Oncolytic viruses expressing car t-cell targets and uses thereof

Recombinant chimeric poxviruses expressing CD19 enhance tumor killing by infecting cancer cells and activating CD19-CAR T cells, addressing the limited efficacy of current oncolytic viruses.

JP2026012184APending Publication Date: 2026-01-23CITY OF HOPE
View PDF 2 Cites 0 Cited by

Patent Information

Application Number
JP2025166481
Authority / Receiving Office
JP · JP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2017-08-11
Filing Date
2025-10-02
Publication Date
2026-01-23

AI Technical Summary

Technical Problem

Current oncolytic viruses, despite being well-tolerated, have limited clinical benefit as monotherapy and there is a need for enhanced antitumor efficacy.

Method used

Development of recombinant chimeric poxviruses expressing human CD19, which infect and kill cancer cells, and induce CD19 expression on their surface, making them vulnerable to CD19-targeting CAR T cells.

Benefits of technology

The recombinant chimeric poxviruses effectively deliver CD19 to cancer cells, enhancing tumor killing and activating CD19-CAR T cells for potent cancer treatment.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 2026012184000014
    Figure 2026012184000014
  • Figure 2026012184000015
    Figure 2026012184000015
  • Figure 2026012184000016
    Figure 2026012184000016
Patent Text Reader

Abstract

To provide oncolytic poxviruses encoding truncated human CD19.SOLUTION: Oncolytic poxviruses encoding truncated human CD19 are used in combination with chimeric antigen-receptors for the treatment of solid tumors.SELECTED DRAWING: None
Need to check novelty before this filing date? Find Prior Art

Description

[Background technology]

[0001] Cancer is the second leading cause of death in the United States. In recent years, there have been significant advances in cancer immunotherapy, including immune checkpoint inhibitors, chimeric antigen receptor-equipped T cells (CAR T cells), and oncolytic viruses. Oncolytic viruses are naturally occurring or genetically engineered viruses that infect, replicate in, and ultimately kill cancer cells without damaging healthy cells.

[0002] Oncolytic viruses are naturally occurring or genetically modified viruses that infect, replicate within, and ultimately kill cancer cells without damaging healthy cells (Non-Patent Documents 1 and 2). A recently completed phase III clinical trial of the oncolytic herpes simplex virus T-VEC in 436 patients with unresectable stage IIIB, IIIC, or IV melanoma met its primary endpoint, reporting that 16.3% of patients receiving T-VEC achieved a durable response compared with 2.1% of patients receiving GM-CSF (Non-Patent Document 3). Based on the results of this clinical trial, the FDA approved T-VEC on October 27, 2015.

[0003] Oncolytic virus constructs derived from at least eight different species, including adenovirus, herpes simplex virus 1, Newcastle disease virus, reovirus, measles virus, coxsackievirus, Seneca Valley virus, and vaccinia virus, are currently being tested in various stages of clinical trials. Oncolytic viruses have been shown to be well tolerated in cancer patients. However, the clinical benefit of oncolytic viruses as monotherapy has been limited (Non-Patent Document 5). Due to safety concerns regarding oncolytic viruses, only highly attenuated oncolytic viruses (either naturally non-toxic or genetically attenuated) have been used in both preclinical and clinical trials. Now that the safety of oncolytic viruses has been well established, it is possible to design and test oncolytic viruses that can maximize their antitumor efficacy. Oncolytic viruses, which exert potent oncolytic effects, release large amounts of tumor antigens, resulting in potent immunotherapeutic effects.

[0004]

[0004] Vaccinia virus, the prototype of the poxvirus family, was used as a smallpox vaccine and eradicated smallpox, which killed an estimated 500 million people in the 19th and 20th centuries alone. It is undoubtedly the most successful live biological product. Vaccinia virus's safety has been well documented in millions of people worldwide. Vaccinia virus was also the first oncolytic virus to demonstrate viral oncolysis in the laboratory. Vaccinia virus as an oncolytic virus has been tested in numerous clinical trials and has been shown to be well tolerated in advanced cancer patients (Non-Patent Document 2). Several studies have shown that vaccinia virus is superior to adenovirus in terms of oncolytic activity (Non-Patent Document 6), which is one of the most well-studied oncolytic virus species and the first oncolytic virus approved for cancer treatment in China (Non-Patent Document 7). In addition to vaccinia virus, other viruses of the poxvirus family, such as raccoonpox virus (Non-Patent Document 8), orf virus (Non-Patent Document 9), and myxoma virus (Non-Patent Document 10), have also been verified as oncolytic viruses. [Prior art documents] [Non-patent literature]

[0005] [Non-Patent Document 1] Chen NG & Szalay AA (2011)Oncolytic virotherapy of cancer. Cancer Managment in Man: Chemotherapy, Biological Therapy, Hyperthermia and Supporting Measures, Cancer Growth and Progression, ed Minev BR (Springer, New York), Vol 13, pp 295-316. [Non-patent document 2] Chen NG & Szalay AA (2010)Oncolytic vaccinia virus: a theranostic agent for cancer. Future Virol.5(6):763-784. [Non-licensed document 3] Andtbacka RH, et al. (2015) Talimogene Laherparepvec Improves Durable Response Rate in Patients WithAdvanced Melanoma. J Clin Oncol 33(25):2780-2788.

Non-licensed Document 4

Non-licensed Document 5

Non-licensed Document 6

Non-licensed Document 7

Non-Patent Document 9

Non-Patent Document 10

Summary of the Invention

[0006]

[0005] The present disclosure relates to a recombinant chimeric poxvirus comprising a nucleotide sequence having at least 70% (80%, 85%, 90%, 95%, 98%) sequence identity to SEQ ID NO:1 or SEQ ID NO:2 (or at least 70% (80%, 85%, 90%, 95%, 98%) sequence identity to SEQ ID NO:1 or SEQ ID NO:2 modified by deletion of the TK gene), and further encoding human CD19, or a portion thereof. The recombinant poxvirus is oncolytic and capable of infecting and killing specific cancer cells. It can also cause infected cells to express cell surface CD19 (or a portion of CD19 that can be expressed on the cell surface). Expression of CD19 renders the cells vulnerable to killing by CD19-targeting CAR T cells (CD19 CAR T cells). That is, various cancers can be treated by administering recombinant chimeric poxviruses or other oncolytic viruses containing a transgene encoding all or part of CD19 (collectively "CD19-expressing oncolytic viruses") together with, or sequentially with, CD19 CAR T cells. In some cases, it may be preferable to first treat with a CD19-expressing oncolytic virus, followed by treatment with CD19 CAR T cells after allowing time (e.g., 1, 2, 3, 4, 5, or more days) for the cells to become infected and express CD19. Either or both treatments can be repeated.

[0007]

[0006] In one aspect, a recombinant oncogenic virus is provided that includes a transgene, for example, a transgene in an expression cassette that encodes all or part of human CD19 (UniProt ID P15391), where the expressed portion of CD19 refers to a portion that can be expressed on the cell surface and recognized by an anti-CD19 antibody.

[0008]

[0007] In another aspect, provided is a method of treating cancer in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a chimeric poxvirus described herein and, simultaneously or subsequently, T cells expressing a CAR that targets CD19, thereby treating the cancer in the subject. In some embodiments, the cancer is, for example, a B-cell cancer, ALL, CLL, or B-NHL, diffuse large B-cell lymphoma, follicular lymphoma, or mantle cell lymphoma.

[0009]

[0008] In one aspect, the nucleotide sequence having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2 includes: (i) nucleic acid fragments derived from at least two poxvirus strains selected from the group consisting of cowpox virus Brighton strain, raccoonpox virus Herman strain, rabbitpox virus Utrecht strain, vaccinia virus WR strain, vaccinia virus IHD strain, vaccinia virus Elstree strain, vaccinia virus CL strain, vaccinia virus Lederle-Chorioallantoic strain, vaccinia virus AS strain, orf virus NZ2 strain, and pseudocowpox virus TJS strain; (ii) one or more anti-cancer nucleic acid sequences; or (iii) a nucleic acid sequence encoding a detectable moiety.

[0010]

[0009] In other aspects, nucleotide sequences having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 1 include: (i) nucleic acid fragments derived from cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, and vaccinia virus strain AS; (ii) one or more anti-cancer nucleic acid sequences; or (iii) nucleic acid sequences encoding a detectable moiety.

[0011]

[0010] In other aspects, nucleotide sequences having at least 70% sequence identity to SEQ ID NO: 2 include: (i) nucleic acid fragments derived from the sheeppox virus strain NZ2 and the pseudocowpox virus strain TJS; (ii) one or more anti-cancer nucleic acid sequences; or (iii) nucleic acid sequences encoding a detectable moiety.

[0012]

[0011] In other aspects, nucleotide sequences having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 3 include: (i) nucleic acid fragments derived from cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, and vaccinia virus strain AS; (ii) one or more anti-cancer nucleic acid sequences; or (iii) nucleic acid sequences encoding a detectable moiety.

