are known in the art and may be used as combination therapeutic agents. Additional exemplary bnAbs of use include those comprising a VH and a VL that bind to or compete with an epitope or region of gp120 selected from the group consisting of: (i) the second variable loop (V2) and / or the Env trimer tip; (ii) the CD4 binding site (CD4bs); (iii) the gp120 / gp41 interface; or (v) the silent face of gp120. Exemplary bNABs for use in anti-HIV antibody combination therapy include those comprising a VH and a VL that bind to or compete with: 2F5, 4E10, M66.6, CAP206-CH12, 10E8, 10E8v4, 10E8-5R-100cF, DH511.11P, 7b2, and LN01 (all of which bind to the MPER of gp41); PG9, PG16, CH01-04 (all of which bind to the V1V2-glycan), 2G12 (which bind to the outer domain glycan); b12, F105, VRC01, VRC07, VRC07-523, VRC03, VRC06, VRC06b01 VRC08, VRC0801, NIH45-46, GS-9723, GS-5423, 3BNC117, 3BNC60, VRC-PG04, PGV04; CH103, 44-VRC13.01, 1NC9, 12A12, N6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cow1, IOMA, CH235 and CH235.12, N49P6, N49P7, N49P11, N49P9, and N60P25 (all of which bind to the CD4 binding site).
[0134] In some embodiments, the combination therapy comprises an antibody that binds to an epitope or region of gp120 in the second variable loop (V2) and / or Env trimer tip and competes with or comprises CDRs and / or VH and VL regions from an antibody selected from the group consisting of PG9, PG16, PGC14, PGG14, PGT-142, PGT-143, PGT-144, PGT-145, CH01, CH59, PGDM1400, CAP256, CAP256-VRC26.08, CAP256-VRC26.09, CAP256-VRC26.25, PCT64-24E, and VRC38.01.
[0135] In some embodiments, the combination therapy comprises an antibody that binds to an epitope or region of gp120 in the CD4 binding site (CD4bs) and competes with or comprises CDRs and / or VH and VL regions from an antibody selected from the group consisting of: b12, F105, VRC01, VRC07, VRC07-523, VRC03, VRC06, VRC06b01 VRC08, VRC0801, NIH45-46, GS-9723, GS-5423, 3BNC117, 3BNC60, VRC-PG04, PGV04; CH103, 44-VRC13.01, 1NC9, 12A12, N 6, N6LS (VRC-HIVMAB091-00-AB), N49-P7, NC-Cow1, IOMA, CH235andCH235.12, N49P6, N49P7, N49P11, N49P9, and N60P25.
[0136] In some embodiments, the combination therapy comprises an antibody that binds to an epitope or region of gp120 at the gp120 / gp41 interface and competes with or comprises CDRs and / or VH and VL regions from an antibody selected from the group consisting of PGT-151, CAP248-2B, 35O22, 8ANC195, ACS202, VRC34, and VRC34.01.
[0137] In some embodiments, the combination therapy comprises an antibody that binds to an epitope or region of the gp120 silent face and competes with or comprises a second VH and VL region from the antibody VRC-PG05.
[0138] In some embodiments, the combination therapy includes an antibody that binds to an epitope or region of gp41 in the membrane proximal region (MPER) and competes with or comprises a second VH and VL region from an antibody selected from the group consisting of 10E8, 10E8v4, 10E8-5R-100cF, 4E10, DH511.11P, 2F5, 7b2, and LN01. In some embodiments, the combination therapy includes an antibody that binds to an epitope or region of KLIC (disclosed as SEQ ID NO:468, "KLIC"), an invariant site of the transmembrane protein gp41, and competes with or comprises a second VH region and a second VL region from clone 3 human monoclonal antibody (Cl3hmAb) (Protheragen). See, e.g., Vanini et al., "AIDS." (1993) 7(2):167-74.
[0139] In some embodiments, the combination therapy comprises an antibody that binds to an epitope or region of the fusion peptide of gp41 and competes with or comprises a second VH and VL region from an antibody selected from the group consisting of VRC34 and ACS202.
[0140] In some embodiments, the combination therapy comprises a multispecific, e.g., bispecific or trispecific, antibody that binds to an HIV antigen. Examples of HIV bispecific and trispecific antibodies include MGD014, B12BiTe, BiIA-SG, TMB-bispecific, SAR-441236, VRC-01 / PGDM-1400 / 10E8v4, 10E8.4 / iMab, and 10E8v4 / PGT121-VRC01.
[0141] Prior to administration, bnAbs can be improved to have enhanced drug-like properties, reduced immunogenicity, enhanced ADCC, and favorable pharmacokinetic properties. Such antibodies have been shown to bind to HIV envelope glycoproteins expressed on the surface of virions or infected cells and mediate both direct neutralization of the virus and potent NK, monocyte, and PBMC killing of these cells. This property allows the antibodies to treat HIV infection by neutralizing the virus and also to kill and eliminate latently HIV-infected cells within infected individuals, potentially leading to a sterile cure of HIV.
[0142] In various embodiments, all antibodies administered in a combination anti-HIV antibody therapy can have Fc and / or post-translational modifications that increase serum half-life and / or enhance effector activity, as described above.
[0143] In various embodiments, anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments, and optionally combined bnAbs, can be delivered in vivo, e.g., expressed in vivo from administered mRNA or engineered B cells. Examples of bnAbs delivered in vivo include AAV8-VRC07; mRNA encoding the anti-HIV antibody VRC01; and engineered B cells encoding 3BNC117 (Hartweger et al., J. Exp. Med. 2019, 1301).
[0144] 5. Combination therapy with other anti-HIV drugs In certain embodiments, a method is provided for treating or preventing HIV infection in a human having or at risk of having an infection, the method comprising administering to the human a therapeutically effective amount of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment in combination with a therapeutically effective amount of one or more (e.g., one, two, three, one or two, or one to three) additional therapeutic agents as disclosed herein. In one embodiment, a method is provided for treating HIV infection in a human having or at risk of having an infection, the method comprising administering to the human a therapeutically effective amount of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment in combination with a therapeutically effective amount of one or more (e.g., one, two, three, one or two, or one to three) additional therapeutic agents as disclosed herein.
[0145] In one embodiment, a pharmaceutical composition comprising an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment, as disclosed herein, is provided in combination with one or more (e.g., 1, 2, 3, 1 or 2, or 1 to 3) additional therapeutic agents, and a pharmaceutically acceptable carrier, diluent, or excipient.
[0146] In certain embodiments, a method for treating HIV infection is provided, the method comprising administering to a patient in need of treatment for HIV infection a therapeutically effective amount of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof in combination with a therapeutically effective amount of one or more additional therapeutic agents suitable for treating HIV infection, as described herein.
[0147] In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof is combined with one, two, three, four, or more additional therapeutic agents. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof is combined with two additional therapeutic agents. In other embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof is combined with three additional therapeutic agents. In further embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof is combined with four additional therapeutic agents. The one, two, three, four, or more additional therapeutic agents may be different therapeutic agents selected from the same class of therapeutic agents (e.g., one or more anti-HIV broadly neutralizing antibodies) and / or the additional therapeutic agents may be selected from different classes of therapeutic agents.
[0148] Administration of HIV combination therapy In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof is co-administered with one or two additional therapeutic agents, as described herein. Co-administration of one or more additional therapeutic agents with the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein generally refers to simultaneous or sequential administration of the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein, such that a therapeutically effective amount of the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein and one or more additional therapeutic agents are both present in the patient's body. When administered sequentially, the combination may be administered in two or more doses.
[0149] Co-administration includes the concurrent administration of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof as described herein before or after administration of a unit dosage of one or more additional therapeutic agents. For example, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof may be administered within seconds, minutes, hours, or days of the administration of one or more additional therapeutic agents as described herein. In some embodiments, a unit dose of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein is administered first, followed by administration of a unit dose of one or more additional therapeutic agents within seconds, minutes, hours, or days. Alternatively, a unit dose of one or more additional therapeutic agents is administered first, followed by administration of a unit dose of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein within seconds, minutes, hours, or days. In other embodiments, a unit dose of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein is administered first, followed by a unit dose of one or more additional therapeutic agents administered a set time (e.g., 1-12 hours, 1-24 hours, 1-36 hours, 1-48 hours, 1-60 hours, 1-72 hours) later. In yet other embodiments, a unit dose of one or more additional therapeutic agents is administered first, followed by a unit dose of an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment disclosed herein administered a set time (e.g., 1-12 hours, 1-24 hours, 1-36 hours, 1-48 hours, 1-60 hours, 1-72 hours) later.
[0150] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments disclosed herein are combined with one or more additional therapeutic agents in a unitary dosage form for simultaneous administration to a patient, e.g., as a solid, liquid, or suspension form for oral, intravenous, intramuscular, or subcutaneous administration.
[0151] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment is formulated as a liquid solution or suspension, which may optionally contain one or more other compounds useful for treating HIV. In certain embodiments, the liquid solution or suspension may contain another active ingredient for treating HIV, such as an HIV protease inhibitor, an HIV non-nucleoside or non-nucleotide inhibitor of reverse transcriptase, an HIV nucleoside or nucleotide inhibitor of reverse transcriptase, an HIV integrase inhibitor, an HIV non-catalytic site (or allosteric) integrase inhibitor, a pharmacokinetic enhancer, and combinations thereof.
[0152] In certain embodiments, such liquid solutions or suspensions are suitable for administration or dosing intervals of once daily, once weekly (i.e., QW), once every other week (i.e., once every other week or once every two weeks, or Q2W), once monthly (i.e., QM), or once every two months (i.e., once a month or once every two months, or Q2M). In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment is administered daily, once a week (i.e., QW), once every other week (i.e., once every other week or once every two weeks, or Q2W), once a month (i.e., QM), once every two months (i.e., once a month or once every two months, or Q2M), once every three months (i.e., Q3M), or once every four months (i.e., Q4M).
