Chimeric antigen receptor factory and methods of use thereof

Abstract

The present invention is directed to chimeric antigen receptors and cells containing same, which further secrete monoclonal antibodies locally at the tumor site.

Description

[Technical field]

[0001] This application claims priority from U.S. Provisional Application No. 62 / 773,885, filed November 30, 2018, and U.S. Provisional Application No. 62 / 826,462, filed March 29, 2019, the entire contents of each of which are incorporated herein by reference.

[0002] All patents, patent applications, and publications cited herein are hereby incorporated by reference in their entirety. The disclosures of these publications are incorporated by reference into this application in order to more fully describe the state of the art known to those skilled in the art as of the date of the invention described and claimed herein.

[0003] This patent disclosure contains material that is subject to copyright protection. The copyright owner has no objection to the facsimile reproduction of either the patent document or the patent disclosure, as it appears in the U.S. Patent and Trademark Office patent files or records, but otherwise reserves all copyright rights whatsoever.

[0004] Incorporation by reference of sequence listing The contents of the text file named “[ ]” created at [ ] is hereby incorporated by reference in its entirety.

[0005] FIELD OF THEINVENTION The present invention is directed to chimeric antigen receptors and cells containing same, which further secrete monoclonal antibodies locally at the tumor site. [Background technology]

[0006] 2. Background of the Invention Clear cell renal cell carcinoma (ccRCC) is the main type of RCC and is one of the 10 most common cancers in both men and women. Other types of renal cancer include papillary renal cell carcinoma, pigmented renal cell carcinoma, and other or unclassified types of renal cell carcinoma. See, for example, Lancet 373 (2009) 1119-32 (Non-Patent Document 1). [Prior art documents] [Non-patent literature]

[0007] [Non-Patent Document 1] Lancet 373(2009)1119-32 Summary of the Invention

[0008] Other objects and advantages of the present invention will become readily apparent from the following description.

[0009] Aspects of the present invention are directed to engineered cells comprising a chimeric antigen receptor. In embodiments, the chimeric antigen receptor comprises an extracellular ligand binding domain specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70.

[0010] In embodiments, the CAR further comprises a transmembrane polypeptide, an intracellular signaling domain, and / or a costimulatory domain.

[0011] In an embodiment, the extracellular ligand binding domain comprises an antibody or a fragment thereof. For example, the antibody comprises a VH and / or VL according to Table 2, or any combination thereof. For example, the antibody comprises a VH and / or VL according to Table 4, or any combination thereof. For example, the extracellular binding domain comprises a VH and / or VL of Table 2 and Table 4, or any combination thereof. For example, the antibody comprises a CDR1, CDR2, and / or CDR3 of Table 1, or any combination thereof. For example, the antibody comprises a CDR1, CDR2, and / or CDR3 of Table 3, or any combination thereof. For example, the extracellular binding domain comprises a CDR1, CDR2, and / or CDR3 of Table 1 and Table 3, or any combination thereof.

[0012] In embodiments, the engineered cells express and secrete the recombinant polypeptide.

[0013] In an embodiment, the recombinant polypeptide comprises an antibody or a fragment thereof, or a cytokine. For example, the recombinant polypeptide comprises an antibody or a fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4. For example, the recombinant polypeptide comprises a cytokine comprising IL-12, IL-15, or IL-18.

[0014] In embodiments, the recombinant polypeptide modulates the immune system of a subject, e.g., the recombinant polypeptide is an immune checkpoint blockade antibody.

[0015] In embodiments, the recombinant polypeptide modulates tumor angiogenesis. For example, the recombinant polypeptide can be specific for VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1.

[0016] In an embodiment, the engineered cell is a T cell, a NK cell, or a NKT cell.For example, the T cell is a CD4+, a CD8+, a CD3+panT cell, or any combination thereof.For example, the T cell is a mixed population of CD4+T cell and CD8+T cell.

[0017] Aspects of the present disclosure are further directed to a nucleic acid construct encoding a chimeric antigen receptor. In embodiments, the chimeric antigen receptor comprises an extracellular ligand-binding domain specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70.

[0018] In embodiments, the nucleic acid construct further encodes a transmembrane polypeptide, an intracellular signaling domain, and / or a costimulatory domain.

[0019] In embodiments, the nucleic acid construct further encodes a recombinant polypeptide.

[0020] Aspects of the present disclosure are further directed to vectors comprising the nucleic acid constructs described herein.

[0021] Additionally, aspects of the present disclosure are directed to cells comprising the vectors described herein.

[0022] Aspects of the present disclosure are also directed to a method for treating a subject suffering from cancer, in embodiments, the method comprises administering to the subject a therapeutically effective amount of the engineered cells described herein.

[0023] Aspects of the invention are also directed to methods of reducing the progression of or promoting the regression of cancer in a subject, in embodiments, the methods comprise administering to the subject a therapeutically effective amount of the engineered cells described herein.

[0024] Additionally, aspects of the invention are directed to a method of reducing cell proliferation of cancer cells in a subject, in embodiments, the method comprises administering to the subject a therapeutically effective amount of the engineered cells described herein.

[0025] In embodiments, the cancer comprises renal cell carcinoma.

[0026] An embodiment of the present disclosure is directed to a chimeric antigen receptor (CAR) comprising an extracellular ligand binding domain, the extracellular ligand binding domain being specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70.

[0027] In embodiments, the CAR further comprises a transmembrane polypeptide, an intracellular signaling domain, and / or a costimulatory domain.

[0028] In embodiments, the extracellular ligand binding domain comprises an antibody or a fragment thereof.

[0029] Additionally, aspects of the present invention are directed to cells comprising the chimeric antigen receptors (CARs) described herein.

[0030] Further aspects of the present invention are directed to an engineered cell comprising a first chimeric antigen receptor and a second chimeric antigen receptor, wherein the first chimeric antigen receptor comprises an extracellular ligand binding domain specific for CAIX and the second chimeric antigen receptor comprises an extracellular ligand binding domain specific for CD70.