[0013]

[0012] In one aspect, nucleotide sequences having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2 include: (i) nucleic acid fragments derived from at least two poxvirus strains selected from the group consisting of cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, vaccinia virus strain AS, sheep pox virus strain NZ2, and pseudocowpox virus strain TJS; (ii) one or more anti-cancer nucleic acid sequences; (iii) one or more nucleic acid binding sequences; or (iv) a nucleic acid sequence encoding a detectable moiety.

[0014]

[0013] In other aspects, nucleotide sequences having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 1 include: (i) nucleic acid fragments derived from cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, and vaccinia virus strain AS; (ii) one or more anti-cancer nucleic acid sequences; (iii) one or more nucleic acid binding sequences; or (iv) a nucleic acid sequence encoding a detectable moiety.

[0015]

[0014] In other aspects, nucleotide sequences having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 2 include: (i) nucleic acid fragments derived from sheeppox virus strain NZ2 and pseudocowpox virus strain TJS; (ii) one or more anti-cancer nucleic acid sequences; (iii) one or more nucleic acid binding sequences; or (iv) nucleic acid sequences encoding a detectable moiety.

[0016]

[0015] In other aspects, nucleotide sequences having at least 70% (80%, 85%, 90%, 95% or 98%) sequence identity to SEQ ID NO: 3 include: (i) nucleic acid fragments derived from cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, and vaccinia virus strain AS; (ii) one or more anti-cancer nucleic acid sequences; (iii) one or more nucleic acid binding sequences; or (iv) a nucleic acid sequence encoding a detectable moiety. [Brief explanation of the drawings]

[0017] [Figure 1]

[0016] This is a graph showing that chimeric orthopoxvirus isolates #33 (sequence number 1) and #17 have superior cancer cell killing ability compared to the parent wild-type virus strain, and the control viruses GLV-1h68 and OncoVEX GFP, respectively. [Figure 2]

[0017] This is a graph showing that chimeric parapoxvirus isolate #189 (sequence number 2) has superior cancer cell killing ability compared to the parent wild-type virus strain, and the control viruses GLV-1h68 and OncoVEX GFP. [Figure 3]

[0018] 1 is a graph showing that chimeric orthopoxvirus isolates #17 and #33 (SEQ ID NO: 1) have potent cancer cell-killing ability in pancreatic cancer cell lines compared to the parent wild-type virus strain, and the control viruses GLV-1h68 and OncoVEX GFP, respectively. [Figure 4]

[0019] 1 is a graph showing that chimeric parapoxvirus isolate #189 (SEQ ID NO: 2) has potent cancer cell killing ability in pancreatic cancer cell lines compared to the parental wild-type virus strain and the control viruses GLV-1h68 and OncoVEX GFP. [Figure 5]

[0020] Chimeric virus isolates #33 (SEQ ID NO: 1) and #189 (SEQ ID NO: 2) exhibited excellent cell killing ability in gastric cancer cell lines. Cancer cells were infected with each virus at an MOI of 0.01, 0.1, and 1.0. The graphs show cell viability 96 hours after infection plotted against the MOI for the gastric cell lines MKN-45 (A), OCUM-2M (B), and KATO-3 (C). [Figure 6]

[0021] 1 is a graph showing CD19 expression in the parental MDA-MB-468 line and the CD19t line, as measured by flow cytometry. [Figure 7]

[0022] FIG. 1 is a schematic diagram of the CD19 CAR used in the experiments described herein. [Figure 8]

[0023] Graph of cleaved EGFR expression measured by flow cytometry, showing the presence of CD19 CAR. [Figure 9]

[0024] Co-cultures of MDA-MB-468 tumors with either mock or CD19 CAR T cells and 33-CD19t virus were stained and analyzed by flow cytometry to determine CD19t expression on target cells. Top: without CD19 CAR T cell treatment. Bottom: with CD19 CAR T cell treatment. [Figure 10]

[0025] This graph shows the results of enzyme-linked immunosorbent assay (ELISA) detection of T cell production of IL-2 (bottom) and IFN-γ (top) from supernatants collected in a 48-hour long-term killing experiment using the 33-CD19t virus. [Figure 11]

[0026] Cell culture images (10x) of tumor killing assay comparing mock and CAR T cells 24, 48, and 72 hours after virus treatment. [Figure 12]

[0027] Long-term killing assay of MDA-MB-468 cells: Cultures were analyzed (A) 24 hours, (B) 48 hours, and (C) 72 hours after exposure of cells to mock, or CD19 CAR T cells, and 33-CD19t virus to measure CD19t expression and % tumor killing compared to virus control (left). [Figure 13]

[0001] Oncolytic viruses effectively deliver CD19t to solid tumors and activate CD19-CAR T cells in vitro. (A) Schematic diagram of vaccinia oncolytic virus [CF33(SE)hCD19t] showing incorporation of a truncated human CD19 (CD19t) under the control of a synthetic early promoter (PSE) inserted into the J2R locus, replacing the thymidine kinase gene. (B) Immunofluorescence microscopy images of MDA-MB-468 cells infected with OV19t at an MOI of 0.025 (left) and 1 (center) for 24 hours, or transduced with lentivirus to stably express CD19t (right). Image magnification is 10x, and inset magnification is 40x. (C) FACS plots showing cell surface expression of CD19t on MDA-MB-468 tumor cells and intracellular expression of vaccinia virus, measured by flow cytometry, 24 hours after infection with increasing MOIs of OV19t. (D) Quantification of CD19t (left), vaccinia (center), and viability (right) after 24, 48, and 72 hours of co-culture of MDA-MB-468 tumor cells with the indicated MOIs of OV19t. (E) Quantification of CD25 (left) and CD137 (right) expressed on mock (untransduced) or CD19-CAR T cells after 24 hours of co-culture with tumor cells at an effector:tumor (E:T) ratio of 1:2, with or without treatment with the indicated MOIs of OV19t. [Figure 14]

[0002] Graphs showing that the OV19t oncolytic virus can promote CD19t expression on tumor cells and redirect CD19-CAR T cell activation and cytotoxicity in vitro. (A) Representative flow cytometry analysis of cell surface CD107a (left) and intracellular IFN-γ expression (right) in CD8+CAR+T cells 16 hours after coculture with MDA-MB-468 tumor cells at an E:T ratio of 1:1, with or without treatment with OV19t at the indicated MOI. (B) IFN-γ production in supernatants collected 24, 48, and 72 hours after coculture with or without treatment with OV19t at the indicated MOI, measured by ELISA. (C) Graph showing the results of a tumor killing assay assessed by flow cytometry comparing mock or CD19-CAR T cells after 24, 48, or 72 hours of co-culture with MDA-MB-468 tumor cells treated with the indicated MOI of OV19t. (D) Graph showing CD19t expression on tumor cells in the killing assay described in (C). (E) Graph showing viral titers in supernatants harvested from co-cultures of tumor cells and T cells treated with the indicated MOI of OV19t. [Figure 15]

[0003] Figures showing the antitumor effect of combination therapy of OV19t and CD19-CAR T cells in a TNBC xenograft model. (A) Mice were engrafted with subcutaneous MDAMB-468 tumors (5 × 10 cells) and treated intratumorally with 0, 10, 10, or 10 plaque-forming units (pfu) per mouse. Tumors were harvested on days 3 (left), 7 (center), or 10 (right) post-treatment, and CD19t expression was quantified by flow cytometry. (+) indicates MDA-MB-468 tumors stably expressing CD19t, transduced with lentivirus as described above. (B) Graph showing tumor volume (mm) in NSG mice bearing subcutaneous MDA-MB-468 (5x106 cells) tumors on day 0 of the study. On day 36, the mice were treated with OV19t (107 pfu), and on day 46, the mice were treated with either mock or CD19-CAR T cells (5x106 cells). (C) Graph showing mean tumor volume at day 73 of the in vivo experiment described in (B). (D) Schematic diagram showing the concept of combination therapy using OV for targeted delivery of CAR to refractory solid tumors. DETAILED DESCRIPTION OF THE INVENTION

[0018]

[0028] This specification relates to recombinant oncolytic viruses that express all or part of human CD19. The viruses are derived from chimeric poxvirus compositions that are oncolytic or other oncolytic viruses. Suitable recombinant oncolytic viruses can be generated by inserting an expression cassette containing a sequence encoding human CD19, or a portion thereof, into a chimeric or other oncolytic virus, as described in PCT / US2017 / 46163, filed August 9, 2017, and incorporated herein by reference.

[0019]

[0029] The term "recombinant," when used in reference to, for example, a cell, or a nucleic acid, protein, or vector, means that the cell, nucleic acid, protein, or vector has been modified by the introduction of a heterologous nucleic acid or protein, or by the modification of a naturally occurring nucleic acid or protein, or that the cell is derived from a cell so modified.

[0020]

[0030] The terms "virus" or "virus particle" are used in accordance with their conventional meaning in virology to refer to a virion containing the viral genome (e.g., DNA, RNA, single-stranded, double-stranded), viral capsid, and associated proteins, and, in the case of enveloped viruses (e.g., herpesviruses, poxviruses), the envelope containing lipids and optionally host cell membrane components, and / or viral proteins.