[0153] HIV combination therapy In the above embodiments, the additional therapeutic agent may be an anti-HIV agent, such as an HIV protease inhibitor, an HIV non-nucleoside or non-nucleotide inhibitor of reverse transcriptase, an HIV nucleoside or nucleotide inhibitor of reverse transcriptase, an HIV integrase inhibitor, an HIV non-catalytic site (or allosteric) integrase inhibitor, an HIV entry inhibitor, an HIV maturation inhibitor, an HIV capsid inhibitor, an HIV Tat or Rev inhibitor, an immunomodulator (e.g., an immune stimulator), an immunotherapeutic agent, an immunomodulator, an immunotherapeutic agent, an antibody drug conjugate, a gene modifier, a gene editor (e.g., CRISPR / Cas9, zinc finger nucleases, homing nucleases, synthetic nucleases, TALENs), cell therapy (chimeric antigen receptor T cells, CAR-T, and gene manipulation). T cell receptor (TCR-T), autologous T cell therapy, latency reversing agents agent), compounds targeting the HIV capsid, immune-based therapies, phosphatidylinositol inositol 3-kinase (PI3K) inhibitors, HIV antibodies, bispecific antibodies and "antibody-like" therapeutic proteins, HIV p17 matrix protein inhibitors, IL-13 antagonists, peptidyl-prolyl cis-trans isomerase A modulators, protein disulfide isomerase inhibitors, complement C5a receptor antagonists, DNA methyltransferase inhibitors, fatty acid synthase inhibitors, HIV vif gene modulators, Vif dimerization antagonists, HIV-1 viral infectivity factor inhibitors, TAT protein inhibitors, HIV-1 Nef modifiers (e.g., Nef inhibitors), Hck tyrosine kinase modifiers, mixed lineage kinase-3 (MLK-3) inhibitors, HIV-1 splicing inhibitors, Rev protein inhibitors, integrin antagonists, nucleoprotein inhibitors, splicing factor modifiers, COMM domain-containing protein 1 modifiers, HIV ribonuclease H inhibitors, retrocyclin modifiers, CDK-4 inhibitors, CDK-6 inhibitors, CDK-9 inhibitors, dendritic ICAM-3-binding nonintegrin 1 inhibitors, HIV GAG protein inhibitors, HIV POL protein inhibitors, complement factor H modifiers, ubiquitin ligase inhibitors, deoxycytidine kinase inhibitors, cyclin-dependent kinase inhibitors, proprotein convertase PC9 stimulators, ATP-dependent RNA helicase DDX3X inhibitors, reverse transcriptase priming complex inhibitors, G6PD and NADH-oxidase inhibitors, mTOR complex 1 inhibitors, mTOR complex 2 inhibitors, P-glycoprotein modifiers, tat protein inhibitors, prolyl endopeptidase inhibitors, phospholipase A2 inhibitors, pharmacokinetic enhancers, HIV gene therapy, TNFα ligand inhibitors, IFN antagonists, HIV vaccines, and combinations thereof.
[0154] In some embodiments, the additional therapeutic agent is selected from the group consisting of combination drugs for HIV, other drugs for treating HIV, HIV protease inhibitors, HIV reverse transcriptase inhibitors, HIV integrase inhibitors, HIV non-catalytic site (or allosteric) integrase inhibitors, HIV entry (fusion) inhibitors, HIV maturation inhibitors, latency reversal agents, HIV capsid inhibitors, HIV Tat or Rev inhibitors, immunomodulatory agents (e.g., immune stimulators), immunotherapeutics, immune-based therapies, PI3K inhibitors, HIV antibodies and bispecific antibodies, and "antibody-like" therapeutic proteins, and combinations thereof.
[0155] HIV combination drugs In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with one, two, three, four, or more additional anti-HIV therapeutic agents. Exemplary anti-HIV therapeutic agents that can be combined include, but are not limited to: ATRIPLA® (efavirenz, tenofovir disoproxil fumarate, and emtricitabine); COMPLERA® (EVIPLERA®; rilpivirine, tenofovir disoproxil fumarate, and emtricitabine); STRIBILD® (elvitegravir, cobicistat, tenofovir disoproxil fumarate, and emtricitabine); emtricitabine); TRUVADA® (tenofovir disoproxil fumarate and emtricitabine; TDF+FTC); DESCOVY® (tenofovir alafenamide and emtricitabine); ODEFSEY® (tenofovir alafenamide, emtricitabine, and rilpivirine); GENVOYA® (tenofovir alafenamide, emtricitabine, cobicistat, and elvitegravir); BIKTARVY (bictegravir+emtricitabine+tenofovir) tenofovir alafenamide), adefovir; adefovir dipivoxil; cobicistat; emtricitabine; tenofovir; tenofovir alafenamide and elvitegravir; tenofovir disoproxil; tenofovir disoproxil fumarate; tenofovir alafenamide; tenofovir alafenamide hemifumarate; TRIUMEQ® (dolutegravir, abacavir, and lamivudine); dolutegravir, abacavir sulfate, and lamivudine; raltegravir; pegylated raltegravir; raltegravir abacavir and lamivudine; maraviroc; tenofovir + emtricitabine + maraviroc, enfuvirtide; ALUVIA® (KALETRA®; lopinavir and ritonavir); COMBIVIR® (zidovudine and lamivudine; AZT + 3TC); EPZICOM® (LIVEXA®; abacavir sulfate and lamivudine; ABC + 3TC); TRIZIVIR® (abacavir sulfate, zidovudine, and lamivudine; ABC + AZT + 3TC);Atazanavir and cobicistat; atazanavir sulfate and cobicistat; atazanavir sulfate and ritonavir; darunavir; darunavir and cobicistat; dolutegravir and rilpivirine; dolutegravir and rilpivirine hydrochloride; dolutegravir, abacavir sulfate, and lamivudine; lamivudine, nevirapine, and zidovudine; raltegravir and lamivudine; doravirine, lamivudine, and tenofovir disoproxil fumarate; doravirine, lamivudine, and tenofovir disoproxil; dolutegravir + lamivudine, lamivudine + abacavir + zidovudine, lamivudine +abacavir, lamivudine + tenofovir disoproxil fumarate, lamivudine + zidovudine + nevirapine, lopinavir + ritonavir, lopinavir + ritonavir + abacavir + lamivudine, lopinavir + ritonavir + zidovudine + lamivudine, tenofovir + lamivudine, and tenofovir disoproxil fumarate + emtricitabine + rilpivirine hydrochloride, lopinavir, ritonavir, zidovudine, and lamivudine; cabotegravir + rilpivirine; elpida (elsulfavirine; VM-1500; VM-1500A); rilpivirine; rilpivir; Phosphate hydrochloride; Atazanavir sulfate and cobicistat; Atazanavir and cobicistat; Darunavir and cobicistat; Atazanavir; Atazanavir sulfate; Dolutegravir; Elvitegravir; Ritonavir; Atazanavir sulfate and ritonavir; Darunavir; Lamivudine; Prolastin; Fosamprenavir; Fosamprenavir calcium efavirenz; Efavirenz, lamivudine, and efavirenz Mutricitabine; Etravirine; Nelfinavir; Nelfinavir mesylate; Interferon; Didanosine; Stavudine; Indinavir; Indinavir sulfate; Tenofovir and lamivudine; Zidovudine; Nevirapine; Saquinavir; Saquinavir mesylate; Aldesleukin; Zalcitabine; Tipranavir; Amprenavir; Delavirdine; Delavirdine mesylate; Radha-108 (receptol); Lamivudine and tenofovir disoproxil fumarate; Efavirenz, lamivudine, and tenofovir disoproxil fumarate; Phosphazide; Lamivudine, nevirapine, and zidovudine; Abacavir and abacavir sulfate.
[0156] Other HIV drugs
[04] Examples of other drugs for treating HIV that can be combined with the agents of the present disclosure include aspernigrin C, acemannan, alisporivir, BanLec, deferiprone, Gamimune, metenkephalin, naltrexone, prolastin, REP9, RPI-MN, VSSP, H1 viral, SB-728-T, 1,5-dicaffeoylquinic acid, rHIV7-shl-TAR-CCR5RZ, AAV-eCD4-Ig gene therapy, MazF gene therapy, BlockAide, Bevirimat derivatives, ABX-464, AG-1105, APH-0812, bryostatin analogs, BIT-225, CYT-107, CS-TATI-1, fluoro-β-D-arabinose nucleic acid (FANA)-modified antisense oligonucleotides, FX-101, griffithsin, HGTV-43, HPH-116, HS -10234, Hydroxychloroquine, IMB-10035, IMO-3100, IND-02, JL-18008, LADAVRU, MK-1376, MK-2048, MK-4250, MK-8507, MK-8558, MK-8591 (Islatravir), NOV-205, OB-002H, ODE-Bn-TFV, M1-TFV, PA-1050040 (PA-040), PC-707, PGN-007, Q F-036, S-648414, SCY-635, SB-9200, SCB-719, TR-452, TEV-90110, TEV-90112, TEV-90111, TEV-90113, RN-18, DIACC-1010, Fasnall, Immuglo, 2-CLIPS peptide, HRF-4467, thrombospondin analog, TBL-1004HI, VG-1177, xl-081, rfhSP-D, [ 18 F]-MC-225, URMC-099-C, RES-529, and VIR-576.
[0157] HIV protease inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV protease inhibitor, such as amprenavir, atazanavir, brecanavir, darunavir, fosamprenavir, fosamprenavir calcium, indinavir, indinavir sulfate, lopinavir, nelfinavir, nelfinavir mesylate, ritonavir, saquinavir, saquinavir mesylate, tipranavir, AEBL-2, DG-17, GS-1156, TMB-657 (PPL-100), T-169, BL-008, MK-8122, TMB-607, GRL-02031, and TMC-310911.
[0158] HIV ribonuclease H inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV RNase H inhibitor. An example of a combinable HIV RNase H inhibitor may include NSC-727447.
[0159] HIV Nef inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV Nef inhibitor. An example of a compatible HIV Nef inhibitor is FP-1.
[0160] HIV reverse transcriptase inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a non-nucleoside or non-nucleotide inhibitor. Examples of HIV non-nucleoside or non-nucleotide inhibitors of reverse transcriptase include dapivirine, delavirdine, delavirdine mesylate, doravirine, efavirenz, etravirine, lentinan, nevirapine, rilpivirine, ACC-007, ACC-008, AIC-292, F-18, KM-023, PC-1005, VM-1500A-LAI, PF-3450074, elsulfavirine (sustained-release oral, HIV infection), elsulfavirine (long-acting injectable nanosuspension, HIV infection), and elsulfavirine (VM-1500).
[0161] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV nucleoside or nucleotide inhibitor. Examples of HIV nucleoside or nucleotide inhibitors of reverse transcriptase include adefovir, adefovir dipivoxil, azuvudine, emtricitabine, tenofovir, tenofovir alafenamide, tenofovir alafenamide fumarate, tenofovir alafenamide hemifumarate, tenofovir disoproxil, tenofovir disoproxil fumarate, tenofovir octadecyloxyethyl ester (AGX-1009), tenofovir disoproxil hemifumarate, VIDEX® and VIDEXEC® (didanosine, ddl), avastatin, and fluticasone. Kavir, abacavir sulfate, alovudine, apricitabine, censavudine, didanosine, elvucitabine, festinavir, fosalvudine tidoxil, CMX-157, dapivirine, doravirine, etravirine, OCR-5753, tenofovir disoproxil orotate, fozivudine tidoxil, lamivudine, phosphazide, stavudine, zalcitabine, zidovudine, lobafovir etalafenamid (GS-9131), GS-9148, MK-8504, MK-8591, MK-858, VM-2500, and KP-1461.