[0031] In embodiments, the engineered cells express and secrete the recombinant polypeptide.

[0032] In embodiments, the first chimeric antigen receptor and the second chimeric antigen receptor are expressed from a single nucleic acid construct. [The present invention 1001] An engineered cell comprising a chimeric antigen receptor, the chimeric antigen receptor comprising an extracellular ligand binding domain specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70. [The present invention 1002] The engineered cell of claim 1001, wherein the CAR further comprises a transmembrane polypeptide and an intracellular signaling domain. [The present invention 1003] The engineered cell of claim 1002, wherein the CAR further comprises a costimulatory domain. [The present invention 1004] 1001. The engineered cell of claim 1001, wherein said extracellular ligand binding domain comprises an antibody or a fragment thereof. [The present invention 1005] The engineered cell of the present invention 1004, wherein said antibody comprises a VH and / or VL according to Table 2, or any combination thereof. [The present invention 1006] The engineered cell of the present invention 1004, wherein said antibody comprises a VH and / or VL according to Table 4, or any combination thereof. [The present invention 1007] 1005. The engineered cell of the present invention, wherein said extracellular binding domain comprises a VH and / or VL of Table 2 and Table 4, or any combination thereof. [The present invention 1008] The engineered cell of the present invention 1004, wherein said antibody comprises CDR1, CDR2, and / or CDR3 of Table 1, or any combination thereof. [The present invention 1009] The engineered cell of the present invention 1004, wherein said antibody comprises CDR1, CDR2, and / or CDR3 of Table 3, or any combination thereof. [The present invention 1010] The engineered cell of the present invention 1004, wherein the extracellular binding domain comprises CDR1, CDR2, and / or CDR3 of Tables 1 and 3, or any combination thereof. [The present invention 1011] The engineered cells of the present invention 1001 that express and secrete a recombinant polypeptide. [The present invention 1012] 1012. The engineered cell of claim 1011, wherein said recombinant polypeptide comprises an antibody or a fragment thereof, or a cytokine. [The present invention 1013] The engineered cell of claim 1011, wherein said recombinant polypeptide modulates the immune system of a subject. [The present invention 1014] The engineered cell of the present invention, wherein the recombinant polypeptide is an immune checkpoint blocking antibody. [The present invention 1015] The engineered cell of claim 1011, wherein said recombinant polypeptide regulates tumor angiogenesis. [The present invention 1016] The engineered cell of the present invention 1015, wherein said recombinant polypeptide is specific for VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1. [The present invention 1017] 1011. The engineered cell of the present invention, wherein the recombinant polypeptide comprises an antibody or fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4. [The present invention 1018] The engineered cell of claim 1012, wherein said cytokine comprises IL-12, IL-15, or IL-18. [The present invention 1019] The engineered cell of claim 1001, wherein said cell comprises a T cell, a NK cell, or a NKT cell. [The present invention 1020] The engineered cell of the present invention, wherein said T cells are CD4+, CD8+, CD3+ pan T cells, or any combination thereof. [The present invention 1021] The engineered cell of the present invention, wherein said T cells are a mixed population of CD4+ T cells and CD8+ T cells. [The present invention 1022] 1. A nucleic acid construct encoding a chimeric antigen receptor, the chimeric antigen receptor comprising an extracellular ligand binding domain specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70. [The present invention 1023] The nucleic acid construct of claim 1022, wherein the chimeric antigen receptor further comprises a transmembrane polypeptide and an intracellular signaling domain. [The present invention 1024] The nucleic acid construct of the present invention, wherein the chimeric antigen receptor further comprises a costimulatory domain. [The present invention 1025] A nucleic acid construct of the invention 1023 further encoding a recombinant polypeptide. [The present invention 1026] The nucleic acid construct of the present invention, wherein said recombinant polypeptide is capable of being secreted from an engineered cell. [The present invention 1027] The nucleic acid construct of the present invention, wherein the recombinant polypeptide comprises an antibody or a fragment thereof, or a cytokine. [The present invention 1028] The nucleic acid construct of the present invention, wherein said recombinant polypeptide modulates the immune system of a subject. [The present invention 1029] The nucleic acid construct of the present invention, wherein the recombinant polypeptide is an immune checkpoint blocking antibody. [The present invention 1030] The nucleic acid construct of the present invention, wherein said recombinant polypeptide regulates tumor angiogenesis. [The present invention 1031] The nucleic acid construct of the present invention 1025, wherein the recombinant polypeptide comprises an antibody or a fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4. [The present invention 1032] The nucleic acid of claim 1027, wherein the cytokine comprises IL12, IL15, or IL18. [The present invention 1033] The nucleic acid of claim 1030, wherein said recombinant polypeptide is specific for VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1. [The present invention 1034] A vector comprising the nucleic acid construct of the present invention. [The present invention 1035] A cell comprising the vector of the present invention. [The present invention 1036] A method of treating a subject suffering from cancer, comprising administering to said subject a therapeutically effective amount of an engineered cell of the present invention. [The present invention 1037] 13. A method of reducing progression or promoting regression of cancer in a subject, comprising administering to said subject a therapeutically effective amount of an engineered cell of the present invention. [The present invention 1038] 13. A method of reducing cell proliferation of cancer cells in a subject, comprising administering to said subject a therapeutically effective amount of an engineered cell of the present invention. [The present invention 1039] The method of any one of claims 1036 to 1038, wherein the cancer comprises renal cell carcinoma. [The present invention 1040] A chimeric antigen receptor (CAR) comprising an extracellular ligand-binding domain, the extracellular ligand-binding domain being specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70. [The present invention 1041] The CAR of the present invention 1040, further comprising a transmembrane polypeptide and an intracellular signaling domain. [The present invention 1042] The CAR of the present invention 1041, further comprising a costimulatory domain. [The present invention 1043] The CAR of the present invention, wherein the extracellular ligand binding domain comprises an antibody or a fragment thereof. [The present invention 1044] A cell comprising the chimeric antigen receptor (CAR) of the present invention. [The present invention 1045] An engineered cell comprising a first chimeric antigen receptor and a second chimeric antigen receptor, wherein the first chimeric antigen receptor comprises an extracellular ligand binding domain specific for CAIX and the second chimeric antigen receptor comprises an extracellular ligand binding domain specific for CD70. [The present invention 1046] An engineered cell of the present invention 1045 that expresses and secretes a recombinant polypeptide. [The present invention 1047] 1047. The engineered cell of claim 1046, wherein said recombinant polypeptide comprises an antibody or a fragment thereof, or a cytokine. [The present invention 1048] The engineered cell of claim 1046, wherein said recombinant polypeptide modulates the immune system of a subject. [The present invention 1049] The engineered cell of claim 1046, wherein said recombinant polypeptide is an immune checkpoint blocking antibody. [The present invention 1050] The engineered cell of claim 1046, wherein said recombinant polypeptide regulates tumor angiogenesis. [The present invention 1051] 1046. The engineered cell of the present invention, wherein the recombinant polypeptide comprises an antibody or fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4. [The present invention 1052] The engineered cell of claim 1047, wherein said cytokine comprises IL12, IL15, or IL18. [The present invention 1053] The nucleic acid of claim 1050, wherein said recombinant polypeptide is specific for VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1. [The present invention 1054] The engineered cell of the present invention 1045, wherein the cell comprises a T cell or a NK cell. [The present invention 1055] The engineered cell of the present invention 1054, wherein said T cells are CD4+, CD8+, CD3+ pan T cells, or any combination thereof. [The present invention 1056] The engineered cell of the present invention 1054, wherein said T cells are a mixed population of CD4+ T cells and CD8+ T cells. [The present invention 1057] 1045. The engineered cell of claim 1045, wherein said first chimeric antigen receptor and said second chimeric antigen receptor are expressed from a single nucleic acid construct. [Brief description of the drawings]