[0021]

[0031] The term "poxvirus" is used according to its conventional meaning in virology to refer to a species of the Poxviridae family that can infect vertebrates and invertebrates and replicate in the cytoplasm of the host. In some embodiments, poxvirus virions are approximately 200 nm in diameter and 300 nm in length, with their genomes typically contained in a single, linear, double-stranded segment of DNA ranging from 130 to 375 kilobases. The term poxvirus includes all genera of the family Poxviridae (e.g., betaentomopoxvirus, yatapoxvirus, cervidpoxvirus, gammaentomopoxvirus, leporipoxvirus, suipoxvirus, molluscipoxvirus, crocodylidpoxvirus, alphaentomopoxvirus, capripoxvirus, orthopoxvirus, avipoxvirus, and parapoxvirus), but is not limited to these. In some embodiments, the poxvirus is an orthopoxvirus (e.g., smallpox virus, vaccinia virus, cowpox virus, monkeypox virus), a parapoxvirus (e.g., sheeppox virus, pseudocowpox virus, bovine popular stomatitis virus), a yatapoxvirus (e.g., tanapox virus, yaba monkey tumor virus), or a molluscipoxvirus (e.g., molluscum contagiosum virus).In some embodiments, the poxvirus is an orthopoxvirus (e.g., cowpox virus strain Brighton, raccoonpox virus strain Herman, rabbitpox virus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, or vaccinia virus strain AS). In some embodiments, the poxvirus is a parapoxvirus (e.g., sheeppox virus strain NZ2, or pseudocowpox virus strain TJS).

[0022]

[0032] The term "chimera," when used in reference to a chimeric poxvirus, is used according to its conventional meaning in virology to refer to a hybrid microorganism (e.g., a chimeric poxvirus) created by combining nucleic acid segments from two or more different microorganisms (e.g., two viruses from the same subfamily, two viruses from different subfamilies). In some embodiments, at least two nucleic acid segments each comprise an essential gene required for replication. The chimeric poxviruses provided herein, including embodiments thereof, can include one or more transgenes (i.e., nucleic acid sequences not inherently present in the viral genome). For example, the chimeric poxviruses provided herein, including embodiments thereof, can include an anti-cancer nucleic acid sequence, a nucleic acid binding sequence, a nucleic acid sequence encoding a detectable moiety, or any combination thereof. In some embodiments, the chimeric poxvirus comprises a nucleic acid sequence comprising an anti-cancer nucleic acid sequence, a nucleic acid binding sequence, and a nucleic acid sequence encoding a detectable moiety. In some embodiments, the chimeric poxvirus comprises an anti-cancer nucleic acid sequence and a nucleic acid sequence encoding a detectable moiety. In some embodiments, the chimeric poxvirus comprises a nucleic acid sequence comprising a nucleic acid binding sequence and a nucleic acid sequence encoding a detectable moiety, hi some embodiments, the chimeric poxvirus comprises a nucleic acid sequence comprising an anti-cancer nucleic acid sequence and a nucleic acid binding sequence.

[0023]

[0033] The term "Cowpox virus Brighton strain" is used according to its common and ordinary meaning and refers to virus strains of the same or similar name, as well as functional fragments and homologs thereof. The term includes recombinant or natural cowpox virus Brighton strain, or variants thereof, that maintain the activity of the cowpox virus Brighton strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term encompasses recombinant or natural cowpox virus Brighton strain, or variants thereof, whose genomes share sequence identity with the cowpox virus Brighton strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the cowpox virus Brighton strain genome). The cowpox virus Brighton strain refers to a variant having a mutated amino acid that modulates (e.g., increases or decreases compared to) the activity, expression, cell targeting, or infectivity of the cowpox virus Brighton strain. The cowpox virus Brighton strain can be modified as described herein. In some embodiments, the cowpox virus Brighton strain refers to a virus strain identified by ATCC (American Type Culture Collection) reference number ATCC VR-302™, or a variant or homolog thereof.

[0024]

[0034] The term "raccoon poxvirus Herman strain" is used according to its common and ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring raccoon poxvirus Herman strain, or variants thereof, that maintain the activity of the raccoon poxvirus Herman strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring raccoon poxvirus Herman strain, or variants thereof, whose genomes share sequence identity with the raccoon poxvirus Herman strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the raccoon poxvirus Herman strain genome). The raccoon poxvirus Herman strain refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases, compared to) the activity, expression, cell targeting, or infectivity of the raccoon poxvirus Herman strain. The raccoon poxvirus Herman strain can be modified as described herein. In some embodiments, the raccoon poxvirus Herman strain refers to the virus strain identified by ATCC Reference Number ATCC VR-838™, a variant thereof, or a homolog thereof.

[0025]

[0035] The term "rabbitpox virus Utrecht strain" is used according to its common, ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring rabbitpox virus Utrecht strain or mutants thereof that maintain the activity of the rabbitpox virus Utrecht strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring rabbitpox virus Utrecht strain or mutants thereof, the genome of which shares sequence identity with the rabbitpox virus Utrecht strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the rabbitpox virus Utrecht strain). The rabbitpox virus Utrecht strain refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases compared to) the activity, expression, cell targeting, or infectivity of the rabbitpox virus Utrecht strain. The rabbitpox virus Utrecht strain can be modified as described herein. In some embodiments, the rabbitpox virus Utrecht strain refers to the virus strain identified by ATCC reference number ATCC VR-1591™, a variant thereof, or a homolog thereof.

[0026]

[0036] The term "vaccinia virus strain WR" is used according to its common and ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring vaccinia virus strain WR, or mutants thereof, that retain the activity of the vaccinia virus strain WR (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring vaccinia virus strain WR, or mutants thereof, whose genomes share sequence identity with the vaccinia virus strain WR genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the vaccinia virus strain WR). Vaccinia virus strain WR refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases compared to) the activity, expression, cell targeting, or infectivity of the vaccinia virus strain WR. The vaccinia virus strain WR can be modified as described herein. In some embodiments, vaccinia virus strain WR refers to the virus strain identified by ATCC reference number ATCC VR-1354™, a variant thereof, or a homolog thereof.

[0027]

[0037] The term "vaccinia virus IHD strain" is used according to its common and ordinary meaning and refers to identically or similarly named virus strains, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring vaccinia virus IHD strains, strains, or variants thereof that retain the activity of vaccinia virus IHD strains (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term encompasses recombinant or naturally occurring vaccinia virus IHD strains, or variants thereof, whose genomes share sequence identity with the vaccinia virus IHD strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with vaccinia virus IHD strain). Vaccinia virus strain IHD refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases, compared to) the activity, expression, cell targeting, or infectivity of the vaccinia virus strain IHD. Vaccinia virus strain IHD can be modified as described herein. In some embodiments, vaccinia virus strain IHD refers to the virus strain identified by ATCC reference number ATCC VR-156™, a variant thereof, or a homolog thereof.

[0028]

[0038] The term "Elstree vaccinia virus strain" is used according to its common and ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring Elstree vaccinia virus strains, or variants thereof, that maintain the activity of the Elstree vaccinia virus strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring Elstree vaccinia virus strains, or variants thereof, whose genomes share sequence identity with the Elstree vaccinia virus strain (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the Elstree vaccinia virus strain). The Elstree vaccinia virus strain refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases, compared to) the activity, expression, cell targeting, or infectivity of the Elstree vaccinia virus strain. The Elstree vaccinia virus strain can be modified as described herein. In some embodiments, the Elstree vaccinia virus strain refers to the virus strain identified by ATCC Reference Number ATCC VR-1549™, a variant thereof, or a homolog thereof.

[0029]

[0039] The term "vaccinia virus CL strain" is used according to its common and ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring vaccinia virus CL strains, or mutants thereof, that maintain the activity of the vaccinia virus CL strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring vaccinia virus CL strains, or mutants thereof, whose genomes share sequence identity with the vaccinia virus CL strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the vaccinia virus CL strain). A vaccinia virus CL strain refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases, compared to) the activity, expression, cell targeting, or infectivity of the vaccinia virus CL strain. Vaccinia virus CL strains can be modified as described herein. In some embodiments, a vaccinia virus CL strain refers to the virus strain identified by ATCC Reference Number ATCC VR-1774™, a variant thereof, or a homolog thereof.

[0030]

[0040] The term "vaccinia virus Lederle-Chorioallantoic strain" is used according to its common and ordinary meaning to refer to the same or similarly named virus strain, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring vaccinia virus Lederle-Chorioallantoic strain, or variants thereof, that retain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%) the activity of the vaccinia virus Lederle-Chorioallantoic strain. The term encompasses recombinant or naturally occurring vaccinia virus Lederle-Chorioallantoic strains, or variants thereof, whose genomes share sequence identity with the vaccinia virus Lederle-Chorioallantoic strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the vaccinia virus Lederle-Chorioallantoic strain). The vaccinia virus Lederle-Chorioallantoic strain refers to variants with mutated amino acids that modulate (e.g., increase or decrease compared to) the activity, expression, cell targeting, or infectivity of the vaccinia virus Lederle-Chorioallantoic strain. The vaccinia virus Lederle-Chorioallantoic strain can be modified as described herein. In some embodiments, vaccinia virus strain WR refers to the virus strain identified by ATCC reference number ATCC VR-118™, a variant or homolog thereof.