[0162] HIV integrase inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV integrase inhibitor, such as elvitegravir, elvitegravir (sustained-release microcapsules), curcumin, curcumin derivatives, chicoric acid, chicoric acid derivatives, 3,5-dicaffeoylquinic acid, derivatives of 3,5-dicaffeoylquinic acid, aurintricarboxylic acid, aurintricarboxylic acid derivatives, caffeic acid phenethyl ester, caffeic acid phenethyl ester derivatives, tyrphostin, tyrphostin derivatives, quercetin, quercetin derivatives, raltegravir, PEGylated raltegravir, dolutegravir, JTK, or the like. -351, bictegravir, AVX-15567, cabotegravir (long-acting injectable solution), diketoquinoline 4-1 derivatives, integrase-LEDGF inhibitors, ledgins, M-522, M-532, MK-0536, NSC-310217, NSC-371056, NSC-48240, NSC-642710, NSC-699171, NSC-699172, NSC-699173, NSC-699174, stilbene disulfonic acid, T-169, STP-0404, VM-3500, and cabotegravir.
[0163] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV non-catalytic site or allosteric integrase inhibitor (NCINI). Examples of HIV non-catalytic site or allosteric integrase inhibitors (NCINI) include CX-05045, CX-05168, and CX-14442.
[0164] HIV entry inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with HIV entry inhibitors. Examples of HIV entry (fusion) inhibitors include AAR-501, LBT-5001, cenicriviroc, CCR5 inhibitors, gp41 inhibitors, CD4 adhesion inhibitors, gp120 inhibitors, gp160 inhibitors, and CXCR4 inhibitors.
[0165] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a CCR5 inhibitor. Examples of CCR5 inhibitors include aplaviroc, vicriviroc, maraviroc, maraviroc (long-acting injectable nanoemulsion), cenicriviroc, leronlimab (PRO-140), adaptavir (RAP-101), nifeviroc (TD-0232), anti-gp120 / CD4 or CCR5 bispecific antibodies, B-07, MB-66, polypeptide C25P, TD-0680, thioraviroc, and vMIP (Haimipu). Examples include:
[0166] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a CXCR4 inhibitor, examples of which include plerixafor, ALT-1188, N15 peptide, and vMIP (Haimipu).
[0167] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a gp41 inhibitor. Examples of gp41 inhibitors include albuvirtide, enfuvirtide, glyphfm, and cyclosporine. These include cin (gp41 / gp120 / gp160 inhibitor), BMS-986197, enfuvirtide biobetter, enfuvirtide biosimilar, HIV-1 fusion inhibitor (P26-Bapc), ITV-1, ITV-2, ITV-3, ITV-4, CPT-31, Cl3hmAb, PIE-12 trimer, and sifuvirtide.
[0168] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with CD4 adhesion inhibitors. Examples of CD4 adhesion inhibitors include ibalizumab and CADA analogs.
[0169] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with gp120 inhibitors, including anti-HIV microbicides, Radha-108 (Receptor) 3B3-PE38, BanLec, bentonite-based nanomedicines, fostemsavir tromethamine, IQP-0831, VVX-004, and BMS-663068.
[0170] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a gp160 inhibitor. An example of a gp160 inhibitor that can be combined is fangchinoline.
[0171] HIV maturation inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV maturation inhibitor, examples of which include BMS-955176, GSK-3640254, and GSK-2838232.
[0172] Latent Reversal Agent In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an HIV latency-reversing agent. Examples of latency-reversing agents that can be combined with one or more multispecific antigen-binding molecules, as described herein, include IL-15 receptor agonists (e.g., ALT-803; interleukin-15 / Fc fusion proteins (e.g., XmAb24306); recombinant interleukin-15 (e.g., AM0015, NIZ-985); PEGylated IL-15 (e.g., NKTR-255); Toll-like receptor (TLR) agonists (including TLR7 agonists, e.g., GS-9620, and TLR8 agonists, e.g., GS-9688), histone deacetylase (HDAC) inhibitors, proteasome inhibitors, e.g., Velcade, protein kinase C (PKC) activators, and Smyd2 inhibitors. , BET-bromodomain 4 (BRD4) inhibitors, ionomycin, IAP antagonists (inhibitors of apoptotic proteins such as APG-1387, LBW-242), SMAC mimetics (including TL32711, LCL161, GDC-0917, HGS1029, AT-406), Debio-1143, PMA, SAHA (suberanilohydroxamic acid, or suberoyl, anilide, and hydroxamic acid), NIZ-985, IL-15 modulating antibodies (including IL-15, IL-15 fusion proteins, and IL-15 receptor agonists such as ALT-803), JQ1, disulfiram, amphotericin B, and ubiquitin inhibitors such as largazole analogs, APH-0812, and GSK-343. Examples of HDAC inhibitors include romidepsin, vorinostat, and panobinostat. Examples of PKC activators include indolactams, prostratin, ingenol B, and DAG-lactone.
[0173] Toll-like receptor (TLR) agonists In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with an agonist of a Toll-like receptor (TLR), such as an agonist of TLR1 (NCBI Gene No.: 7096), TLR2 (NCBI Gene No.: 7097), TLR3 (NCBI Gene No.: 7098), TLR4 (NCBI Gene No.: 7099), TLR5 (NCBI Gene No.: 7100), TLR6 (NCBI Gene No.: 10333), TLR7 (NCBI Gene No.: 51284), TLR8 (NCBI Gene No.: 51311), TLR9 (NCBI Gene No.: 54106), and / or TLR10 (NCBI Gene No.: 81793).Examples of TLR7 agonists that may be co-administered or combined with one or more multispecific antigen binding molecules described herein include AL-034, DSP-0509, GS-9620 (vesatolimod), vesatolimod analogs, LHC-165, TMX-101 (imiquimod), GSK-2245035, resiquimod, DSR-6434, DSP-3025, IMO-4200, MCT-465, MEDI-9197, 3M-051, SB-9922, 3M-052, Limtop, TMX-30X, TMX-202, RG-7863, RG-7854, RG-7795, and the compounds described in U.S. Patent Application Publication No. 20100143301 (Gilead). Sciences), U.S. Patent Application Publication No. 20110098248 (Gilead Sciences), and U.S. Patent Application Publication No. 20090047249 (Gilead Sciences), U.S. Patent Application Publication No. 20140045849 (Janssen), U.S. Patent Application Publication No. 20140073642 (Janssen), WO 2014 / 056953 (Janssen), WO 2014 / 076221 (Janssen), WO 2014 / 128189 (Janssen), U.S. Patent Application Publication No. 20140350031 (Janssen), WO 2014 / 023813 (Janssen), U.S. Patent Application Publication No. 20080234251 (Array Biopharma), U.S. Patent Application Publication No. 20080306050 (Array Biopharma), U.S. Patent Application Publication No. 20100029585 (Ventirx Pharma), U.S. Patent Application Publication No. 20110092485 (Ventirx. No. 20140066432 (Ventirx Pharma), U.S. Patent Application Publication No. 20140088085 (Ventirx Pharma), U.S. Patent Application Publication No. 20140275167 (Novira Therapeutics), and U.S. Patent Application Publication No. 20130251673 (Novira Therapeutics). TLR7 / TLR8 agonists that may be co-administered include, but are not limited to, compounds disclosed in U.S. Patent Application Publication No. 20110118235 (Ventirx Pharma), U.S. Patent Application Publication No. 20120082658 (Ventirx Pharma), U.S. Patent Application Publication No. 20120219615 (Ventirx Pharma), U.S. Patent Application Publication No. 20140066432 (Ventirx Pharma), U.S. Patent Application Publication No. 20140088085 (Ventirx Pharma), U.S. Patent Application Publication No. 20140275167 (Novira Therapeutics), and U.S. Patent Application Publication No. 20130251673 (Novira Therapeutics). TLR7 / TLR8 agonists that may be co-administered include NKTR-262, tellurolimod, and BDB-001.Examples of TLR8 agonists that may be co-administered or combined with one or more multispecific antigen-binding molecules described herein include E-6887, IMO-4200, IMO-8400, IMO-9200, MCT-465, MEDI-9197, motolimod, resiquimod, GS-9688, VTX-1463, VTX-763, 3M-051, 3M-052, and U.S. Patent Application Publication No. 20140045849 (Janssen), ... Japanese Patent Application Publication No. 20140073642 (Janssen), International Publication No. 2014 / 056953 (Janssen), International Publication No. 2014 / 076221 (Janssen), International Publication No. 2014 / 128189 (Janssen), U.S. Patent Application Publication No. 20140350031 (Janssen), International Publication No. 2014 / 023813 (Janssen), U.S. Patent Application Publication No. 20080234251 (Array Biopharma), U.S. Patent Application Publication No. 20080306050 (Array Biopharma), U.S. Patent Application Publication No. 20100029585 (Ventirx Pharma), U.S. Patent Application Publication No. 20110092485 (Ventirx Pharma), U.S. Patent Application Publication No. 20110118235 (Ventirx Pharma), U.S. Patent Application Publication No. 20120082658 (Ventirx Pharma), U.S. Patent Application Publication No. 20120219615 (Ventirx Pharma), U.S. Patent Application Publication No. 20140066432 (Ventirx Pharma), U.S. Patent Application Publication No. 20140088085 (Ventirx Pharma), U.S. Patent Application Publication No. 20140275167 (Novira Examples of compounds include, but are not limited to, compounds disclosed in U.S. Patent Application Publication No. 20130251673 (Novira Therapeutics).Examples of TLR9 agonists that may be co-administered include, but are not limited to, AST-008, cobitolimod, CMP-001, IMO-2055, IMO-2125, ritenimod, MGN-1601, BB-001, BB-006, IMO-3100, IMO-8400, IR-103, IMO-9200, agatolimod, DIMS-9054, DV-1079, DV-1179, AZD-1419, lefitolimod (MGN-1703), CYT-003, CYT-003-QbG10, tilsotolimod, and PUL-042. Examples of TLR3 agonists include lintatolimod, poly-ICLC, RIBOXXON®, Apoxxim, RIBOXXIM®, IPH-33, MCT-465, MCT-475, and ND-1.1. Examples of TLR4 agonists include G-100 and GSK-1795091.
[0174] Histone deacetylase (HDAC) inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with inhibitors of histone deacetylase, e.g., histone deacetylase 1, histone deacetylase 9 (HDAC9, HD7, HD7b, HD9, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, MITR; Gene ID 9734). Examples of HDAC inhibitors include, but are not limited to, abexinostat, ACY-241, AR-42, BEBT-908, belinostat, CKD-581, CS-055 (HBI-8000), CT-101, CUDC-907 (fimepinostat), entinostat, divinostat, mocetinostat, panobinostat, pracinostat, xinostat (JNJ-26481585), resminostat, licorinostat, romidepsin, SHP-141, TMB-ADC, valproic acid (VAL-001), vorinostat, tinostamustin, remetinostat, and entinostat.
[0175] Cyclin-Dependent Kinase (CDK) Inhibitors or Antagonists In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof described herein is combined with an inhibitor or antagonist of a cyclin-dependent kinase (CDK), such as cyclin-dependent kinase 4 (CDK4; NCBI Gene No. 1019), cyclin-dependent kinase 6 (CDK6; NCBI Gene No. 1021), or cyclin-dependent kinase 9 (CDK9; NCBI Gene No. 1025). In some embodiments, the CDK4 / CDK6 / CDK9 inhibitor or antagonist is selected from the group consisting of VS2-370.