[0033] [Figure 1] Figure 1 shows a schematic diagram of bispecific tandem CAR T anti-CD70 and anti-CAIX scFvs combined in different permutations by changing the order of two targeting scFvs with various linkers and hinges connected to costimulatory domains (non-limiting examples include CD28, 41BB, CD28-41BB, or 41BB-CD28) and activation domains (such as CD3). To assess efficacy (such as addressing heterogeneity) and safety (such as limiting on-target off-tumor effects), second generation CAR T cell factories can be engineered with the introduction of a second cassette anti-CD70 scFv. [Diagram 2] We show that a series of CARs (such as different scFvs, linkers, and hinges) can be combined with immune checkpoint blockade as payload to establish a second generation CAR T cell factory. Based on these data, eight constructs were established by using G36 as anti-CAIX scFv and B7 as anti-CD70 scFv. Those skilled in the art will recognize that any scFv according to the present invention can be utilized. The dual CAR engineering is the most important part, and the payload was replaced with zsgreen to show the conversion efficiency. [Diagram 3]Showing CAIX and CD70 upregulated and co-expressed in ccRCC. IHC staining of ccRCC primary cell lines generated from patient samples shows that both CAIX and CD70 are highly expressed and co-expressed in ccRCC. Without wishing to be bound by theory, CAIX and CD70 are two potential targets for ccRCC therapy. To validate the targets, IHC was performed for staining of CAIX and CD70 in primary cell lines generated from patients with ccRCC. From these images, we see that CAIX and CD70 staining is 100% positive, demonstrating that CAIX and CD70 are highly and co-expressed in ccRCC. This is currently being validated in a study measuring CAIX and CD70 expression in patients with ccRCC in at least 150 samples. [Figure 4] Figure 2 shows CAIX and CD70 are upregulated and co-expressed in ccRCC. IHC staining of ccRCC patient samples shows that both CAIX and CD70 are highly expressed and co-expressed on ccRCC. [Figure 5-1] Establishment of CRISPR skrc-59 cell lines is shown. Four CRISPR engineered skrc-59 cell lines with four different phenotypes (i) CAIX+CD70+, (ii) CAIX+CD70-, (iii) CAIX-CD70+, and (iv) CAIX-CD70- have been established for further evaluation in vitro. Four CRISPR skrc-59 cell lines have been established. The four different phenotypes (i) CAIX+CD70+, (ii) CAIX+CD70-, (iii) CAIX-CD70+, and (iv) CAIX-CD70- are used for the in vitro assays described herein. The corresponding table shows the expression levels of CAIX and CD70 in the four different cell lines quantified. [Figure 5-2] Please refer to the description of Figure 5-1. [Figure 6]Figure 1 shows a graph of anti-CD70 minibodies that showed selective binding to CD70+SKRC59 cells. Phage display (panned against CD70+skrc-59 cells and subtracted against CD70-skrc-59 cells) shows that a series of anti-CD70 minibodies showed binding to CD70-positive ccRCC skrc-59 cells. Anti-CD70 minibodies were expressed via Expi293 cells in 6-well plates. Three days after transfection, the supernatant was collected and an IgG quantification ELISA (Bethyl) was performed to estimate the concentration of minibodies in the supernatant. This approximate concentration was used to normalize the supernatant for FACS binding curves. Staining was performed via standard FACS staining protocol using anti-hFc-APC secondary. As can be seen, one of the killing activity hits (#9) is very non-specific. The other two monoCARs that exhibit killing activity (#3, 7) show good specificity for CD70. [Figure 7] We demonstrate that anti-CD70 CAR T cells exhibit killing activity in Celigo killing assay. These anti-CD70 scFv candidates were cloned into vectors, packaged into lentivirus, and transduced into primary T cells. The CAR T cells were evaluated for anti-proliferative activity in Celigo assay. The results showed that #3, #7, and #9 had efficacy compared to CD70 ligand CD27 CAR T cells. These hits were also cloned into pHAGE vectors and Celigo killing assay was performed. These graphs show that anti-CD70 CAR T cells exhibited killing activity in Celigo killing assay, with effector:target ratio of 2:1. The cell numbers at different time points were compared and normalized with untreated cells at the corresponding time points. So, Y-axis is the percentage of treated cells / untreated cells, and X-axis is the different treatments. After 24 h of co-culture with T cells, the number of SKRC59 cells in the treated group was significantly reduced compared to the untreated and non-transduced T cell groups, demonstrating the anti-proliferative activity of these CAR T cells. After 48 h of co-culture, we found three candidates that matched CD27, the ligand for CD70. Therefore, 3, 7, and 9 were used in further Chromium 51 killing assays. [Figure 8] We demonstrate that anti-CD70 CAR T cells exhibit killing activity in a Chromium 51 killing assay against CAIX+CD70+ cells. CAR T cells were also evaluated for killing activity in a Chromium 51 release assay. The results showed that #7 CAR T cells have enhanced efficacy compared to CD27 (CD70 ligand) CAR T cells. A Chromium 51 4-hour release assay was performed. It was verified that B7 has killing activity against SKRC59 CD70+ cells after 4 hours of incubation with Chromium 51-labeled target cells. [Figure 9] Second generation CAR-T cells are shown. CAR T cells can be generated using zsGreen instead of immune checkpoint blockade. Based on these data, eight constructs were established by using G36 as anti-CAIX scFv and B7 as anti-CD70 scFv. Dual CAR engineering is the most important part, and the payload was replaced with zsgreen to show the conversion efficiency. [Figure 10] Transfected 293T cells binding with CAIX-PE are shown. 