[0031]

[0041] The term "vaccinia virus AS strain" is used according to its common, ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring vaccinia virus AS strains or mutants thereof that maintain the activity of the vaccinia virus AS strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring vaccinia virus AS strains or mutants thereof, the genome of which shares sequence identity with the vaccinia virus AS strain genome (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the vaccinia virus WR strain). A vaccinia virus AS strain refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases, compared to) the activity, expression, cell targeting, or infectivity of the vaccinia virus AS strain. The vaccinia virus AS strain can be modified as described herein. In some embodiments, a vaccinia virus AS strain refers to a virus strain identified by ATCC reference number ATCC VR-2010™, a variant thereof, or a homolog thereof.

[0032]

[0042] The term "sheeppox virus strain NZ2" is used according to its common, ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring sheeppox virus strain NZ2 or mutants thereof that maintain the activity of the sheeppox virus strain NZ2 (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring sheeppox virus strain NZ2 or mutants thereof, whose genomes share sequence identity with the sheeppox virus strain NZ2 (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the vaccinia virus strain WR). Sheeppox virus strain NZ2 refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases, compared to) the activity, expression, cell targeting, or infectivity of the sheeppox virus strain NZ2. The sheeppox virus strain NZ2 can be modified as described herein. In some embodiments, sheeppox virus strain NZ2 refers to the virus strain identified by ATCC reference number ATCC VR-1548™, a variant thereof, or a homolog thereof.

[0033]

[0043] The term "pseudocowpox virus TJS strain" is used according to its common and ordinary meaning and refers to a virus strain of the same or a similar name, as well as functional fragments and homologs thereof. The term includes recombinant or naturally occurring pseudocowpox virus TJS strain or variants thereof that maintain the activity of the pseudocowpox virus TJS strain (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100%). The term also encompasses recombinant or naturally occurring pseudocowpox virus TJS strain or variants thereof, whose genomes share sequence identity with the pseudocowpox virus TJS strain (e.g., about 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identity with the vaccinia virus WR strain). A pseudocowpox virus TJS strain refers to a variant with a mutated amino acid that modulates (e.g., increases or decreases compared to) the activity, expression, cell targeting, or infectivity of the pseudocowpox virus TJS strain. The pseudocowpox virus TJS strain can be modified as described herein. In some embodiments, the pseudocowpox virus TJS strain refers to the virus strain identified by ATCC Reference Number ATCC VR-634™, a variant thereof, or a homolog thereof.

[0034]

[0044] In some embodiments, the cowpox virus Brighton strain is cowpox virus Brighton strain ATCC VR-302™. In some embodiments, the raccoon pox virus Herman strain is raccoon pox virus Herman strain ATCC VR-838™. In some embodiments, the rabbit pox virus Utrecht strain is rabbit pox virus Utrecht strain ATCC VR-1591™. In some embodiments, the vaccinia virus WR strain is vaccinia virus WR strain ATCC VR-1354™. In some embodiments, the vaccinia virus IHD strain is vaccinia virus IHD strain ATCC VR-156™. In some embodiments, the vaccinia virus Elstree strain is vaccinia virus Elstree strain ATCC VR-1549™. In some embodiments, the vaccinia virus CL strain is vaccinia virus CL strain ATCC VR-1774™. In some embodiments, the vaccinia virus Lederle-Chorioallantoic strain is vaccinia virus Lederle-Chorioallantoic strain ATCC VR-118™. In some embodiments, the vaccinia virus AS strain is vaccinia virus AS strain ATCC VR-2010™. In some embodiments, the sheeppox virus NZ2 strain is sheeppox virus NZ2 strain ATCC VR-1548™. In some embodiments, the pseudocowpox virus TJS strain is pseudocowpox virus TJS strain ATCC VR634™.

[0035] I. Chimeric Poxvirus Compositions

[0045] In one aspect, a chimeric poxvirus is provided that includes a nucleotide sequence having at least 70% (75%, 80%, 85%, 90%, 92%, 94%, 96%, 98%, or 99%) sequence identity to SEQ ID NO: 1 or SEQ ID NO: 2, and a nucleotide sequence encoding human CD19, or a portion thereof, capable of being expressed on a cell surface. In some embodiments, the sequence having at least 70% identity to SEQ ID NO: 1 or SEQ ID NO: 2 includes nucleotide sequences ("nucleic acid fragments") from at least two poxvirus strains selected from the group consisting of cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, vaccinia virus strain AS, sheep pox virus strain NZ2, and pseudocowpox virus strain TJS.

[0036]

[0046] The chimeric oncolytic poxviruses described herein contain a transgene encoding a truncated human CD19 (CD19t) that lacks a functional signaling domain but includes the extracellular and transmembrane domains, and has the following amino acid sequence, SEQ ID NO:C:

[0037] [ka] (or a sequence at least 95%, 97%, 98%, or 99% identical to the SEQ ID NO:). In some cases, the CD19t comprises or consists of amino acids 22 to 323 of SEQ ID NO: C. Amino acids 1 to 21 of SEQ ID NO: 3 are a signaling domain, which can be substituted with a different signaling domain. That is, the oncolytic virus comprises a sequence comprising a nucleotide sequence encoding a truncated human CD19 operably linked to an expression control sequence (e.g., an early promoter).

[0038]

[0047] In some embodiments, the nucleic acid fragment is derived from cowpox virus strain Brighton, raccoon poxvirus strain Herman, rabbit poxvirus strain Utrecht, vaccinia virus strain WR, vaccinia virus strain IHD, vaccinia virus strain Elstree, vaccinia virus strain CL, vaccinia virus strain Lederle-Chorioallantoic, and vaccinia virus strain AS.

[0039]

[0048] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the raccoon pox virus Herman strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the rabbit pox virus Utrecht strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the vaccinia virus WR strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the vaccinia virus IHD strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the vaccinia virus Elstree strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the vaccinia virus CL strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the cowpox virus Brighton strain and the vaccinia virus Lederle-Chorioallantoic strain. In some embodiments, the nucleic acid sequence comprises nucleic acid fragments from cowpox virus Brighton strain and vaccinia virus AS strain. In some embodiments, the nucleic acid sequence comprises nucleic acid fragments from cowpox virus Brighton strain and sheeppox virus NZ2 strain. In some embodiments, the nucleic acid sequence comprises nucleic acid fragments from cowpox virus Brighton strain and pseudocowpox virus TJS strain.

[0040]

[0049] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the vaccinia virus WR strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the vaccinia virus IHD strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the vaccinia virus Elstree strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the vaccinia virus CL strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the vaccinia virus Lederle-Chorioallantoic strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the vaccinia virus AS strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the rabbitpox virus Utrecht strain and the sheeppox virus NZ2 strain. In some embodiments, the nucleic acid sequences include nucleic acid fragments from rabbitpox virus strain Utrecht and pseudocowpox virus strain TJS.

[0041]

[0050] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the IHD strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the Elstree strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the CL strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the Lederle-Chorioallantoic strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the AS strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the NZ2 strain of sheeppox virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the WR strain of vaccinia virus and the TJS strain of pseudocowpox virus.

[0042]

[0051] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain IHD and vaccinia virus strain Elstree. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain IHD and vaccinia virus strain CL. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain IHD and vaccinia virus strain Lederle-Chorioallantoic. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain IHD and vaccinia virus strain AS. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain IHD and sheeppox virus strain NZ2. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain IHD and pseudocowpox virus strain TJS.

[0043]

[0052] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Elstree strain of vaccinia virus and the CL strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Elstree strain of vaccinia virus and the Lederle-Chorioallantoic strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Elstree strain of vaccinia virus and the AS strain of vaccinia virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Elstree strain of vaccinia virus and the NZ2 strain of sheeppox virus. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Elstree strain of vaccinia virus and the TJS strain of pseudocowpox virus.

[0044]

[0053] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain CL and vaccinia virus strain Lederle-Chorioallantoic. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain CL and vaccinia virus strain AS. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain CL and sheeppox virus strain NZ2. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from vaccinia virus strain CL and pseudocowpox virus strain TJS.

[0045]

[0054] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Lederle-Chorioallantoic vaccinia virus strain and the AS vaccinia virus strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Lederle-Chorioallantoic vaccinia virus strain and the NZ2 sheeppox virus strain. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the Lederle-Chorioallantoic vaccinia virus strain and the TJS pseudocowpox virus strain.

[0046]

[0055] In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the vaccinia virus strain AS and the sheep pox virus strain NZ2. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the vaccinia virus strain AS and the pseudocow pox virus strain TJS. In some embodiments, the nucleic acid sequence comprises a nucleic acid fragment from the sheep pox virus strain NZ2 and the pseudocow pox virus strain TJS.

[0047] II. CD19-targeting chimeric antigen receptor (CAR)

[0056] Various CD19 CARs have been reported, including those described in U.S. Patent No. 7,446,179 and Park et al. 2016 Blood 128:4035, and those described therein can be used. CD19 CARs include scFvs that bind to CD19, such as FMC63 (Zola et al. 1991 Immunol Cell Biol 69:411) or SJ25C1 (Bejcek et al. 1995 Cancer Research 55:2346), both of which are commercially available.