[0176] Stimulator of Interferon Gene (STING) agonists In some embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof described herein is combined with a stimulator of interferon genes (STING). In some embodiments, the STING receptor agonist or activator is selected from the group consisting of ADU-S100 (MIW-815), SB-11285, MK-1454, SR-8291, AdVCA0848, GSK-532, SYN-STING, MSA-1, SR-8291, 5,6-dimethylxanthenone-4-acetic acid (DMXAA), cyclic-GAMP (cGAMP), and cyclic-di-AMP.
[0177] RIG-I agonists In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment thereof described herein is combined with an agonist of DExD / H-box helicase 58 (DDX58; also known as RIG-I, RIG1, RIGI, RLR-1, SGMRT2; NCBI Gene ID 23586). In some embodiments, an agent described herein is combined with a RIG-I modulator such as RGT-100, or a NOD2 modulator such as SB-9200 (also known as GS9992; inaridivir), and IR-103. An exemplary RIG-I agonist is KIN1148, described in Hemann et al., J Immunol, May 1 (2016), vol. 196 (I Suppl.), p. 76.1. Additional RIG-I agonists are described, for example, in Elion et al., Cancer Res. (2018) 78(21):6183-6195; and Liu et al., J Virol. (2016) 90(20):9406-19. RIG-I agonists are commercially available, for example, from Invivogen (invivogen.com).
[0178] LAG-3 and TIM-3 inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with anti-TIM-3 (also known as Hepatitis A Virus Cellular Receptor 2 antibodies (HAVCR2; NCBI Gene No. 84868) antibodies, e.g., TSR-022, LY-3321367, MBG-453, INCAGN-2390. In some embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with anti-LAG-3 (lymphocyte-activating) (NCBI Gene No. 3902) antibodies, e.g., leratolimab (ONO-4482), LAG-525, MK-4280, REGN-3767, INCAGN2385.
[0179] Capsid inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with capsid inhibitors. Examples of capsid inhibitors that can be combined with the agents of the present disclosure include capsid polymerization inhibitors or capsid-disrupting compounds, HIV nucleocapsid p7 (NCp7) inhibitors such as azodicarbonamide, HIV p24 capsid protein inhibitors, GS-6207, GS-CA1, AVI-621, AVI-101, AVI-201, AVI-301, and the AVI-CAN1-15 series, PF-3450074, and compounds described in International Patent Publication No. 2019 / 087016.
[0180] Immune-Based Therapies In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with immune-based therapies. Examples of immune-based therapies include Toll-like receptor (TLR) modulators, such as TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12, and TLR13; programmed cell death protein 1 (PD-1) modulators; programmed death-ligand 1 (PD-L1) modulators; IL-15 modulators (e.g., IL-15 receptor agonists (e.g., ALT-803; interleukin-15 / Fc fusion proteins (e.g., XmAb24306); recombinant interleukin-15 (e.g., AM0015, NIZ-985); PEGylated IL-15 (e.g., NKTR-255)); DermaVir; interleukin-7; and plaques. Nil (hydroxychloroquine); Proleukin (aldesleukin, IL-2); interferon alpha; interferon alpha-2b; interferon alpha-n3; pegylated interferon alpha; interferon gamma; hydroxyurea; mycophenolate mofetil (MPA) and its ester derivative mycophenolate mofetil (MMF); ribavirin; the polymer polyethyleneimine (PEI); gepon; IL-12; WF-10; VGV-1; MOR-22; BMS-936559; CYT-107, normferon, pegylated interferon alpha-2a, pegylated interferon alpha-2b, RPI-MN, STING modulators, RIG-I modulators, NOD2 modulators, SB-9200, and IR-103.
[0181] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a TLR agonist, including, but not limited to, vesatolimod (GS-9620), lefitolimod, tilsotolimod, lintatolimod, DSP-0509, AL-034, G-100, cobitolimod, AST-008, motolimod, GSK-1795091, GSK-2245035, VTX-1463, GS-9688, LHC-165, BDB-001, RG-7854, and tellatolimod.
[0182] Immune checkpoint receptor protein modulators In various embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more blockers or inhibitors of inhibitory immune checkpoint proteins or receptors, and / or with one or more stimulators, activators, or agonists of one or more stimulatory immune checkpoint proteins or receptors. Blockade or inhibition of inhibitory immune checkpoints can positively regulate T cell or NK cell activation and prevent immune escape of infected cells. Activation or stimulation of stimulatory immune checkpoints can enhance the effectiveness of immune checkpoint inhibitors in treating infectious diseases. In various embodiments, immune checkpoint proteins or receptors regulate T cell responses (e.g., Xu et al., J Exp Clin Cancer Res. (2018) 37:110). In various embodiments, immune checkpoint proteins or receptors regulate NK cell responses (reviewed, e.g., in Davis et al., Semin Immunol. (2017) 31:64-75 and Chiossone et al., Nat Rev Immunol. (2018) 18(11):671-688).
[0183] Examples of immune checkpoint proteins or receptors that can be combined with the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein include, but are not limited to, CD27, CD70; CD40, CD40LG; CD47, CD48 (SLAMF2), transmembrane domain and immunoglobulin domain containing 2 (TMIGD2, CD28H), CD84 (LY9B, SLAMF5), CD96, CD160, MS4A1 (CD20), CD244 (SLAMF4); CD276 (B7H3); V-set domain-containing T-cell activation inhibitor (1) (VTCN1, B7H4); V-set immunoregulatory receptor (VSIR, B7H5, VISTA); immunoglobulin superfamily member 11 (IGSF11, VSIG3); natural killer cytotoxicity receptor 3 ligand 1 (NCR3LG1, B7H6); HERV-H Long-Term Receptor-associated 2 (HHLA2, B7H7); inducible T-cell costimulatory factor (ICOS, CD278); inducible T-cell costimulatory factor ligand (ICOSLG, B7H2); TNF receptor superfamily member 4 (TNFRSF4, OX40); TNF superfamily member 4 (TNFSF4, OX40L); TNFRSF8 (CD30), TNFSF8 (CD30L); TNFRSF10A (CD261, DR4, TRAILR1), TNFRSF9 (CD137), TNFSF9 (CD137L); TNFRSF10B (CD262, DR5, TRAILR2), TNFRSF10 (TRAIL); TNFRSF14 (HVEM, CD270), TNFSF14 (HVEML); CD272 (B and T lymphocyte associated (BTLA)); TNFRSF17 (BCMA, CD269), TN FSF13B (BAFF); TNFRSF18 (GITR), TNFSF18 (GITRL); MHC class I polypeptide-related sequence A (MICA); MHC class I polypeptide-related sequence B (MICB); CD274 (CD274, PDL1, PD-L1); programmed cell death 1 (PDCD1, PD1, PD-1); cytotoxic T lymphocyte-associated protein 4 (CTLA4, CD152); CD80 (B7-1), CD28; nectin cell adhesion molecule 2 (NECTIN2, CD112); CD226 (DNAM-1); poliovirus receptor (Poliovirus receptor (PVR) cell adhesion molecule (PVR, CD155); PVR-related immunoglobulin domain-containing (PVRIG, CD112R); T-cell immunoreceptor with Ig and ITIM domains (TIGIT); T-cell immunoglobulin and mucin domain-containing 4 (TIMD4; TIM4); hepatitis A virus cellular receptor 2 (HAVCR2, TIMD3, TIM3); galectin 9 (LGALS9); lymphocyte activation 3 (LAG3, CD223); signaling lymphocyte activation molecule family member 1 (SLAMF1, SLAM, CD150); lymphocyte antigen 9 (LY9, CD229, SLAMF3); SLAM family member 6 (SLAMF6, CD352); SLAM family member 7 (SLAMF7, CD31 9); UL16-binding protein 1 (ULBP1); UL16-binding protein 2 (ULBP2); UL16-binding protein 3 (ULBP3); retinoic acid early transcript 1E (RAET1E; ULBP4); retinoic acid early transcript 1G (RAET1G; ULBP5); retinoic acid early transcript 1L (RAET1L; ULBP6); lymphocyte activation 3 (CD223); killer cell immunoglobulin-like receptor, three Ig domains, and long cytoplasmic tail 1 (KIR, CD158E1); killer cell lectin-like receptor C1 (KLRC1, NKG2A, CD159A); killer cell lectin-like receptor K1 (KLRK1, NKG2D, CD314); killer cell lectin-like receptor C2 (KLRC2, CD159c, NKG2C);Killer cell lectin-like receptor C3 (KLRC3, NKG2E); killer cell lectin-like receptor C4 (KLRC4, NKG2F); killer cell immunoglobulin-like receptor, two Ig domains, and long cytoplasmic tail 1 (KIR2DL1); killer cell immunoglobulin-like receptor, two Ig domains, and long cytoplasmic tail 2 (KIR2DL2); killer cell immunoglobulin-like receptor, two Ig domains, and long cytoplasmic tail 3 (KIR2DL3); killer cell immunoglobulin-like receptor, three Ig domains, and long cytoplasmic tail 1 (KIR3DL1); killer cell lectin-like receptor D1 (KLRD1); and SLAM family member 7 (SLAMF7).
[0184] In various embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more blockers or inhibitors of one or more T cell inhibitory immune checkpoint proteins or receptors. Exemplary T cell inhibitory immune checkpoint proteins or receptors include, but are not limited to, CD274 (CD274, PDL1, PD-L1); programmed cell death 1 ligand 2 (PDCD1LG2, PD-L2, CD273); programmed cell death 1 (PDCD1, PD1, PD-1); cytotoxic T lymphocyte-associated protein 4 (CTLA4, CD152); CD276 (B7H3); V-set domain-containing T cell activation inhibitor (1 (VTCN1, B7H4); V-set immunoregulatory receptor (VSIR, B7H5, VISTA); immunoglobulin superfamily member 11 (IGSF11, VSIG3); TNFRSF14 (HVEM, CD270), TNFSF14 (HVEML); CD272 (B and T lymphocyte-associated (BTLA)); PVR-related immunoglobulin domain-containing (PVRIG, CD112 R); T cell immunoreceptor with Ig and ITIM domains (TIGIT); lymphocyte activation 3 (LAG3, CD223); hepatitis A virus cell receptor 2 (HAVCR2, TIMD3, TIM3); galectin 9 (LGALS9); killer cell immunoglobulin-like receptor, three Ig domains and long cytoplasmic tail 1 (KIR, CD158E1); killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 1 (KIR2DL1); killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 2 (KIR2DL2); killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 3 (KIR2DL3); and killer cell immunoglobulin-like receptor, three Ig domains and long cytoplasmic tail 1 (KIR3DL1). In various embodiments, the anti-HIV antibodies described herein are The gp120 V3 glycan-directed antibody or antigen-binding fragment is combined with one or more agonists or activators of one or more T cell stimulatory immune checkpoint proteins or receptors.Exemplary T cell stimulatory immune checkpoint proteins or receptors include, but are not limited to, CD27, CD70; CD40, CD40LG; inducible T cell costimulator (ICOS, CD278); inducible T cell costimulator ligand (ICOSLG, B7H2); TNF receptor superfamily member 4 (TNFRSF4, OX40); TNF superfamily member 4 (TNFSF4, OX40L); TNFRSF9 (CD137), TNFSF9 (CD137L); TNFRSF18 (GITR), TNFSF18 (GITRL); CD80 (B7-1), CD28; nectin cell adhesion molecule 2 (NECTIN2, CD112); CD226 (DNAM-1); CD244 (2B4, SLAMF4), poliovirus receptor (PVR) cell adhesion molecule (PVR, CD155). See, e.g., Xu et al., J Exp Clin Cancer Res. (2018) 37:110.