293T cells were transfected with different constructs of dual CARs and binding assays with PE-labeled CAIX protein were performed. All dual CARs bind to CAIX and the different orientations of the two scFvs affect the EC50 of anti-CAIX scFv binding. Anti-CAIX scFv G36 favors the second cassette after the linker. For example, 293T cells were transfected with these eight bispecific constructs and the corresponding mono-CARs and stained with CAIX-PE. After normalization by transfection efficiency, the different orientations of the two scFvs affect the EC50 of anti-CAIX scFv binding. Anti-CAIX scFv G36 favors the second cassette after the linker. [Figure 11]Figure 1 shows transfected 293T cells binding to CD70-APC. 293T cells were transfected with different constructs of dual CARs and binding assays were performed with CAIX protein labeled with PE. All dual CARs bind to CD70, and the different orientations of the two scFvs do not affect the EC50 of anti-CD70 scFv binding. Anti-CD70 scFv B7 has no significant preference. For example, 293T cells were transfected with these eight bispecific constructs and the corresponding mono-CARs and stained with CD70-PE. After normalization by transfection efficiency, the different orientations of the two scFvs do not affect the EC50 of anti-CD70 scFv binding. Anti-CD70 scFv B7 has no significant preference. [Figure 12] Figure 1 shows B7-GGGGS3-G36 killing assay using Celigo. For example, selective killing assay was performed using B7-GGGGS3-G36 CAR against CAIX+ or CD70+ single positive cells or CAIX+CD70+ double positive cells mixed with CAIX-CD70- cells. B7-GGGGS3-G36 CAR T cells had more killing activity against target cells (CAIX+CD70+) than non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-). [Figure 13] B7-GGGGS3-G36 killing assay by FACS. Four different CRISPR engineered skrc-59 cells were transduced with BFP fluorescent groups. The cells were mixed at a 1:1:1:1 ratio and treated with B7-GGGGS3-G36 CAR T cells or media. After treatment, the cells were stained with PE-labeled anti-CD70 antibody and APC-labeled anti-CAIX antibody and flow cytometry was performed. B7-GGGGS3-G36 showed selective killing against CAIX+CD70+ cells, and the population was reduced from 26.7% to 18.5%. [Figure 14]Schematic diagram of fine-tuned anti-CAIX CAR T. Anti-CAIX scFvs with various KDs were generated as CARs and the corresponding killing activities were evaluated. To limit on-target off-tumor effects, a second generation CAR T cell factory was designed by introducing an anti-CD70 scFv in a second cassette. [Figure 15] Diagram rendering of fine-tuned anti-CAIX CAR-T cells. In validation experiments, CAR T cells were generated using zsGreen instead of immune checkpoint blockade. Eight constructs were established by using G36 as anti-CAIX scFv and B7 as anti-CD70 scFv. Dual CAR engineering was the key part, and the payload was replaced with zsgreen to show the conversion efficiency. A series of antibodies against CAIX were identified with different KD values ​​ranging from 1.49 nM to 99.58 nM (see also Figure 16). Binding experiments classified the 13 antibodies into four groups: [Figure 16-1] 1 depicts a table showing the 19 anti-CAIX ScFvs identified and the corresponding binding. [Figure 16-2] Please refer to the description of Figure 16-1. [Figure 17] A graph of anti-CAIX monoCAR T killing against CAIX+CD70+ is shown. These anti-CAIX CAR T cells were evaluated for anti-proliferative activity in a Celigo assay. The results showed that the 19 CARs could be divided into four groups based on killing activity: G37, G39, G125(++++)>G10, G21, G36, G40, G45, G57, G62, G98, G106, G119(+++)>G6, G9, G17, G27, G28(++)>G104(++). [Figure 18]Figure 1 shows a graph of anti-CAIX monoCAR T killing against CAIX+CD70+. These anti-CAIX CAR T cells were evaluated for anti-proliferative activity in a Celigo assay. The results showed that the 19 CARs could be divided into 4 groups based on killing activity: G37, G39, G125(++++)>G10, G21, G36, G40, G45, G57, G62, G98, G106, G119(+++)>G6, G9, G17, G27, G28(++)>G104(++). [Figure 19] Figure 1 shows killing of anti-CAIX monoCAR T against CAIX+CD70+. These anti-CAIX CAR T cells were evaluated for anti-proliferative activity in a Celigo assay. The results showed that based on killing activity, the 19 CARs could be divided into four groups: G37, G39, G125(++++)>G10, G21, G36, G40, G45, G57, G62, G98, G106, G119(+++)>G6, G9, G17, G27, G28(++)>G104(++). [Figure 20] Schematic of selective killing assay (e.g., using either Celigo assay or FACS assay). Two different selectivity assays were performed to investigate the selectivity of bispecific CARs against four different cell lines. For example, CAIX+CD70+ cells were mixed with mono-positive cells and then CART cells were added. After a certain time of incubation, the number of double-positive and single-positive cells was measured by Celigo. Also, the four different cell lines were mixed in a 1:1:1:1 ratio and CART cells were added. After 24 h of co-culture, all cells were collected and stained with CAIX-APC and CD70-PE by FACS. [Figure 21]Graph showing tandem CAR killing against skrc-59 mixed cells. Selective killing assays were performed on CAIX+ or CD70+ single positive cells or CAIX+CD70+ double positive cells mixed with CAIX-CD70- cells. Bispecific CAR T cells had more killing activity against target cells (CAIX+CD70+) than non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-) at E:T=5:1. [Figure 22] Graph showing tandem CAR killing against skrc-59 mixed cells. Selective killing assays were performed on CAIX+ or CD70+ single positive or CAIX+CD70+ double positive cells mixed with CAIX-CD70- cells. Bispecific CAR T cells had more killing activity against target cells (CAIX+CD70+) than non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-) at E:T=5:1. [Diagram 23] Graph showing tandem CAR killing on skrc-59 mixed cells. Selective killing assays were performed on CAIX+ or CD70+ single positive or CAIX+CD70+ double positive cells mixed with CAIX-CD70- cells. Bispecific CAR T cells had more killing activity against target cells (CAIX+CD70+) than non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-) at E:T=10:1. [Figure 24] 1 shows CAIX and CD70 being upregulated and co-expressed in ccRCC. [Diagram 25]We present the design of CARs to address the undesirable side effects previously associated with CAR cell therapy. To apply CAR cell therapy to solid tumors, we evaluate efficacy and safety profiling. First, to restore effective anti-cancer immunity, CAR-T cell factories were developed, which can secrete human anti-immune checkpoint blockade monoclonal antibodies (mAbs) locally at tumor sites to modulate the tumor microenvironment by reversing T cell exhaustion. To limit on-target off-tumor side effects, fine-tuned CARs were engineered with reduced affinity scFvs to expand the therapeutic window by limiting the recognition of tumor-associated antigens on normal tissues. Also, bispecific CARs were engineered by introducing a second cassette, such as an anti-CD70 scFv, to increase preferential killing in the dual-positive population and result in improved safety profiling. [Figure 26] We show that CAR-T cell factories exhibit enhanced killing. We designed a bicistronic lentiviral vector to express anti-CAIX scFv linked to CD28 and CD3z signaling