[0048]

[0057] Described herein are nucleic acid molecules encoding CARs, wherein the CARs comprise: a CD19-targeting scFv (e.g., as set forth below in SEQ ID NO: D);

[0049] [ka] a CD4 transmembrane domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted), a CD8 transmembrane domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted), a CD28 transmembrane domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted), a CD3 zeta transmembrane domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted); a costimulatory domain, e.g., a CD This includes a D28 costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted); a 4-1BB costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted); a CD28 costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted), and a 4-1BB costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted); and a CD3 zeta signaling domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted).

[0050]

[0058] In various embodiments, the costimulatory domain is selected from the group consisting of a CD28 costimulatory domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted), a 4-1BB costimulatory domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted), or an OX costimulatory domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted). In certain embodiments, a 4-1BB costimulatory domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted) is present. In some embodiments, two costimulatory domains are present, for example, a CD28 costimulatory domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted), and a 4-1BB costimulatory domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted). In various embodiments, the 1 to 5 (eg, 1 or 2) amino acid modifications are substitutions.

[0051]

[0059] In some cases, there is a short sequence of 1-6 amino acids (eg, GG G) between the costimulatory domain and the CD3 zeta signaling domain and / or between two costimulatory domains.

[0052]

[0060] In a further embodiment, the CAR comprises two different costimulatory domains selected from the group consisting of: a CD19-targeting scFv; a CD28 costimulatory domain or a variant thereof with 1 to 5 (e.g., 1 or 2) amino acid modifications; a 4-1BB costimulatory domain or a variant thereof with 1 to 5 (e.g., 1 or 2) amino acid modifications; an OX costimulatory domain or a variant thereof with 1 to 5 (e.g., 1 or 2) amino acid modifications; a CD28 costimulatory domain or a variant thereof with 1 to 2 amino acid modifications; a 4-1BB costimulatory domain or a variant thereof with 1 to 5 (e.g., 1 or 2) amino acid modifications; two different costimulatory domains selected from the group consisting of: a CD4 transmembrane domain or a variant thereof with one or two amino acid modifications, an OX costimulatory domain or a variant thereof with one or two amino acid modifications; a CD19scFv or a variant thereof with one or two amino acid modifications; a CD4 transmembrane domain or a variant thereof with one or two amino acid modifications, a CD8 transmembrane domain or a variant thereof with one or two amino acid modifications, a CD28 transmembrane domain or a variant thereof with one or two amino acid modifications, a CD3 zeta transmembrane domain or a variant thereof with one or two amino acid modifications. a transmembrane domain selected from a CD28 costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted); a 4-1BB costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted); or a CD28 costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted), and a 4-1BB costimulatory domain or a variant thereof in which 1 to 5 (e.g., 1 or 2) amino acids have been modified (e.g., substituted). a CD3 zeta signaling domain or a variant thereof having one or two amino acid modifications; a spacer region located between a CD19scFv or a variant thereof and a transmembrane domain (for example, the spacer region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 2 to 12 and 42 (Table 3), or a variant thereof having one to five (e.g., one or two) amino acid modifications); the spacer comprising an IgG hinge region; the spacer region comprising 1 to 150 amino acids; the absence of a spacer;The antibody comprises a 4-1BB signaling domain comprising the amino acid sequence of SEQ ID NO: 24, a CD3 zeta signaling domain comprising the amino acid sequence of SEQ ID NO: 21, and a linker of 3 to 15 amino acids located between the costimulatory domain and the CD3 zeta signaling domain or a variant thereof. In particular embodiments where there are two costimulatory domains, one is a 4-1BB costimulatory domain and the other is a costimulatory domain selected from CD28 and CD28gg. In some embodiments, the 1 to 5 (e.g., 1 or 2) amino acid modifications are substitutions, e.g., conservative substitutions.

[0053]

[0061] The disclosure herein also provides a population of human T cells transduced with a vector comprising an expression cassette encoding a chimeric antigen receptor, wherein the chimeric antigen receptor is selected from: a CD19-targeting scFv; a CD4 transmembrane domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); a CD8 transmembrane domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); a CD28 transmembrane domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); or a CD3 zeta transmembrane domain or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted). a transmembrane domain in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); a costimulatory domain, for example, a CD28 costimulatory domain, or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); a 4-1BB costimulatory domain, or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); or a CD28 costimulatory domain, or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted), and a 4-1BB costimulatory domain, or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted); and a CD3 zeta signaling domain, or a variant thereof in which one to five (e.g., one or two) amino acids have been modified (e.g., substituted). In various embodiments, the population of human T cells comprises central memory T cells (TCM cells), e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80% of the human T cells are TCM cells, or the population of T cells comprises central memory T cells, naive T cells, and stem central memory cells (TCM cells). CM / SCM / N cells), e.g., at least 20%, 30%, 40%, 50%, 60%, 70%, 80% of the T cells are T CM / SCM / NIn either case, the T cell population includes both CD4+ and CD8+ cells (e.g., at least 20% of the CD3+ T cells are CD4+, and at least 3% of the CD3+ T cells are CD8+, and at least 70, 80, or 90% are CD4+ or CD8+; at least 15%, 20%, 25%, 30%, 35%, 40%, 50%, or 60% of the CD3+ cells are CD4+, and at least 4%, 5%, 8%, 10%, or 20% of the CD3+ cells are CD8+ cells).

[0054]

[0062] Also described herein is a method of treating cancer in a patient, comprising administering to the patient a population of autologous or allogeneic human T cells (e.g., central memory T cells (TCM cells) or at least 20%, 30%, 40%, 50%, 60%, 70%, 80% of the cells are a combination of central memory T cells, naive T cells, and stem central memory cells (i.e., the T cells are T CM / SCM / N In either case, the population of T cells includes both CD4+ and CD8+ cells transduced with a vector containing an expression cassette encoding a chimeric antigen receptor (e.g., at least 20% of the CD3+ T cells are CD4+, and at least 3% of the CD3+ T cells are CD8+, and at least 70, 80, or 90% are CD4+ or CD8+; at least 15%, 20%, 25%, 30%, 35%, 40%, 50%, or 60% of the CD3+ cells are CD4+, and at least 4%, 5%, 8%, 10%, or 20% of the CD3+ cells are CD8+ cells).

[0055]

[0063] A CD19 CAR can include a spacer region located between the CD19 binding domain (e.g., CD19scFv) and the transmembrane domain. A variety of different spacers can be used. Some of these include at least a portion of a human Fc region, such as the hinge portion or CH3 domain of a human Fc region, or variants thereof. Table 1 below provides various spacers that can be used in the CARs described herein. Table 1: Examples of spacers

[0056] [Table 1]

[0064] Some spacer regions include all or part of an immunoglobulin (e.g., IgG1, IgG2, IgG3, IgG4) hinge region, i.e., the sequence between the CHI and CH2 domains of an immunoglobulin, e.g., an IgG4 Fe hinge or a CD8 hinge. Some spacer regions include both the CH3 and CH2 domains of an immunoglobulin, or the CH3 domain. The immunoglobulin-derived sequence can include one or more amino acid modifications, e.g., 1, 2, 3, 4, or 5 substitutions, e.g., substitutions that reduce off-target binding.

[0057]

[0065] "Amino acid modification" refers to the substitution, insertion, and / or deletion of an amino acid in a protein or peptide sequence, and "amino acid substitution" or "substitution" refers to the replacement of an amino acid at a particular position in a parent peptide or protein sequence with another amino acid. Substitutions can be made to change the amino acids in the resulting protein non-conservatively (i.e., by changing a codon from an amino acid belonging to a group of amino acids with a particular size or characteristics to an amino acid belonging to another group) or conservatively (i.e., by changing a codon from an amino acid belonging to a group of amino acids with a particular size or characteristics to an amino acid belonging to the same group). Such conservative changes generally result in less change in the structure and function of the resulting protein. The following are examples of various amino acid groupings: 1) amino acids with a nonpolar R group: alanine, valine, leucine, isoleucine, proline, phenylalanine, tryptophan, methionine; 2) amino acids with an uncharged polar R group: glycine, serine, threonine, cysteine, tyrosine, asparagine, glutamine; 3) amino acids with a charged polar R group (negatively charged at pH 6.0): aspartic acid, glutamic acid; (4) basic amino acids (positively charged at pH 6.0): lysine, arginine, histidine (pH 6.0). Another grouping may be amino acids with a phenyl group: phenylalanine, tryptophan, and tyrosine.

[0058]

[0066] As discussed herein, the numbering for amino acid positions in immunoglobulins is according to the EU index, or EU numbering scheme (Kabat et al. 1991 Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda). The EU index, or EU index as described in Kabat's reference, or EU numbering scheme, refers to the numbering of EU antibodies (Edelman et al. 1969 Proc Natl Acad Sci USA 63:78-85).