[0185] In various embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more blockers or inhibitors of one or more NK cell inhibitory immune checkpoint proteins or receptors. Exemplary NK cell inhibitory immune checkpoint proteins or receptors include, but are not limited to, killer cell immunoglobulin-like receptor, three Ig domains and long cytoplasmic tail 1 (KIR, CD158E1); killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 1 (KIR2DL1); killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 2 (KIR2DL2); killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 3 (KIR2DL3); killer cell immunoglobulin-like receptor, three Ig domains and long cytoplasmic tail 1 (KIR3DL1); killer cell lectin-like receptor C1 (KLRC1, NKG2A, CD159A); and killer cell lectin-like receptor D1 (KLRD1, CD94). In various embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more agonists or activators of one or more NK cell-stimulatory immune checkpoint proteins or receptors. Exemplary NK cell-stimulatory immune checkpoint proteins or receptors include, but are not limited to, CD16, CD226 (DNAM-1); CD244 (2B4, SLAMF4); killer cell lectin-like receptor K1 (KLRK1, NKG2D, CD314); and SLAM family member 7 (SLAMF7). See, e.g., Davis et al., "Semin Immunol." (2017) 31:64-75; Fang et al., "Semin Immunol." (2017) 31:37-54; and Chiossone et al., "Nat Rev Immunol." (2018) 18(11):671-688.
[0186] In some embodiments, the one or more immune checkpoint inhibitors comprise a proteinaceous (e.g., antibody or fragment thereof, or antibody mimetic) inhibitor of PD-L1 (CD274), PD-1 (PDCD1), or CTLA4. In some embodiments, the one or more immune checkpoint inhibitors comprise a small organic molecule inhibitor of PD-L1 (CD274), PD-1 (PDCD1), or CTLA4.
[0187] Examples of CTLA4 inhibitors that can be co-administered include ipilimumab, tremelimumab, BMS-986218, AGEN1181, AGEN1884, BMS-986249, MK-1308, REGN-4659, ADU-1604, CS-1002, BCD-145, APL-509, JS-007, BA-3071, ONC-392, AGEN-2041, JHL-1155, KN-044, CG-0161, ATOR-1144, and PBI -5D3H5, BPI-002, and the multispecific inhibitors FPT-155 (CTLA4 / PD-L1 / CD28), PF-06936308 (PD-1 / CTLA4), MGD-019 (PD-1 / CTLA4), KN-046 (PD-1 / CTLA4), MEDI-5752 (CTLA4 / PD-1), XmAb-20717 (PD-1 / CTLA4), and AK-104 (CTLA4 / PD-1).
[0188] Examples of PD-L1 (CD274) or PD-1 (PDCD1) inhibitors that can be co-administered include pembrolizumab, nivolumab, cemiplimab, pidilizumab, AMP-224, MEDI0680 (AMP-514), spartalizumab, atezolizumab, avelumab, durvalumab, BMS-936559, CK-301, PF-06801591, BGB-A317 (tislelizumab), GLS-010 (WBP-3055), AK-103 (HX-008), AK-105, CS-1003, HLX-10, MGA-012, BI-754091, AGEN-2034, JS-001 (Tripalimab), JNJ-63723283, Genolimzumab (CBT-501), LZM-009, BCD-100, LY-3300054, SHR-1201, SHR-1210 (Camrelizumab), Sym-021, ABBV-181 (Budijarimab), PD1-PIK, BAT-1306, (MSB0010718C), CX-072, CBT-502, TSR-042 (Dostallimab), MSB-2311, JTX-4014, BGB-A333, SHR-1316, CS-1001 (WBP-3155, KN-035, IBI-308 (sintilimab), HLX-20, KL-A167, STI-A1014, STI-A1015 (IMC-001), BCD-135, FAZ-053, TQB-2450, MDX1105-01, GS-4224, GS-4416, INCB086550, MAX10181, and the multispecific inhibitors FPT-155 (CTLA4 / PD-L1 / CD28), PF-06936308 (PD-1 / CTLA4), MGD-013 (PD-1 / LAG-3), FS-118 (LAG-3 / PD-L1), MGD-019 (PD-1 / CTLA4), KN-046 (PD-1 / CTLA4), MEDI-5752 (CTLA4 / PD-1), RO-7121661 (PD-1 / TIM-3), XmAb-20717 (PD-1 / CTLA4), AK-104 (CTLA4 / PD-1), M7824 (PD-L1 / TGFβ-EC domain), CA-170 (PD-L1 / VISTA), CDX-527 (CD27 / PD-L1), LY-3415244 (TIM3 / PDL1), and INBRX-105 (4-1BB / PDL1).Not limited to these.
[0189] In some embodiments, the small molecule inhibitor of CD274 or PDCD1 is selected from the group consisting of GS-4224, GS-4416, INCB086550, and MAX 10181. In some embodiments, the small molecule inhibitor of CTLA4 comprises BPI-002.
[0190] In various embodiments, the antibodies or antigen-binding fragments described herein are combined with an anti-TIGIT antibody, such as BMS-986207, RG-6058, or AGEN-1307.
[0191] Agonists or activators of members of the TNF receptor superfamily (TNFRSF) In various embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with an agonist of one or more of the following TNF receptor superfamily (TNFRSF) members: for example, TNFRSF1A (NCBI Gene No. 7132), TNFRSF1B (NCBI Gene No. 7133), TNFRSF4 (OX40, CD134; NCBI Gene No. 7293), TNFRSF5 (CD40; NCBI Gene No. 958), TNFRSF6 (FAS, NCBI Gene No. 959), TNFRSF7 (OX40, CD134; NCBI Gene No. 959), TNFRSF8 (OX40, CD134; NCBI Gene No. 959), TNFRSF9 (OX40, CD134; NCBI Gene No. 959), TNFRSF10 (OX40, CD134; NCBI Gene No. 959), TNFRSF11 (OX40, CD134; NCBI Gene No. 959), TNFRSF12 (OX40, CD134; NCBI Gene No. 959), TNFRSF13 (OX40, CD134; NCBI Gene No. 959), TNFRSF14 (OX40, CD134; NCBI Gene No. 959), TNFRSF15 (OX40, CD134; NCBI Gene No. 959), TNFRSF16 (OX40, CD134; NCBI Gene No. 959), TNFRSF17 (OX40, CD134; NCBI Gene No. 959), TNFRSF18 (OX40, CD134; NCBI Gene No. 959), TNFRSF19 (OX40, CD134; NCBI Gene No. 959), No. 355), TNFRSF7 (CD27, NCBI gene number 939), TNFRSF8 (CD30, NCBI gene number 943), TNFRSF9 (4-1BB, CD137, NCBI gene number 3604), TNFRSF10A (CD261, DR4, TRAILR1, NCBI gene number 8797), TNFRSF10B (CD262, DR5, TRAILR2, NCBI gene number 8795), TNFRSF10C (CD263, TRAILR3, N NCBI gene number 8794), TNFRSF10D (CD264, TRAILR4, NCBI gene number 8793), TNFRSF11A (CD265, RANK, NCBI gene number 8792), TNFRSF11B (NCBI gene number 4982), TNFRSF12A (CD266, NCBI gene number 51330), TNFRSF13B (CD267, NCBI gene number 23495), TNFRSF13C (CD268, NCBI gene number 1155) 650), TNFRSF16 (NGFR, CD271, NCBI gene number 4804), TNFRSF17 (BCMA, CD269, NCBI gene number 608), TNFRSF18 (GITR, CD357, NCBI gene number 8784), TNFRSF19 (NCBI gene number 55504), TNFRSF21 (CD358, DR6, NCBI gene number 27242), and one or more of TNFRSF25 (DR3, NCBI gene number 8718).
[0192] Examples of anti-TNFRSF4 (OX40) antibodies that may be co-administered include, but are not limited to, MEDI6469, MEDI6383, MEDI0562 (tabolixizumab), MOXR0916, PF-04518600, RG-7888, GSK-3174998, INCAGN1949, BMS-986178, GBR-8383, ABBV-368, and antibodies described in WO2016179517, WO2017096179, WO2017096182, WO2017096281, and WO2018089628.
[0193] Exemplary anti-TNFRSF5 (CD40) antibodies that may be co-administered include, but are not limited to, RG7876, SEA-CD40, APX-005M, and ABBV-428.
[0194] In some embodiments, the anti-TNFRSF7 (CD27) antibody varlilumab (CDX-1127) is co-administered.
[0195] Examples of anti-TNFRSF9 (4-1BB, CD137) antibodies that may be co-administered include, but are not limited to, urelumab, utomilumab (PF-05082566), AGEN2373, and ADG-106.
[0196] Examples of anti-TNFRSF18 (GITR) antibodies that can be co-administered include, but are not limited to, MEDI1873, FPA-154, INCAGN-1876, TRX-518, BMS-986156, MK-1248, GWN-323, and antibodies described in International Publication Nos. WO 2017096179, WO 2017096276, WO 2017096189, and WO 2018089628. In some embodiments, antibodies or fragments thereof co-targeting TNFRSF4 (OX40) and TNFRSF18 (GITR) are co-administered. Such antibodies are described, for example, in WO 2017096179 and WO 2018089628.
[0197] Interleukin receptor agonists In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with the following interleukin receptor agonists: for example, IL-2, IL-7, IL-15, IL-10, IL-12 agonists; examples of IL-2 receptor agonists, such as proleukin (aldesleukin, IL-2); PEGylated IL-2 (e.g., NKTR-214); modified variants of IL-2 (e.g., THOR-707), bempegaldesleukin, AIC-2 84, ALKS-4230, CUI-101, Neo-2 / 15; IL-15 receptor agonists such as ALT-803, NKTR-255, and hetIL-15, interleukin-15 / Fc fusion proteins, AM-0015, NIZ-985, SO-C101, IL-15Synthorin (PEGylated IL-15), P-22339, and IL-15-PD-1 fusion protein N-809; examples of IL-7 include CYT-107.
[0198] Examples of additional interleukin receptor agonists that can be combined with the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein include: interferon alpha interferon alpha-2b; interferon alpha-n3; pegylated interferon alpha; interferon gamma; Flt3 agonists, such as CDX-301; Gepone; Normferon, pegylated interferon alpha-2a, pegylated interferon alpha-2b, RPI-MN.