domains in the first cassette and anti-PDL1 mAb in the second expression cassette. Therefore, CAR-T cell factories can target CAIX and secrete checkpoint blockade inhibitors at the tumor site to transform the suppressive tumor microenvironment. In an RCC orthotopic mouse model, 1E7 CAR-T cells were injected by intravenous injection on day 0 and 2.5E6 CAR-T cells were injected on day 17. CAR-T cell factories showed enhanced killing efficacy compared to CAR-T cells secreting irrelevant antibodies in our orthotopic RCC mouse model. [Figure 27] A schematic diagram of the evaluation of CAR-T on a humanized orthotopic ccRCC mouse model is shown. [Figure 28] MRI images of RCC mouse models are shown. [Figure 29] A schematic diagram of the experiments designed to establish a stress model and compare second and third generation CARs and CD8 vs. CD4 / 8 on an orthotopic ccRCC mouse model is shown. [Diagram 30] These results show that 41BB performed superior killing in vivo. At a dose of 1E7, efficient tumor regression was observed in the G36-41BB and G36-CD28-41BB treated groups. Mixed CD4 / CD8 G36-41BB CAR-T performed superior killing even at a dose of 3E6. Comparing two second-generation CAR constructs and one third-generation CAR construct, G36-41BB was more efficient than G36-CD28 and G36-CD28-41BB. [Diagram 31] 1 shows the G36-41BB stress model. Dosing of 3E6 can be used in the G36-41BB stress model. [Diagram 32] 41BB demonstrated superior killing in vivo. [Diagram 33] 41BB CAR-T cells showed the highest proliferation in vivo. [Diagram 34] CD8 vs. CD4 / CD8 is shown. [Diagram 35] 1 shows the in vivo proliferation of CD4 and CD8 T cells. [Diagram 36] Figure 1 shows a schematic of a fine-tuned anti-CAIX CAR-T designed to limit on-target off-tumor effects. Without wishing to be bound by theory, decreasing the affinity of the anti-CAIX scFv allows the CAR to only recognize the high density of CAIX on ccRCC. A series of anti-CAIX scFvs with various KDs were cloned into lentiviral vectors, and the corresponding CAR-T cells were generated and evaluated for killing activity. [Figure 37]Detailed diagram of "therapeutic window". "Therapeutic window" is a term originally derived from drug toxicology, which can refer to the range of doses between efficacy and toxicity, achieving the best therapeutic effect without causing unacceptable toxicity, which is the range between the minimum effective dose (MED) and the maximum tolerated dose (MTD). This concept has been applied to optimize CAR-T therapy. To expand the therapeutic window, the CAR affinity with the antigen can be fine-tuned by assembling scFvs with different KDs in the CAR construct, such as 1 nm to 100 nm. Ideally, after optimization, the CAR only recognizes high-density antigens on tumor cells, not low-density antigens on normal cells. Targeting antigens expressed only on tumor cells or only on non-critical tissues widens the therapeutic window because no direct toxicity occurs on major tissues. On the other hand, targeting antigens expressed in important normal tissues / cells narrows the window by decreasing the MTD. [Figure 38] FIG. 1 is a schematic illustrating widening the therapeutic window to address on-target off-tumor side effects. [Figure 39] IHC double staining of CAIX and CD70 on patient samples is shown. CD70 and CAIX were found to be highly expressed and co-expressed on ccRCC. Therefore, CD70 is selected as the second target. [Diagram 40] IHC double staining for CAIX and CD70 on patient samples is shown. [Diagram 41] A panel of scFvs against CAIX with different KD values ​​ranging from 1.49 nM to 99.58 nM are shown in the table. Corresponding CAR-T cells were generated and screened by Celigo killing assay. [Diagram 42]Showing a correlation between scFv affinity and CART cell killing, 19 CARs were divided into four groups according to cytotoxicity and tested against skrc-59 cells with different levels of CAIX expression: G37, G39, G125>G10, G21, G36, G40, G45, G57, G62, G98, G106, G119>G6, G9, G17, G27, G28>G104. [Diagram 43] "Or" gating is shown to capture tumor cell heterogeneity but not kill healthy cells at low target density. [Diagram 44] CD70 is highly expressed on renal cancer, particularly clear cell renal cell carcinoma, indicating that it may be an ideal second target for bispecific CARs. [Diagram 45] IHC double staining of CAIX and CD70 on ccRCC patient samples is shown. CD70 and CAIX are highly expressed and co-expressed on ccRCC. Therefore, CD70 is selected as the second target. [Diagram 46] Figure 1 shows IHC double staining of CAIX and CD70 on ccRCC patient samples. CD70 and CAIX are highly expressed and co-expressed on ccRCC. Therefore, CD70 is selected as the second target. [Figure 47] Shows CAIX and CD70 being upregulated and co-expressed on ccRCC. [Figure 48]Figure 1 shows that anti-CD70 minibodies showed selective binding to CD70+SKRC59 cells. By phage display (panned against CD70+skrc-59 cells and subtracted against CD70-skrc-59 cells), we discovered a series of anti-CD70 minibodies that showed promising binding to CD70-positive ccRCC skrc-59 cells. Anti-CD70 minibodies were expressed via Expi293 cells in 6-well plates. Three days after transfection, the supernatants were collected and an IgG quantification ELISA (Bethyl) was performed to estimate the concentration of minibodies in the supernatants. This approximate concentration was used to normalize the supernatants for FACS binding curves. Staining was performed via standard FACS staining protocols using an anti-hFc-APC secondary. One of the killing activity hits (#9) is highly nonspecific. The other two monoCARs (#3, 7) that exhibit killing activity show good specificity for CD70. [Figure 49] We show that anti-CD70 B7 CAR-T cells showed promising killing against CD70+skrc-59 cells. By phage display (panned against CD70+skrc-59 cells and subtracted against CD70-skrc-59 cells), we discovered a series of anti-CD70 minibodies that showed promising binding to CD70-positive ccRCC skrc-59 cells. These hits were also cloned into lentiviral vectors and Celigo killing assay was performed on the corresponding CAR T cells. From the screening, we found B7 as a candidate. [Figure 50] Figure 1 shows bispecific CAR constructs. A series of constructs were established in different rotations (or orientations) with different linkers by using G36 as the anti-CAIX scFv and B7 as the anti-CD70 scFv. [Figure 51]Anti-scFv G36 prefers to be in the second cassette after the linker. 