[0059]

[0067] A variety of transmembrane domains can be used. Examples of suitable transmembrane domains are listed in Table 2. When a spacer domain is present, the transmembrane domain is located carboxy-terminal to the spacer domain.

[0060] Table 2: Examples of transmembrane domains

[0061] [Table 2]

[0068] Many of the CARs described herein include one or more (e.g., two) costimulatory domains located between the transmembrane domain and the CD3 zeta signaling domain. Table 3 lists suitable costimulatory domain and CD3 zeta signaling domain sequences.

[0062] Table 3: Examples of CD3 zeta domains and costimulatory domains

[0063] [Table 3] [Example]

[0064] Novel and potent chimeric poxviruses for oncolytic immunotherapy of cancer

[0069] The following describes an oncolytic anchor chimeric poxvirus that can be used to prepare a recombinant chimeric poxvirus that expresses human CD19 in cells infected with the recombinant virus. The recombinant virus infects cancer cells and expresses CD19. The infected cells can then be targeted by a CD19-directed CAR.

[0065]

[0070] Chimeric poxviruses, used to generate recombinant poxviruses, can combine favorable characteristics from different viral species and therefore are superior to individual wild-type viruses. Orthopoxviruses and parapoxviruses are antigenically distinct, and the potent chimeric orthopoxviruses and chimeric parapoxviruses generated in this study may achieve maximum therapeutic efficacy when combined in the same treatment regimen. As described in detail in International Patent Application No. PCT / US2017 / 46163, filed August 9, 2017, chimeric poxviruses, including isolates #33 (SEQ ID NO: 1) and #189 (SEQ ID NO: 2), were generated from pools of chimeric orthopoxviruses and chimeric parapoxviruses. The killing ability of several chimeric orthopoxvirus and parapoxvirus isolates, including isolates #33 and #189, was superior to that of their respective parent wild-type viruses in a panel of NCI60 cancer cell lines.

[0066]

[0071] Generation of chimeric virus pools and isolation of individual chimeric viruses A chimeric orthopoxvirus pool was generated by coinfecting CV-1 cells with cowpox virus Brighton strain, raccoonpox virus Herman strain, rabbitpox virus Utrecht strain, vaccinia virus IHD strain, vaccinia virus Elstree strain CL, Lederle-Chorioallantoic strain, and vaccinia virus AS strain at a multiplicity of infection (MOI) of 0.01 for each virus. A chimeric parapoxvirus pool was generated by coinfecting MDBK cells with sheeppox virus NZ2 strain and pseudocowpox virus TJS strain at an MOI of 0.1. Our pilot experiments demonstrated that CV-1 cells were susceptible to all orthopoxviruses used in this experiment, and that both sheeppox virus and pseudocowpox virus infected MDBK cells and formed plaques.

[0067]

[0072] One hundred chimeric orthopoxvirus plaques and one hundred chimeric parapoxvirus plaques were collected from CV-1 cells infected with the chimeric orthopoxvirus pool and from MDBK cells infected with the chimeric parapoxvirus pool, respectively. These 200 plaques were further plaque-purified twice on each cell line to obtain 200 clonally purified individual chimeric virus isolates. Virus isolate #14-113 is a chimeric orthopoxvirus isolate, and virus isolate #114-213 is a chimeric parapoxvirus isolate.

[0068]

[0073] Identification of novel potent chimeric poxvirus isolates by high-throughput screening in the NCI-60 cell line The tumor cell killing activities of 200 chimeric orthopoxvirus and 200 chimeric parapoxvirus strains, as well as 11 parental virus strains and two control oncolytic viruses (GLV-1h68 and OncoVEX GFP), were evaluated and compared in a panel of NCI-60 cell lines (Table 4). GLV-1h68 is one of the most well-studied oncolytic vaccinia viruses and is currently in clinical development. OncoVEX GFP is an oncolytic herpes simplex virus type 1 with the same backbone as T-VEC, the first FDA-approved oncolytic virus. Each cell line was infected with each virus at an MOI of 0.01. Cell viability 96 hours postinfection was measured using the MTS assay. The virus dose used in this high-throughput screening experiment (MOI 0.01) was intentionally low and optimized to highlight potent novel virus isolates, and cell killing was compared in adherent cell lines (the majority of cell lines in the NCI-60 panel are adherent). However, this virus dose was too low to observe significant and consistent cell killing in suspension cell lines. Therefore, results from the six leukemia cell lines were not included in the virus comparison analysis.

[0069]

[0074] Table 4. Catalog of NCI-60 cell lines

[0070] [Table 4] TIFF2026012184000007.tif230152TIFF2026012184000008.tif75155

[0075] Among the 100 novel chimeric orthopoxvirus isolates, isolates #17 (SEQ ID NO: 3) and #33 (SEQ ID NO: 1) exhibited significantly superior cell killing abilities to nine parental orthopoxvirus strains and two control viruses in NCI-60 solid tumor cell lines (Figure 1). Among the 100 novel parapoxvirus isolates, isolate #189 (SEQ ID NO: 2) exhibited remarkable cell killing abilities, significantly superior to those of the two parental parapoxvirus strains and the control viruses (Figure 2). All three novel chimeric virus isolates (#17, #33, and #189) induced significant cell death in the majority of NCI-60 solid tumor cell lines, even at an MOI as low as 0.01. In general, orthopoxvirus strains and chimeric orthopoxvirus strains had stronger cancer cell-killing effects than parapoxvirus strains and chimeric parapoxvirus strains at a low MOI of 0.01.

[0071]

[0076] Genomic DNA of the novel poxvirus isolates #33 and #189 was isolated from purified virions and subjected to next-generation sequencing at over 1000x coverage using an Illumina Hiseq 2500. Gap sequences were PCR-amplified and sequenced by Sanger sequencing. 189,415 base pairs (bps) of the #33 genome were fully sequenced, while 138,203 bps were obtained for the #189 genome. Initial BLAST searches against GenBank showed that the #33 and #189 genome sequences were not identical to any genome sequences in GenBank. #33 is closest to vaccinia virus strains among orthopoxvirus strains. #189 is most closely related to the sheeppox virus NZ2 strain, one of its parent parapoxviruses. The nucleotide sequences of all ORFs identified in the sheeppox virus NZ2 strain are identical to those of #189. Compared to the sheeppox virus NZ2 strain, #189 has a single "G" insertion at position 6755 in its genome. One copy of a repeat element has been deleted from the inverted terminal repeat region, and one copy of another repeat element has been inserted into the #189 genome. Overall, both #33 and #189 are novel and unique poxvirus isolates.

[0072]

[0077] All cancer cell lines were grown in RPMI-1640 (Mediatech, Manassas, VA). African green monkey kidney fibroblasts (CV-1) and bovine kidney epithelial cells (MDBK) were obtained from the American Type Culture Collection (ATCC; Rockville, MD, USA) and grown in DMEM (Mediatech, Manassas, VA). All media were supplemented with 10% FBS (Mediatech, Manassas, VA) and 1% penicillin-streptomycin solution (Mediatech, Manassas, VA). Cells were cultured at 37°C under 5% CO₂.

[0073]

[0078] virusCowpox virus Brighton strain, raccoonpox virus Herman strain, rabbitpox virus Utrecht strain, vaccinia virus WR strain, vaccinia virus IHD strain, vaccinia virus Elstree strain, CL strain, Lederle-Chorioallantoic strain, and vaccinia virus AS strain, sheeppox virus NZ2 strain, and pseudocowpox virus TJS strain were purchased from ATCC. All orthopoxvirus strains were grown and titrated in CV-1 cells. Parapoxvirus strains were grown and titrated in MDBK cells.

[0074]

[0079] Generation of pools of chimeric orthopoxviruses and chimeric parapoxviruses and isolation of individual clonal chimeric virus isolates A chimeric orthopoxvirus pool was generated by coinfecting CV-1 cells with cowpox virus Brighton strain, raccoonpox virus Herman strain, rabbitpox virus Utrecht strain, vaccinia virus WR strain, vaccinia virus IHD strain, Elstree strain, CL strain, Lederle-Chorioallantoic strain, and vaccinia virus AS strain at a multiplicity of infection (MOI) of 0.01 per virus. A chimeric parapoxvirus pool was generated by coinfecting MDBK cells with sheeppox virus NZ2 strain and pseudocowpox virus TJS strain at an MOI of 0.1. Infected cells were harvested 3 days postinfection. The initial chimeric orthopoxvirus pool was further passaged three times in CV-1 cells at an MOI of 0.1, and the initial chimeric parapoxvirus pool was further passaged three times in MDBK cells at an MOI of 0.1. The cells were further passaged three times. 100 chimeric orthopoxvirus plaques were picked from CV-1 cells infected with the final chimeric orthopoxvirus pool, and 100 chimeric parapoxvirus plaques were picked from MDBK cells infected with the final chimeric parapoxvirus pool. The 200 plaques were plaque-purified twice more on each cell line, yielding 200 clonally purified chimeric virus isolates each.