[0199] Bi- and tri-specific natural killer (NK) cell engagers In various embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are directed against a bi-specific NK-cell engager (BiKE) or a tri-specific NK-cell engager (TriKE) (e.g., Fc-less), or an NK cell activating receptor (NKCR). Bispecific antibodies (e.g., Fc-bearing) against, for example, CD16A, C-type lectin receptors (CD94 / NKG2C, NKG2D, NKG2E / H, and NKG2F), natural cytotoxicity receptors (NKp30, NKp44, and NKp46), killer cell C-type lectin-like receptors (NKp65, NKp80), Fc receptors FcγR (mediating antibody-dependent cellular cytotoxicity), SLAM family receptors (e.g., 2B4, SLAM6, and SLAM7), killer cell immunoglobulin-like receptors (KIR) (KIR-2DS and KIR-3DS), DNAM-1, and CD137 (4-1BB). Exemplary anti-CD16 bispecific antibodies, BiKE, or TriKE, that can be co-administered include AFM26 (BCMA / CD16A) and AFM-13 (CD16 / CD30). Optionally, the anti-CD16 binding bispecific molecule may or may not have an Fc. BiKE and TriKE are described, for example, in Felice et al., "Methods Mol Biol." (2016) 1441:333-346; Fang et al., "Semin Immunol. (2017) 31:37-54. Examples of trispecific NK cell engagers (TRiKEs) include OXS-3550 and CD16-IL-15-B7H3TriKe.
[0200] Phosphatidylinositol 3-kinase (PI3K) inhibitors In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a PI3K inhibitor. Examples of PI3K inhibitors include idelalisib, alpelisib, buparlisib, CAI orotate, copanlisib, duvelisib, jedatolisib, neratinib, panulisib, Perifosine, pictilisib, pilalalisib, puquitinib mesylate, rigosertib, rigosertib sodium, sonolisib, taselisib, AMG-319, AZD-8186, BAY-1082439, CLR-1401, CLR-457, CUDC-907, DS-7423, EN-3342, GSK-2126458, GSK-2269577, GSK- 2636771, INCB-040093, LY-3023414, MLN-1117, PQR-309, RG-7666, RP-6530, RV-1729, SAR-245409, SAR-260301, SF-1126, TGR-1202, UCB-5857, VS-5584, XL-765, and ZSTK-474.
[0201] Alpha-4 / beta-7 antagonists In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with an alpha-4 / beta-7 antagonist, such as PTG-100, TRK-170, abrilumab, etrolizumab, carotegrast methyl, and vedolizumab.
[0202] Pharmacokinetic enhancers In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with a pharmacokinetic enhancer. Examples of pharmacokinetic enhancers include cobicistat and ritonavir.
[0203] Additional therapeutic agents Examples of additional therapeutic agents include the following: WO 2004 / 096286 (Gilead Sciences); WO 2006 / 015261 (Gilead Sciences); WO 2006 / 110157 (Gilead Sciences); WO 2012 / 003497 (Gilead Sciences); WO 2012 / 003498 (Gilead Sciences); WO 2012 / 145728 (Gilead Sciences); WO 2013 / 006738 (Gilead Sciences); WO 2013 / 159064 (Gilead Sciences); WO 2014 / 100323 (Gilead Sciences) Compounds disclosed in U.S. Patent Application Publication No. 2014 / 0221378 (Japan Tobacco), U.S. Patent Application Publication No. 2014 / 0221380 (Japan Tobacco); WO 2009 / 062285 (Boehringer Ingelheim); WO 2010 / 130034 (Boehringer Ingelheim); WO 2013 / 006792 (Pharma Resources), U.S. Patent Application No. 20140221356 (Gilead Sciences), U.S. Patent Application No. 20100143301 (Gilead Sciences), and WO 2013 / 091096 (Boehringer Ingelheim).
[0204] HIV combination therapy In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments thereof described herein are combined with one, two, three, four, or more additional therapeutic agents selected from the following: ATRIPLA® (efavirenz, tenofovir disoproxil fumarate, and emtricitabine); COMPLERA® (EVIPLERA®; rilpivirine, tenofovir disoproxil fumarate, and emtricitabine); STRIBILD® (elvitegravir, cobicistat, tenofovir disoproxil fumarate, and and emtricitabine); TRUVADA® (tenofovir disoproxil fumarate and emtricitabine; TDF+FTC); DESCOVY® (tenofovir alafenamide and emtricitabine); ODEFSEY® (tenofovir alafenamide, emtricitabine, and rilpivirine); GENVOYA® (tenofovir alafenamide, emtricitabine, cobicistat, and elvitegravir); adefovir; adefovir dipivoxil; cobicistat; emtricitabine; tenofovir tenofovir disoproxil; tenofovir disoproxil fumarate; tenofovir alafenamide; tenofovir alafenamide hemifumarate; TRIUMEQ® (dolutegravir, abacavir, and lamivudine); dolutegravir, abacavir sulfate, and lamivudine; raltegravir; raltegravir and lamivudine; maraviroc; enfuvirtide; ALUVIA® (KALETRA®; lopinavir and ritonavir); COMBIVIR® (zidovudine and lamivudine; AZT+3TC ); EPZICOM® (LIVEXA®; abacavir sulfate and lamivudine; ABC+3TC); TRIZIVIR® (abacavir sulfate, zidovudine, and lamivudine; ABC+AZT+3TC); rilpivirine; rilpivirine hydrochloride; atazanavir sulfate and cobicistat; atazanavir and cobicistat; darunavir and cobicistat; atazanavir; atazanavir sulfate; dolutegravir; elvitegravir; ritonavir; atazanavir sulfate and ritonavir; darunavir; lamivudine;Prolastin; Fosamprenavir; Fosamprenavir calcium; Efavirenz; Etravirine; Nelfinavir; Nelfinavir mesylate; Interferon; Didanosine; Stavudine; Indinavir; Indinavir sulfate; Tenofovir and lamivudine; Zidovudine; Nevirapine; Saquinavir; Saquinavir mesylate; Aldesleukin; Zalcitabine; Tipranavir; Amprenavir; Delavirdine; Delavirdine mesylate; Radha-108 (Receptor); Lamivudine and tenofovir disoproxil fumarate; Efavirenz, lamivudine, and tenofovir disoproxil fumarate; Phosphazide; Lamivudine, nevirapine, and zidovudine; Abacavir and abacavir sulfate.
[0205] Those skilled in the art will appreciate that the additional therapeutic agents listed above may fall into more than one of the classes listed above. The particular classes are not intended to limit the functionality of the compounds listed in those classes.
[0206] In a specific embodiment, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with an HIV nucleoside or nucleotide inhibitor of reverse transcriptase and an HIV non-nucleoside inhibitor of reverse transcriptase. In another specific embodiment, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with an HIV nucleoside or nucleotide inhibitor of reverse transcriptase and an HIV protease inhibitor compound. In a further embodiment, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with an HIV nucleoside or nucleotide inhibitor of reverse transcriptase and an HIV non-nucleoside inhibitor of reverse transcriptase, and a pharmacokinetic enhancer. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with at least one HIV nucleoside inhibitor of reverse transcriptase, an integrase inhibitor, and a pharmacokinetic enhancer. In another embodiment, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with two HIV nucleoside or nucleotide inhibitors of reverse transcriptase.
[0207] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with abacavir sulfate, tenofovir, tenofovir disoproxil, tenofovir disoproxil fumarate, tenofovir disoproxil hemifumarate, tenofovir alafenamide, or tenofovir alafenamide hemifumarate.
[0208] In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with tenofovir, tenofovir disoproxil, tenofovir disoproxil fumarate, tenofovir alafenamide, or tenofovir alafenamide hemifumarate.
[0209] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with a first additional therapeutic agent selected from the group consisting of abacavir sulfate, tenofovir, tenofovir disoproxil, tenofovir disoproxil fumarate, tenofovir alafenamide, and tenofovir alafenamide hemifumarate, and a second additional therapeutic agent selected from the group consisting of emtricitabine and lamivudine.
[0210] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with a first additional therapeutic agent selected from the group consisting of tenofovir, tenofovir disoproxil, tenofovir disoproxil fumarate, tenofovir alafenamide, and tenofovir alafenamide hemifumarate, and a second additional therapeutic agent, wherein the second additional therapeutic agent is emtricitabine.
[0211] In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more additional therapeutic agents in a therapeutically effective dosage ranging, for example, from 1 mg to 50 mg, 75 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 400 mg, 500 mg, 1000 mg, or 1500 mg of the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments. In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more additional therapeutic agents in a therapeutically effective dosage ranging from, for example, about 0.1 mg / kg to about 0.5 mg / kg, 1 mg / kg, 2 mg / kg, 3 mg / kg, 4 mg / kg, 5 mg / kg, 8 mg / kg, 10 mg / kg, 15 mg / kg, 20 mg / kg, 25 mg / kg, 30 mg / kg, 35 mg / kg, 40 mg / kg, 45 mg / kg, or 50 mg / kg of the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments. In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with one or more additional therapeutic agents in a therapeutically effective dosage ranging from, for example, about 5 mg to about 10 mg, 20 mg, 25 mg, 50 mg, 100 mg, 125 mg, 150 mg, 250 mg, 300 mg, 500 mg, 1000 mg, or 1500 mg of the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments.
[0212] In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 5-30 mg of tenofovir alafenamide fumarate, tenofovir alafenamide hemifumarate, or tenofovir alafenamide and 200 mg of emtricitabine. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 5-10, 5-15, 5-20, 5-25, 25-30, 20-30, 15-30, or 10-30 mg of tenofovir alafenamide fumarate, tenofovir alafenamide hemifumarate, or tenofovir alafenamide and 200 mg of emtricitabine. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 10 mg of tenofovir alafenamide fumarate, tenofovir alafenamide hemifumarate, or tenofovir alafenamide and 200 mg of emtricitabine. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 25 mg of tenofovir alafenamide fumarate, tenofovir alafenamide hemifumarate, or tenofovir alafenamide and 200 mg of emtricitabine. In some embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with agents provided herein in any dosage of anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments (e.g., 1 mg to 500 mg of anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments as described herein), as if each combination of dosages were specifically and individually recited.
[0213] In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 200-400 mg of tenofovir disoproxil fumarate, tenofovir disoproxil hemifumarate, or tenofovir disoproxil and 200 mg of emtricitabine. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 200-250, 200-300, 200-350, 250-350, 250-400, 350-400, 300-400, or 250-400 mg of tenofovir disoproxil fumarate, tenofovir disoproxil hemifumarate, or tenofovir disoproxil and 200 mg of emtricitabine. In certain embodiments, an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with 300 mg of tenofovir disoproxil fumarate, tenofovir disoproxil hemifumarate, or tenofovir disoproxil and 200 mg of emtricitabine. The anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment may be combined with an agent provided herein in any dosage amount (e.g., 1 mg to 500 mg of anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment), as if each combination of dosage amounts were specifically and individually recited.