293T cells are transfected with these eight bispecific constructs and the corresponding monoCARs and stained with CAIX-PE. After normalization by transfection efficiency, it shows that the different orientations of the two scFvs affect the EC50 of anti-CAIX scFv binding. Anti-CAIX scFv G36 prefers to be in the second cassette after the linker. [Figure 52] Anti-CD70 scFv B7 has no preference. 293T cells are transfected with different constructs of dual CAR, and binding assay is performed with APC-labeled CD70 protein. After normalization by transfection efficiency, it shows that the different orientations of the two scFvs do not affect the EC50 of anti-CD70 scFv binding. Anti-CD70 scFv B7 has no significant preference. [Diagram 53] Figure 1 Establishment of four CRISPR skrc-59 cell lines. Four CRISPR engineered skrc-59 cell lines with four distinct phenotypes, CAIX+CD70+, CAIX+CD70-, CAIX-CD70+, and CAIX-CD70-, were established for further evaluation in vitro. [Figure 54] We show that B7-GGGGS3-G36 exhibits preferential killing. Taking B7-GGGGS3-G36 CAR as an example, selective killing assay was performed on CAIX+ or CD70+ single positive cells, or CAIX+CD70+ double positive cells mixed with CAIX-CD70- cells. B7-GGGGS3-G36 CAR-T cells were shown to have preferential killing activity against target cells (CAIX+CD70+) over non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-). After a certain period of incubation, the number of double positive cells and single positive cells was measured by Celigo. It can also be seen that B7-GGGGS3 has a restricted selective index for CAIX+CD70+ while mixed with CAIX+ cells. [Figure 55]Showing that B7-GGGGS3-G36 exhibits preferential killing. Four different CRISPR engineered skrc-59 cells were transduced with BFP fluorescent groups. The cells were mixed at a 1:1:1:1 ratio and treated with B7-GGGGS3-G36 CAR-T cells or media. After treatment, the cells were stained with PE-labeled anti-CD70 antibody and APC-labeled anti-CAIX antibody and flow cytometry was performed. B7-GGGGS3-G36 showed selective killing against CAIX+CD70+ cells, the population of which was reduced from 26.7% to 18.5%. This selective killing data from FACS showed that B7-GGGGS3-G36 had selective killing against CAIX+CD70+ cells, the population of which was reduced from 26.7% to 18.5%. [Figure 56] Schematic diagram of bispecific split CAR T. Anti-CD70 and anti-CAIX scFv were expressed on the cell surface with different costimulatory domains. See, for example, dual(split)CAR T, Nat Rev Cancer 16(9):566-81. [Figure 57] Showing split CAR killing in ccRCC primary cancer cells. Split CAR T cells were evaluated for killing activity against primary ccRCC cancer cells using mono-CAR T and tandem CAR T cells. It showed that split CAR achieved superior killing at low E:T ratios such as a 1:1 ratio. [Figure 58] 1 provides a multiple alignment of the amino acid sequences of anticarbonic anhydrase IX (G250) scFv clones. [Figure 59] 1 provides an alignment of human and mouse CAIX amino acid sequences. [Figure 60] The structure of carbonic anhydrase IX (G250) is provided. [Figure 61] CAR T cell killing assay of Skrc-59 transduced cells. Celigo image cytometry is shown. [Figure 62]Shown is a homology study of 10 different species. Tree: the distance of each branch is equal to the number of differences between the sequences (e.g. 0.1 means that the difference between the two sequences is 10%) and the distance between two species is equal to the sum of the lengths of all the branches connecting them. Homology > 60% → potential cross-reactivity. [Figure 63] Establishment of skrc-59 stable cell lines expressing CAIX or CD70 from different species. CRISPR knocked out CAIX- / CD70-skrc-59 cells were transduced with 10 different constructs (CD70 or CAIX from 5 different species) and sorted by FACS. Half-transduced with BFP (for Celigo). Stained with commercial antibodies. [Figure 64] Binding assay of anti-CAIX(G36) scFv normalized to commercial antibody binding data analyzed using nonlinear regression and log(agonist) vs response model. [Figure 65] Killing assay of anti-CAIX(G36) CAR T cells: 100% monkey (same killing as humans, cross-reactivity), 50% mouse, hamster (significant killing). [Figure 66] 1 shows a killing assay of anti-CD70 (B7) CAR T cells. [Figure 67] Killing assay of 20 different anti-CAIX CAR T cells is shown. [Figure 68] Fold change killing assay G36 E:T 10:1 is shown. [Figure 69] Killing assay G36 E:T 5:1 is shown. [Figure 70] Killing assay G36 n=2 is shown. [Figure 71] Killing Assay Twenty anti-CAIX scFvs are shown. [Figure 72] All candidate monkeys are shown. [Figure 73] All candidate mice are shown. [Figure 74] All candidate hamsters are shown. [Figure 75] Fold change B7 killing assay is shown. [Figure 76-1] 1 shows the amino acid sequence and germline alignment of anti-cd70 antibodies. [Figure 76-2] Please refer to the description of Figure 76-1. [Figure 77] 1 shows the nucleic acid construct of split car. [Figure 78] 1 shows the amino acid sequences and germline alignments of anti-PDL1 and anti-PD1 sequences. [Figure 79] 1 shows the amino acid sequences and germline alignments of anti-CAIX antibodies. [Figure 80] Figure 2 shows the cytotoxicity of tandem CAR B7-GGGGS5-G36. [Figure 81-1] 1 shows the amino acid sequences and germline alignments of anti-TIGIT antibodies. [Figure 81-2] Please refer to the description of Figure 81-1. [Figure 81-3] Please refer to the description of Figure 81-1. [Figure 82] 4 shows the anti-PD-L1 amino acid sequence. [Figure 83-1] 1 shows anti-PD1 nucleic acid and amino acid sequences. [Figure 83-2] Please refer to the description of Figure 83-1. [Figure 83-3] Please refer to the description of Figure 83-1. [Figure 83-4] Please refer to the description of Figure 83-1. [Figure 83-5] Please refer to the description of Figure 83-1. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0034] Chimeric antigen receptor (CAR) T-cell therapy represents an exciting area of ​​discovery that has already revolutionized the treatment of several blood-borne cancers. For example, in acute lymphoblastic leukemia (ALL), it has demonstrated remission rates of 80-90%, leading to FDA approval. This technology can harness the patient's own immune cells to fight cancer by engineering them to better recognize specific proteins located on cancer cells. For example, after that modification is made in the laboratory, the immune cells can be grown extensively in the lab, doubling their cancer-killing potential, and finally infused into the patient, where their increased efficacy and numbers allow them to attack the cancer wherever it is located in the body.