[0075]

[0080] NCI-60 cancer cell line and a panel of pancreatic cancer cell lines, including PANC1, MIA PaCa-2, BxPC3, FG, Capan-2, and Su.86.86, were aliquoted into 96-well plates (solid tumor cell lines at 3,000 cells / well, leukemia cell lines at 5,000 cells / well) using an epMotion 5075 liquid handler (Eppendorf) under sterile conditions and incubated overnight at 37°C under 5% (v / v) CO2. Cells were then co-infected with 200 chimeric orthopoxvirus and chimeric parapoxvirus isolates, 11 parental viruses, and the control oncolytic viruses GLV-1h68 and OncoVEX GFP2 at an MOI of 0.01. Cell viability was measured 96 hours post-infection using the MTS assay (Promega). The absorbance at 490 nm was measured using an automated BMG PHERASTA plate reader (BMG Labtech). Each experiment was performed in duplicate. The cell viability of mock-infected cells was set at 100%.

[0076]

[0081] MK-45, OCUM-2M, and KATO-3 cells were seeded into 96-well plates at a density of 3,000 cells per well and incubated overnight at 37°C under 5% (v / v) CO2. Cells were infected with #33, #189, GLV-1h68, and OncoVEX GFP at MOIs of 0.01, 0.1, and 1. Cell viability was monitored daily for 4 days using the MTS assay at 37°C under 5% (v / v) CO2.

[0077]

[0082] Genomic DNA of #33 and #189 was extracted from purified virions using the Wizard Genomic DNA Purification Kit (Promega) and fragmented by sonication. Library preparation was performed using the KAPA LTP Library Preparation Kit. Sequencing was performed on an Illumina Hiseq 2500. [Example]

[0078] High-throughput screening of pancreatic cancer cell lines

[0083] The NCI-60 cancer cell lines include only solid tumors derived from eight different organs (see Table 4). To verify whether the results obtained with the NCI-60 cancer cell lines could be replicated in solid tumors from other organs, six pancreatic cancer cell lines (BxPC3, FG, MIA PaCa-2, Capan-2, PANC-1, and SU.86.86) were infected with the same viruses used in the high-throughput screening of the NCI-60 cancer cell lines at an MOI of 0.1. Cell viability was measured again 96 hours after infection using the MTS assay. Among all chimeric orthopoxvirus isolates, chimeric orthopoxvirus isolates #17 and #33 had the best cell killing ability, and chimeric parapoxvirus isolate #189 had the best cell killing ability among all chimeric parapoxvirus isolates. As shown in Table 5, Figures 3 and 4, they were all superior to the parent virus strains, as well as the control viruses GLV-1h68 and OncoVEX GFP in killing the pancreatic cancer cell lines. In other words, the results obtained with the NCI-60 cancer cell line were highly reproducible in the panel of pancreatic cancer cell lines. Table 5: Pancreatic cancer cell survival

[0079] [Table 5] [Example]

[0080] Novel chimeric orthopoxvirus isolates #33 and #189 exhibit potent cell killing activity in gastric cancer cell lines

[0084] Based on the results of high-throughput screening of NCI-60 cancer cell lines and a panel of pancreatic cancer cell lines, novel chimeric orthopoxvirus isolates #33 and #189 were selected for further characterization. The tumor cell killing activities of isolates #33 and #189 were further examined in three gastric cancer cell lines. MKN-45, OCUM-2M, and KATO-3 cells were infected with #33, #189, GLV-1h68, and OncoVEX GFP at MOIs of 0.01, 0.1, and 1. Cell viability was monitored daily for 4 days using the MTS assay. MKN-45 and OCUM-2M cell lines were most sensitive to #33, intermediately sensitive to OncoVEX GFP, and least sensitive to GLV-1h68. On the other hand, KATO-3 cells were most sensitive to OncoVEX GFP at a low MOI of 0.01, whereas #33, #189, and OncoVEX GFP equally killed KATO-3 cells at high MOIs (0.1 and 1). KATO-3 cells were least sensitive to GLV-1h68. Overall, #33 most efficiently killed gastric cancer cell lines, whereas GLV-1h68 had the lowest killing ability (Figure 5A-C).

[0081]

[0085] The 90 genes present in all sequenced ChPVs are listed with their known functions, as shown in Table 6 (abbreviations: IMV: intracellular mature virus; IEV: intracellular enveloped virus; EEV: extracellular enveloped virus). Genes are named after their corresponding genes in VACV-COP. An asterisk * indicates a gene that is also present in the two EnPVs. Table 3 is adapted from Gubser et al. (Gubser, C, Hue, S., Kellam, P., and Smith, GL (2004). Poxvirus genomes: a phylogenetic analysis. J Gen Virol 85, 105-117), which is incorporated herein by reference in its entirety for all purposes.

[0082]

[0086] Table 6. Chordopoxvirus Minimal Gene Complement

[0083] [Table 6]

[0084] [Table 7] [Example]

[0085] Construction of recombinant chimeric poxviruses Construction of a shuttle vector for inserting foreign gene expression cassettes into the #33 chimeric poxvirus genome

[0087] To construct the thymidine kinase (TK) shuttle vector, Q5 High-Fidelity 2X Master Mix (New England Biolabs, Ipswich, MA) and the following primers:

[0086] [ka] The left and right flanking sequences of the 7XT gene of the #33 chimeric poxvirus were amplified by PCR from #33 genomic DNA using the PCR product. The two fragments were ligated using the overlapping extension gene splicing method. The resulting fragment was digested with Ndel and EcoRI and cloned into the identically cut plasmid pGPT to obtain p33NC-TK. The flanking sequences of TK in the shuttle vector were confirmed by sequencing. p33NC-TK contains the left and right flanking sequences of TK separated by Sacl, Sail, BamHI, Nhel, and Notl, as well as the Escherichia coli guanine phosphoribosyltransferase (gpt) gene driven by the vaccinia virus (VACV) early promoter p7.5E as a transient dominant selectable marker.

[0087]

[0088] The F14.5L shuttle vector was constructed in the same manner. The left and right flanking sequences of the F14.5L gene of the #33 chimeric poxvirus were amplified using Q5 High-Fidelity 2X Master Mix (New England Biolabs, Ipswich, MA) and the following primers:

[0088] [ka] The F14.5L fragment was amplified by PCR from #33 genomic DNA using the VACV early promoter p7.5E. The two fragments were ligated using the gene splicing method by overlapping extension. The resulting fragment was digested with Ndel and EcoRI and cloned into the identically cut plasmid pGPT to obtain p33NC-F14.5L. The flanking sequences of F14.5L in the shuttle vector were confirmed by sequencing. p33NC-F14.5L contains the left and right flanking sequences of F14.5L separated by Hind11, Sacl, Xhol, BamHI, Nhel, and Notl, as well as the E. coli gpt gene driven by the VACV early promoter p7.5E as a transient dominant selectable marker. [Example]

[0089] Recombinant chimeric poxviruses expressing CD19t provide a target for CD19-targeting CARs In the following experiments, two breast cancer cell lines were used: MDA-MB-468wt (a triple-negative breast cancer cell line), the parental line, and a variant of MDA-MB-468 engineered to express a truncated human CD19 lacking the signaling domain (MDA-MB-468-CD19t). As shown in Figure 6, MDA-MB-468-CD19t expresses CD19t. T cells engineered to express a CAR targeting CD19 (described in more detail below) were also used. The CAR expressed by these T cells, shown schematically in Figure 7, contains a CD19-targeting scFv and an IgG4 spacer, a CD28 transmembrane domain, a CD28 costimulatory domain, and CD3 zeta. Sequences encoding this CAR and a truncated EGFR were inserted into a lentiviral vector, and this recombinant vector was used to transduce PBMCs. The truncated EGFR can be used as a marker for CAR expression. As shown in Figure 8, comparison of EGFR expression by mock-transformed PBMCs and PBMCs transfected with recombinant lentivirus expressing CD19 CAR with truncated EGFR indicates that the transfected cells efficiently express the transgene.

[0090] Chimeric poxvirus #33 was engineered to express a truncated CD19 recombinant oncolytic virus (33-CD19t). MDA-MB-48 tumor cells, which do not express CD19, were exposed to the recombinant oncolytic virus 33-CD19t and mock-transformed T cells at different MOIs. As shown in the upper panel of Figure 9, increasing the level of the recombinant oncolytic virus 33-CD19t resulted in increased CD19 expression and decreased cell counts. The lower panel of Figure 9 shows the results of exposing MDA-MB-48 tumor cells to the recombinant oncolytic virus 33-CD19t and transformed T cells expressing a CD19-targeted CAR at different MOIs. It is clear that the number of MDA-MB-468 cells expressing CD19t was significantly reduced.

[0091] 10 shows the results of an experiment measuring the levels of IL-2 (bottom panel) and IFN-γ (top panel) in a long-term killing assay. In this experiment, MDA-MB-468 cells were exposed to recombinant oncolytic virus 33-CD19t alone; recombinant oncolytic virus 33CD19t and mock-transformed T cells; or recombinant oncolytic virus 33-CD19t and transformed T cells expressing a CD19-targeted CAR.