[0214] Long-acting HIV inhibitors In some embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein can be co-administered with long-acting HIV inhibitors. Examples of drugs being developed as long-acting HIV inhibitors include, but are not limited to, cabotegravir LA, rilpivirine LA, any integrase LA, VM-1500 LAI, maraviroc (LAI), tenofovir implant, MK-8591 implant, and long-acting dolutegravir.
[0215] In one embodiment, the kit comprises an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein in combination with one or more (e.g., 1, 2, 3, 1 or 2, or 1 to 3) additional therapeutic agents.
[0216] HIV vaccine In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with an HIV vaccine. Examples of HIV vaccines include peptide vaccines, recombinant subunit protein vaccines, live vector vaccines, DNA vaccines, HIV MAG DNA vaccines, CD4-derived peptide vaccines, vaccine combinations, adenovirus vector vaccines, and the like. Adenovirus vaccines (e.g., Ad5, Ad26, or Ad35), simian adenovirus (chimpanzee, gorilla, rhesus macaque, i.e., rhAd), adeno-associated virus vector vaccines, chimpanzee adenovirus vaccines (e.g., ChAdOX1, ChAd68, ChAd3, ChAd63, ChAd83, ChAd155, ChAd157, Pan5, Pan6, Pan7, Pan9), coxsackievirus-based vaccines, enteric virus-based vaccines, gorilla adenovirus vaccines, lentivirus-vectored vaccines, bi-segmented or tripartite arenavirus-based vaccines (e.g., LCMV, Pichinde), trimeric HIV-1 vaccines, measles virus-based vaccines, flavivirus-vectored vaccines, tobacco mosaic virus-vectored vaccines, varicella-zoster virus-based vaccines, human parainfluenza virus 3 (PIV3)-based vaccines, poxvirus-based vaccines (modified vaccinia virus Ankara), Vaccine virus Ankara: MVA), orthopoxvirus-derived NYVAC, and avipox-derived ALVAC (canarypox virus) strains); fowlpox virus-based vaccines, rhabdovirus-based vaccines, such as vesicular stomatitis virus (VSV) and maraba virus; recombinant human CMV (rhCMV)-based vaccines, alphavirus-based vaccines, virus-based vaccines, such as Semliki Forest virus, Venezuelan equine encephalitis virus, and Sindbis virus (see, e.g., Lauer et al., Clin Vaccine Immunol. (2017) 24(1):e00298-16); LNP-formulated mRNA-based therapeutic vaccines, and LNP-formulated self-replicating RNA / self-amplifying RNA vaccines.
[0217] Examples of HIV vaccines include, but are not limited to, anti-CD40.Env-gp140 vaccine, Ad4-EnvC150, BG505 SOSIP.664 gp140 adjuvant vaccine, BG505 SOSIP.GT1.1 gp140 adjuvant vaccine, Chimigen HIV vaccine, ConM SOSIP.v7 gp140, rgp120(AIDSVAX), ALVAC HIV(vCP1521) / AIDSVAX B / E(gp120)(RV144), monomeric gp120 HIV-1 subtype C vaccine, MPER-656 liposomal subunit vaccine, Remune, ITV-1, Contre Vir, Ad5-ENVA-48, DCVax-001 (CDX-2401), Vacc-4x, Vacc-C5, VAC-3S, multiclade DNA recombinant adenovirus-5 (rAd5), rAd5 gag-pol env A / B / C vaccine, Pennvax-G, Pennvax-GP, Pennvax-G / MVA-CMDR, HIV-TriMix-mRNA vaccine, HIV-LAMP-vax, Ad35, Ad35-GRIN, NAcGM3 / VSSP ISA-51, polyICLC adjuvanted vaccine, TatImmune, GTU-multiHIV (FIT-06), ChAdV63.HIVconsv, gp140[δ]V2.TV1+MF-59, rVSVIN HIV-1 gag vaccine, SeV-EnvF, SeV-Gag vaccine, AT-20, DNK-4, ad35-Grin / ENV, TBC-M4, HIVAX, HIVAX-2, N123-VRC-34.01-derived epitope-based HIV vaccine, NYVAC-HIV-PT1, NYVAC-HIV-PT4, DNA-HIV-PT123, rAAV1-PG9DP, GOVX-B11, GOVX-B21, GOVX-C55, TVI-HIV-1, Ad-4 (Ad4-env clade C + Ad4-mGag), Paxvax, EN41-UGR7C, EN41-FPA2, ENOB-HV-11, PreVaxTat, AE-H, MYM-V101, CombiHIVvac, ADVAX, MYM-V201, MVA-CMDR, MagaVax, DNA-Ad5 gag / pol / nef / nev (HVTN505), MVATG-17401, ETV-01, CDX-1401, DNA and Sev vector vaccines expressing SCaVII, rcAD26.MOS1.HIV-Env, Ad26. Modified HIV vaccine, Ad26.Modified HIV + MVA mosaic vaccine + gp140, AGS-004, AVX-101, AVX-201, PEP-6409, SAV-001, ThV-01, TL-01, TUTI-16, VGX-3300, VIR-1111, IHV-001, as well as virus-like particle vaccines such as pseudovirion vaccines, CombiVICHvac, LFn-p24 B / C fusion vaccine, GTU-based DNA vaccine, HIV gag / pol / nef / env DNA vaccine, anti-TAT HIV vaccine, conjugate polypeptide vaccine, dendritic cell vaccine, gag-based DNA vaccine, GI-2010, gp41 HIV-1 vaccine, HIV vaccine (PIKA adjuvant), I i-key / MHC class II epitope hybrid peptide vaccine, ITV-2, ITV-3, ITV-4, LIPO-5, multiclade Env vaccine, MVA vaccine, Pennvax-GP, pp71-deficient HCMV vector HIV gag vaccine, recombinant peptide vaccine (HIV infection), NCI, rgp160 HIV vaccine, RNActive HIV vaccine, SCB-703, Tat Oyi vaccine, TBC-M4, therapeutic HIV vaccine, UBI HIV gp120, Vacc-4x + romidepsin, variant gp120 polypeptide vaccine, rAd5 gag-pol env A / B / C vaccine, DNA.HTI and MVA.HTI, VRC-HIVDNA016-00-VP + VRC-HIVADV014-00-VP, INO-6145, JNJ-9220, gp145C.6980; eOD-GT8 60mer vaccine, PD-201401, env (A, B, C, A / E) / gag (C) DNA vaccine, gp120 (A, B, C, A / E) protein vaccine, PDPHV-201401, Ad4-EnvCN54, EnvSeq-1 Env HIV-1 vaccine (GLA-SE adjuvant), HIV p24gag prime-boost plasmid DNA vaccine, HIV-1 iglb12-neutralizing VRC-01 antibody-priming anti-CD4 vaccine, MVA-BN HIV-1 vaccine regimen, UBI HIV gp120, mRNA-based prophylactic vaccine, VPI-211, and TBL-1203HI.
[0218] Combined birth control (contraception) therapy In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with birth control or contraceptive regimens. Therapeutic agents (contraceptives) used for birth control include cyproterone acetate, desogestrel, dienogest, drospirenone, estradiol valerate, ethinylestradiol, ethynodiol, etonogestrel, levomefolate, levonorgestrel, lynestrenol, medroxyprogesterone acetate, mestranol, mifepristone, misoprostol, nomegestrol acetate, norelgestromin, norethindrone, norethynodrel, norgestimate, ormeloxifene, segesterone acetate, ulipristal acetate, and any combination thereof.
[0219] Gene Therapy and Cell Therapy In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with gene or cell therapy regimens. Gene and cell therapies include, but are not limited to, genetic modifications to silence genes; genetic approaches to directly kill infected cells; infusions of immune cells designed to replace a large portion of a patient's own immune system to enhance the immune response to infected cells, or to activate the patient's own immune system to kill infected cells, or to find and kill infected cells; and genetic approaches to modify cell activity to further alter endogenous immune responsiveness to infection. Examples of cell therapies include LB-1903, ENOB-HV-01, GOVX-B01, and SupT1 cell-based therapies. Examples of dendritic cell therapies include AGS-004. Examples of CCR5 gene editing agents include SB-728T. Examples of CCR5 gene inhibitors include Cal-1. In some embodiments, C34-CCR5 / C34-CXCR4-expressing CD4-positive T cells are co-administered with an anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment. In some embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment is co-administered with AGT-103-transduced autologous T cell therapy or AAV-eCD4-Ig gene therapy.
[0220] gene editing agents In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibody or antigen-binding fragment described herein is combined with a gene editing agent, e.g., an HIV-targeted gene editing agent. In various embodiments, the genome editing system can be selected from the group consisting of a CRISPR / Cas9 complex, a zinc finger nuclease complex, a TALEN complex, a homing endonuclease complex, and a meganuclease complex. Exemplary HIV-targeted CRISPR / Cas9 systems include, but are not limited to, EBT-101.
[0221] CAR-T cell therapy In some embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are directed against chimeric antigen receptors (CAs). The HIV CAR-T can be co-administered with a population of immune effector cells genetically engineered to express a CD4-binding domain (CAR), where the CAR comprises an HIV antigen-binding domain. HIV antigens include HIV envelope proteins or portions thereof, gp120 or portions thereof, CD4-binding sites on gp120, CD4-inducible binding sites on gp120, N-glycans on gp120, V2 of gp120, and membrane-proximal regions on gp41. The immune effector cells are T cells or NK cells. In some embodiments, the T cells are CD4+ T cells, CD8+ T cells, or a combination thereof. The cells can be autologous or allogeneic. Examples of HIV CAR-T include transformed CAR-T, VC-CAR-T, anti-CD4CAR cell therapy, and autologous hematopoietic stem cells genetically engineered to express CD4CAR and C46 peptide.
[0222] TCR-T cell therapy In certain embodiments, the anti-HIV gp120 V3 glycan-directed antibodies or antigen-binding fragments described herein are combined with a population of TCR-T cells that are engineered to target HIV-derived peptides present on the surface of virally infected cells.
[0223] 6. Kit Kits for carrying out the diagnostic and therapeutic methods described herein are also provided. In some embodiments, the kits include primers for amplifying and sequencing at least the gp120 V3 glycan region of HIV species in a biological sample. In some embodiments, the kits include a suite or set of nested primers for amplifying and sequencing at least the gp120 V3 glycan region of HIV species in a biological sample. In some embodiments, the kits include a pair of primers or a nested primer set for amplifying and sequencing full-length gp120. In some embodiments, the kits include sample preparation, nucleic acid quantification, amplification, and / or sequencing reagents, such as nucleic acid isolation reagents for isolating RNA and / or DNA, protein-denaturing solvents, buffers, dNTPs, reverse transcriptase, polymerase enzyme, and / or detection labels. In some embodiments, the kits include library preparation reagents, such as barcode reagents and / or target-specific primers. In some embodiments, the kits include analysis guides and / or software, for example, to facilitate the performance of the diagnostic methods described herein. In some embodiments, the kit includes instructions for sequencing at least the gp120 V3 glycan region of HIV species in a biological sample to detect or identify HIV species expressing gp120, which comprises a glycosylated asparagine at a position corresponding to amino acid residue 332 (N332 glycan), an aspartate at a position corresponding to amino acid residue 325 (D325), and one or more of the following amino acids: a threonine at a position corresponding to amino acid residue 63 (T63), a leucine at a position corresponding to amino acid residue 179 (L179), a threonine at a position corresponding to amino acid residue 320 (T320), and a histidine at a position corresponding to amino acid residue 330 (H330), wherein the amino acid positions refer to residues 1-511 of SEQ ID NO:4 (i.e., NCBI Reference SEQ ID NO: NP_057856.1), as described herein.