[0035] CAR T cell therapy has been largely elusive in solid tumors such as renal cell carcinoma (RCC) because cancer cells create a tumor microenvironment that turns off immune infiltration. We have succeeded in creating advanced mouse models that can provide critical information for this technology. Our approach relies on the creation of humanized RCC in mice that can be studied to better understand the immunological fingerprint. By examining how human RCC behaves within mice, the lab has been able to identify antigens that can be targeted using CAR T cell therapy in humans and other mammals, such as carbonic anhydrase IX [CAIX] and CD70. By and large, these two antigens, namely CAIX and CD70, are only found together on renal cancer tumor cells, which allows the immune system to attack them locally with minimal impact on healthy tissue. There have also been advances in counteracting the immunosuppressive effects within the microtumor environment by engineering T cells that produce and / or secrete checkpoint blocking antibodies. Together, these approaches will allow for dramatically improved efficacy within the tumor microenvironment.

[0036] Described herein are, for example, CAR T cells that target CAIX and CD70, which can be administered to animals while closely monitoring the changes in tumor microenvironment and subsequent antitumor effects.Those skilled in the art will recognize that these approaches can also be combined with currently available technologies that have already positively impacted the clinical setting of RCC, such as the use of immune checkpoint blockade.

[0037] Detailed description of one or more embodiments is provided herein.However, it is understood that the present invention can be embodied in various forms.Therefore, the specific details disclosed herein should not be interpreted as limiting, but as a basis for claims and as a representative basis for teaching a person skilled in the art to use the present invention in any suitable manner.