[0092] 11 shows a series of images of cell cultures obtained in a cell killing assay. In this experiment, MDA-MB-468 cells were exposed to recombinant oncolytic virus 33-CD19t at an MOI of 1 in the presence of mock-transformed T cells or transformed T cells expressing a CD19-targeted CAR. The top of the image shows either MDA-MB-468 cells cultured in the absence of recombinant oncolytic virus 33-CD19t or transformed T cells expressing a CD19-targeted CAR.

[0093] 12 shows the results of a long-term cell killing assay in which MDA-MB-468 cells or MMDA-MB-231 cells were cultured with recombinant oncolytic virus 33-CD19t alone (at different MOIs); recombinant oncolytic virus 33-CD19t (at different MOIs) and mock-transformed T cells; or recombinant oncolytic virus 33-CD19t (at different MOIs) and transformed T cells expressing a CD19-targeted CAR. Tumor cell killing and CD19t expression were measured.

[0094]

[0094] Overall, the experiments in this example demonstrated that 1) CD19t expression in MDA-MB-48 cells exposed to recombinant oncolytic virus 33-CD19t increases with increasing MOI; 2) T cells from MDA-MB-48 cells exposed to recombinant oncolytic virus 33-CD19t in the presence of CD19-CAR T cells produce increased levels of IL-2 and IFN-γ with increasing MOI; and 3) CD19 CAR T cells are efficacious in MDA-MB-48 cells exposed to recombinant oncolytic virus 33-CD191. [Example]

[0095] A recombinant chimeric poxvirus expressing CD19t is effective in TNBC xenograft models when combined with a CD19 CAR As shown in Figure 13, oncolytic viruses can effectively deliver CD19t to solid tumors and activate CD19-CAR T cells in vitro. Figure 13, panel A, is a schematic diagram of vaccinia oncolytic virus [CF33-(SE)hCD19t], showing the incorporation of a truncated human CD19 (CD19t) under the control of a synthetic early promoter (PSE) inserted into the J2R locus, replacing the thymidine kinase gene. Figure 13, panel B, shows immunofluorescence microscopy of MDAMB-468 cells infected with OV19t at an MOI of 0.025 (left) and an MOI of 1 (center) for 24 hours, or cells transduced with lentivirus to stably express CD19t (right). Image magnification is 10x, and inset magnification is 40x. Figure 13, panel C, is a set of FACS plots showing cell surface expression of CD19t on MDA-MB468 tumor cells and intracellular expression of vaccinia virus, as measured by flow cytometry, 24 hours after infection with OV19t at increasing MOIs. Figure 13, panel D, shows quantification of CD19t (left), vaccinia (center), and viability (right) of MDA-MB-468 tumor cells 24, 48, and 72 hours after co-culture with OV19t at the indicated MOI. Panel E shows quantification of CD25 (left) and CD137 (right) expression 24 hours after co-culture of mock (untransduced) or CD19-CAR T cells with tumor cells at an effector:tumor (E:T) ratio of 1:2, with or without treatment with OV19t at the indicated MOI.

[0096] As shown in Figure 14, the OV19t oncolytic virus can drive CD19t expression on tumor cells, which redirects CD19-CAR T cell activation and cytotoxicity in vitro. Figure 14, panel A, shows the CD8 T cell proliferation and cytotoxicity after 16 hours of co-culture with MDA-MB-468 tumor cells at an E:T ratio of 1:1, with or without OV19t treatment at the indicated MOI. + CAR +Representative flow cytometry analysis showing cell surface CD107a (left) and intracellular IFNy expression (right) in T cells. Figure 14, panel B, shows IFNy production measured by ELISA in supernatants collected 24, 48, and 72 hours after co-culture with or without treatment with OV19t at the indicated MOI. Figure 14, panel C, shows a tumor killing assay assessed by flow cytometry comparing mock or CD19-CAR T cells 24, 48, or 72 hours after co-culture with MDAMB-468 tumor cells with or without treatment with OV19t at the indicated MOI. Figure 14, panel D, shows CD19t expression on tumor cells in the killing assay described in panel C, and panel D shows virus titers in supernatants collected from co-cultures of tumor cells and T cells treated with OV19t at the indicated MOI.

[0097] As shown in Figure 15, the combination therapy of OV19t and CD19-CAR T cells demonstrated efficacy in a TNBC xenograft model. Figure 15, panel A, shows mice receiving subcutaneous MDA-MB-468 tumors (5x10 6 Cells) were engrafted at 0, 10 5 , 10 6 , or 10 7 Plaque-forming units (pfu) were intratumorally administered to tumors, which were harvested on days 3 (left), 7 (center), or 10 (right) after treatment, and CD19t expression was quantified by flow cytometry. (+) indicates MDA-MB-468 tumors previously transduced with lentivirus to stably express CD191. Figure 15, panel B, shows MDA-MB468 tumors (5x10) subcutaneously injected on day 0. 6 NSG mice with OV19t (10 7 pfu), tumor volume (mm 3 On day 46, mice were treated with either Mock or CD19-CAR T cells (5x10 6 Figure 15, panel C, shows the mean tumor volume at day 73 in the in vivo experiment described in panel B. Figure 15, panel D, is a schematic illustrating the concept of combination therapy utilizing OV to deliver CAR targets to refractory solid tumors.

Claims

1. A recombinant oncolytic virus comprising a nucleotide sequence encoding a truncated human CD19 lacking a functional signaling domain, wherein the nucleotide sequence encoding the truncated human CD19 is operably linked to a promoter, and the recombinant oncolytic virus comprises a nucleotide sequence that is at least 97% identical to SEQ ID NO: 1, but lacks all or part of the sequence encoding thymidine kinase.

2. A recombinant oncolytic virus as described in claim 1, wherein the nucleotide sequence of the remaining part of the recombinant oncolytic virus comprises a nucleotide sequence that is at least 98% identical to SEQ ID NO: 1, but all or part of the sequence encoding thymidine kinase is missing.

3. The recombinant oncolytic virus of claim 1 , wherein the promoter is a viral early promoter.

4. 2. The recombinant oncolytic virus of claim 1, wherein the promoter is a poxvirus early promoter.

5. The truncated human CD19 lacking a functional signaling domain has the following structure: EPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYL CQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPP CVPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLL LPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKR The recombinant oncolytic virus of claim 1, comprising an amino acid sequence represented by:

6. The truncated human CD19 lacking a functional signaling domain has the following structure: MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAI WLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAK DRPEIWEGEPPCVPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDDMWVM ETGLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKR The recombinant oncolytic virus of claim 1, comprising an amino acid sequence represented by:

7. 10. A pharmaceutical composition for treating a cancer patient, comprising the recombinant oncolytic virus of any one of claims 1 and 3 to 6, wherein a population of T cells expressing a chimeric antigen receptor (CAR) that targets human CD19 is administered to the patient simultaneously or subsequently.

8. 8. The pharmaceutical composition of claim 7, wherein the T cell population comprises T cells transduced with a lentiviral vector encoding the CAR.

9. 8. The pharmaceutical composition of claim 7, wherein the T cell population comprises T cells transformed with an RNA molecule encoding the CAR.

10. 8. The pharmaceutical composition of claim 7, wherein the population of T cells is administered 1 to 20 days after administration of the recombinant oncolytic virus.

11. 8. The pharmaceutical composition of claim 7, wherein the population of T cells is administered 5 to 100 days after administration of the recombinant oncolytic virus.

12. The pharmaceutical composition according to claim 7, wherein the cancer is a solid tumor.

13. The pharmaceutical composition according to claim 12, wherein the solid tumor is ovarian cancer, breast cancer, or pancreatic cancer.

14. CAR has the following amino acid sequence: Asp Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Lys Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile Tyr His Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Thr Gly Ser Thr Ser Gly Ser Gly Lys Pro Gly Ser Gly Glu Gly Ser Thr Lys Gly Glu Val Lys Leu Gln Glu Ser Gly Pro Gly Leu Val Ala Pro Ser Gln Ser Leu Ser Val Thr Cys Thr Val Ser Gly Val Ser Leu Pro Asp Tyr Gly Val Ser Trp Ile Arg Gln Pro Pro Arg Lys Gly Leu Glu Trp Leu Gly Val Ile Trp Gly Ser Glu Thr Thr Tyr Tyr Asn Ser Ala Leu Lys Ser Arg Leu Thr Ile Ile Lys Asp Asn Ser Lys Ser Gln Val Phe Leu Lys Met Asn Ser Leu Gln Thr Asp Asp Thr Ala Ile Tyr Tyr Cys Ala Lys His Tyr Tyr Tyr Gly Gly Ser Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Ser Val Thr Val Ser Ser 8. The pharmaceutical composition of claim 7, comprising an scFv comprising:

15. CAR is: scFv targeting human CD19; a transmembrane domain selected from a CD4 transmembrane domain, a CD8 transmembrane domain, a CD28 transmembrane domain, and a CD3 zeta transmembrane domain; a costimulatory domain selected from a CD28 costimulatory domain and a 4-1BB costimulatory domain; and CD3 zeta signaling domain; 8. The pharmaceutical composition of claim 7, comprising:

Citation Information

Patent Citations

  • Combination of oncolytic virus with immune checkpoint modulators

    WO2016009017A1

  • Targeted cancer therapy

    WO2017075440A1