[0224] In one embodiment, the kit comprises one or more pharmaceutical packs comprising one or more containers (e.g., vials, ampoules, pre-filled syringes) containing one or more of the components of the pharmaceutical compositions described herein, such as antibodies or antigen-binding fragments thereof against the HIV gp120 V3 glycan region, or one or more polynucleotides encoding such antibodies or antigen-binding fragments, etc., as provided herein. In some examples, the kit contains a pharmaceutical composition described herein. In some embodiments, the kit comprises one or more containers containing antibodies or antigen-binding fragments thereof against the HIV gp120 V3 glycan region, or one or more polynucleotides encoding such antibodies or antigen-binding fragments, etc., in aqueous solution or lyophilized form. Optionally, associated with such containers may be a notice in the form prescribed by a government agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use, or sale for human administration. [Example]
[0225] The following examples are offered to illustrate, but not to limit, the claimed invention.
[0226] Example 1 Identification of HIV-infected patients who respond to therapy with anti-HIV gp120 V3-glycan-directed antibodies or their antigen-binding fragments This example demonstrates the identification of Env genotypes associated with viral susceptibility to neutralization by PGT121 and its derivative, GS-9722 (elipovimab), for prescreening of HIV-infected subjects for susceptibility to PGT121 / GS-9722.
[0227] The high level of sequence diversity in HIV envelope genes makes prescreening of subjects in clinical trials of broadly neutralizing antibodies (bNAbs) attractive because it increases the likelihood of a high response rate. To identify Env genotypes that predict viral susceptibility to PGT121 and GS-9722, we examined PGT121 and GS-9722 neutralization data and corresponding Env sequences of 206 clade B Envs.
[0228] GS-9722 is a genetically engineered variant of PGT121 that maintains the same neutralizing activity as PGT121, as evidenced by the highly statistically significant correlation of PGT121 and GS-9722 neutralizing IC50s between 397 HIV strains tested with PGT121 and GS-9722 (r 2 =0.9698, P<0.0001). Therefore, we combined GS-9722 neutralization data obtained with 140 clade B Envs isolated from viremic subjects enrolled in a Gilead-sponsored clinical trial with publicly available PGT121 neutralization data obtained from the Los Alamos HIV Sequence Database (n=66) to increase statistical power.
[0229] Full-length Env amino acid sequences were aligned using ClustalW and manually adjusted upon visual inspection. To identify genotypes associated with susceptibility to neutralization by PGT121 / GS-9722, we compared the amino acid frequencies and potential N-linked glycosylation sites (PNGS) at each residue between PGT121 / GS-9722-susceptible viruses with those of PGT121 / GS-9722-resistant viruses using Fisher's exact test. The N-linked glycosylation motif was NXS / T, where X is any residue except proline. Neutralization susceptibility to PGT121 / GS-9722 was defined as an IC50 < 1 μg / mL. For residues that were statistically significantly associated with susceptibility to PGT121 / GS-9722, the positive predictive value (PPV; i.e., the probability that the Env is susceptible to PGT121 / GS-9722, given the presence of the genotype) and susceptibility (i.e., the probability that the genotype is present, given that the Env is susceptible to PGT121 / GS-9722) were calculated as follows: [Table 11]
number
[0230] The Mann-Whitney test was also applied to identify determinants of susceptibility independent of the 1 μg / mL cutoff for designating Env as "susceptible" versus "resistant."
[0231] Residues that were statistically associated with susceptibility to PGT121 / GS-9722 and / or previously reported to be associated with PGT121 susceptibility are ranked by descending PPV and listed in Table 2. Among residues previously reported to confer susceptibility to PGT121, 307I, 295PNGS, and 300PNGS were not statistically associated with susceptibility to PGT121 / GS-9722 in this Clade B dataset. We identified many previously unreported residues that were significantly associated with susceptibility to PGT121 / GS-9722. [Table 12]
[0232] Because epitopes consist of more than two residues, we evaluated combinations of genotypic determinants that were statistically associated with susceptibility to PGT121 / GS-9722 to determine whether combining individual genotypic determinants improved PPV by preferentially enriching for true positives over false positives. Because less susceptible genotypes require screening of a larger number of subjects, susceptibility was also considered to enroll sufficient subjects in clinical trials.
[0233] The genotype combinations that provided the highest PPV and sensitivity are listed in Table 3 and shown in Figure 1. Several genotype combinations, incorporating previously unreported genotypes associated with sensitivity to PGT121 / GS-9722 neutralization, provided higher PPV than was achievable using previously described genotypes alone. The highest PPV obtained was 98.4% (for a virus containing the amino acid N332 glycan / D325 / H330 / T63 / T320 / L179), representing a 57% increase over the positive predictive value of 62.6% without genotype selection. [Table 13]
[0234] Using the combined PGT121 / GS-9722 genotypes in Table 3 for Clade B, the neutralization data and corresponding Env sequences for 66 Clade A Envs and 258 Clade C Envs were used to determine the PPV, susceptibility, and prevalence for Clade A (Table 4) and Clade C (Table 5). The Clade A and Clade C datasets were publicly available data obtained from the Los Alamos HIV Sequence Database. The highest PPV obtained for Clade A was 93.8% (for viruses containing amino acids N332 glycan / D325 / H330 / T320 / L179), representing an 88% increase over the 50% positive predictive value without genotype selection. The highest PPV obtained for clade C was 89.3% (for viruses containing amino acids N332 glycan / D325 / H330 / T320 / L179), which represents a 53% increase over the positive predictive value of 58.5% without genotype selection. [Table 14] [Table 15]
[0235] The prevalence of individual amino acids (T63, L179, T320, D325, H330, N332, NotP333, and S / T334) used in the PGT121 / GS-9722 combination genotype was determined for clade A, clade B, and clade C viral sequences (Table 6). All amino acids show a prevalence greater than 60% in clade B, clade A except for L179 (51.5%), and clade C except for T63 (10.1%). [Table 16]
[0236] 10-1074 is a broadly neutralizing antibody that targets the V3 glycan region of HIV gp120 and is related to PGT121 / GS-9722. See, e.g., Mouquet et al., Proc Natl Acad Sci U S A. 2012 Nov. 20; 109(47):E3268-77; and Walker et al., Nature. 2011 Sep. 22; 477(7365):466-70. Using the combined genotype of PGT121 / GS-9722 in Table 3, the PPV, susceptibility, and prevalence of 10-1074 were determined using the neutralization data of 315 clade BEnvs and corresponding Env sequences (Table 7). The 315 clade B dataset includes 143 clade B strains isolated from viremic subjects enrolled in Gilead-sponsored clinical trials. The genotype selection consisted of 172 Clade B Envs from publicly available data obtained from the Los Alamos HIV Sequence Database. The highest PPV obtained was 100% (for viruses containing the amino acid N332 glycan / D325 / H330 / T63 / T320 / L179), representing a 61% increase over the 62.2% positive predictive value without genotype selection. [Table 17]
[0237] The highest-scoring genotype algorithm (Table 3) was then applied to analyze pre-ART plasma samples from HIV-infected individuals from the Zurich Primary HIV Infection Cohort Study (ZPHI) to predict whether they would be susceptible to GS-9722 treatment. A total of 92 individual plasma samples were analyzed with an NGS assay for the HIV envelope gene (GenoSure HIV Envelope RNA Assay, Monogram Biosciences, South San Francisco, CA). Subjects were characterized as positive for a given genotype if the derived viral sequence contained the amino acid specified by the algorithm without sequence variability (sequence variability at the specified position was 0). Using these criteria, 47 / 92, 37 / 92, 32 / 92, 27 / 92, 22 / 92, and 16 / 92 subjects were predicted to be susceptible to GS-9722 (Figure 1), with corresponding positive predictive values of 80.7%, 83.5%, 86.1%, 91.6%, 93.7%, and 98.4%, respectively (Table 3). For clade B-infected subjects (59 of 92 subjects), 35 / 59, 27 / 59, 22 / 59, 23 / 59, 18 / 59, and 12 / 59 were predicted to be susceptible to GS-9722 (Figure 2), with corresponding positive predictive values of 80.7%, 83.5%, 86.1%, 91.6%, 93.7%, and 98.4%, respectively (Table 3).
[0238] For pre-ART plasma samples in all subjects (n = 92) and the subset of subjects infected with clade B (n = 59), 100% conservation (no sequence variability at the specified positions) of the individual amino acids (T63, L179, T320, D325, H330, N332, NotP333, and S / T334) used in the combined genotypes for GS-9722 susceptibility prediction was determined (Table 8). [Table 18]
[0239] To confirm the genotypic prediction of susceptibility to GS-9722, viral swarms from pre-ART plasma samples from ZPHIs were cloned and evaluated in a GS-9722 neutralization assay (PhenoSense HIV Entry Assay, Monogram Biosciences, South San Francisco, CA). Viruses were derived from 29 clade B samples, with a positive predictive value of 80.7% or higher. Derived viruses were characterized as GS-9722 susceptible if their IC50 was 1 μg / mL or lower. Using these criteria, 25 / 29, 20 / 22, 16 / 18, 18 / 20, 14 / 16, and 10 / 11 viruses were confirmed as susceptible to GS-9722 (Figure 2), with corresponding positive predictive values of 80.7%, 83.5%, 86.1%, 91.6%, 93.7%, and 98.4%, respectively (Table 3).
[0240] To further confirm the genotypic predictions and phenotypic susceptibility to GS-9722, 20 individual viruses from four viral swarms from pre-ART plasma samples from ZPHIs were subcloned and evaluated in a GS-9722 neutralization assay (PhenoSense HIV Entry Assay, Monogram Biosciences, South San Francisco, CA). All individual viruses were susceptible to GS-9722 with IC50s comparable to those of the swarm viruses (Figure 4).
[0241] It is understood that the examples and embodiments described herein are for illustrative purposes only, and that various modifications or changes in light thereof will be suggested to those skilled in the art and are to be included within the spirit and scope of this application and the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
Claims
[Claim 1] The invention as set forth in the drawings.
Citation Information
Patent Citations
Anti-hiv monoclonal antibody
WO2009066702A1
Human immunodeficiency virus (HIV)-neutralizing antibodies
WO2012030904A2
Broadly-neutralizing Anti-HIV antibodies
WO2014063059A1
HIV-1 neutralizing antibodies and uses thereof (v3 antibodies)
WO2016149698A2
Human immunodeficiency virus neutralizing antibodies
WO2017106346A2