[0038] The singular forms "a," "an," and "the" include plural references unless the context clearly dictates otherwise. The use of the words "a" or "an" when used in conjunction with the term "comprising" in the claims and / or specification can mean "one," but is also consistent with the meaning of "one or more," "at least one," and "one or more than one."

[0039] Whenever the phrases "for example," "such as," "including," and the like are used herein, unless expressly stated otherwise, they are understood to be accompanied by the phrase "without limitation." Similarly, "an example," "exemplary," and the like are understood to be non-limiting.

[0040] The term "substantially" permits deviations from the descriptive language that do not adversely affect the intended purpose. It is understood that the descriptive language is modified by the term "substantially" even if the word "substantially" is not expressly recited.

[0041] The terms "comprising" and "including," as well as "having" and "involving" (and similarly "comprises," "includes," "has," and "involves"), etc., are used interchangeably and have the same meaning. Specifically, each term is defined consistent with the general U.S. Patent Law definition of "comprising," and therefore is to be interpreted as having the open term meaning "at least the following," and not excluding additional features, limitations, aspects, etc. Thus, for example, "a process involving steps a, b, and c" means that the process includes at least steps a, b, and c. Whenever the terms "a," "an" are used, they are to be understood as "one or more," unless such an interpretation is meaningless in the context.

[0042] The term "about" as used herein can refer to approximately, roughly, approximately, or within a range. When the term "about" is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values ​​set forth. In general, the term "about" is used herein to modify a numerical value above and below the set forth value by a variance of 20 percent (up and down).

[0043] Chimeric antigen receptor (CAR) T cell therapy Chimeric antigen receptor (CAR) T cell therapy redirects a patient's T cells to kill tumor cells by exogenous expression of CAR. With reference to Figure 1, for example, CAR is a transmembrane fusion protein that links the antigen recognition domain of an antibody or fragment to the intracellular signaling domain of a T cell receptor and a co-receptor. For example, chimeric antigen receptor fuses an antigen-specific antibody fragment to a T cell co-stimulatory domain and a CD3 zeta intracellular signaling domain, allowing the redirection of T cells to antigens presented on cells of interest, such as tumor cells.

[0044] The term "antibody" herein is used in the broadest sense and can refer to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen-binding site that specifically binds (immunoreacts with) an antigen. "Specifically binds" or "immunoreacts with" can refer to an antibody that reacts with one or more antigenic determinants of a desired antigen and not with other polypeptides. Antibodies of the present invention include, but are not limited to, polyclonal, monoclonal, humanized, fully human, bispecific, multispecific, chimeric, dAb (domain antibody), single chain antibodies, Fab, Fab' and F(ab')2 fragments, scFv, diabodies, minibodies, scFv-Fc fusions, and Fab expression libraries. Unless expressly stated to the contrary, references made herein to "antibody" or "antibodies" include, for example, any (or all) of these molecules so long as they exhibit the desired antigen-binding activity.

[0045] Single chain Fv ("scFv") polypeptide molecules are covalently linked VH::VL heterodimers and can be expressed from gene fusions containing VH- and VL-encoding genes linked by a peptide-encoding linker. (See Huston et al. (1988) Proc Nat Acad Sci USA 85(16):5879-5883). Many methods have been described for identifying chemical structures for converting naturally aggregated but chemically separated light and heavy polypeptide chains derived from antibody V regions into scFv molecules that fold into a three-dimensional structure substantially similar to that of an antigen-binding site. See, for example, U.S. Patent Nos. 5,091,513, 5,132,405, and 4,946,778.

[0046] Solid tumors provide unique challenges for CAR-T therapy. Unlike hematological cancers, tumor-associated target proteins are overexpressed between tumors and healthy tissues, resulting in on-target / off-tumor T cell killing of healthy tissues. Furthermore, immune suppression in the tumor microenvironment (TME) limits tumor-killing CAR-T cell activation. Aspects of the disclosure address these issues. For example, embodiments include (a) T cells comprising a bispecific CAR that targets two antigens on cancer cells and reduces on-target / off-tumor T cell killing. With reference to FIG. 12, for example, B7-GGGGS-G36 CAR T cells had more killing activity against target renal cancer cells (CAIX+CD70+) than non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-). In embodiments, the bispecific CAR can also (b) secrete checkpoint blockade antibodies that remove inhibition in the tumor microenvironment. Other embodiments include fine-tuned CARs that only recognize high density antigens on tumor cells, but not low density antigens on normal cells. Without wishing to be bound by theory, this can be accomplished, for example, by reducing the affinity of one or more antibodies associated with the CAR.

[0047] For example, Figure 1 provides a schematic diagram of a bispecific CAR that targets two antigens, such as CAIX and CD70. A bispecific CAR can refer to a CAR that has binding specificity for at least two different antigens. For example, a bispecific CAR can include a monoclonal antibody, such as a human or humanized antibody, or a fragment thereof. In this case, one of the binding specificities is CAIX and / or CD70. The second binding target is any other antigen, advantageously a cell surface protein or receptor or receptor subunit. For example, one of the binding specificities is for CAIX, and the second binding specificity is for CD70.

[0048] As reported (see, e.g., J Clin Oncol 24(2006)20-22; Molecular Therapy 21(2013)4), the first clinical trial of first-generation anti-CAIX G250 CAR-T cells for patients with renal cell carcinoma RCC (RCC) failed to open the door to on-target off-tumor side effects. Two of the first three patients developed hepatitis due to CAIX expression in the bile duct. The introduction of a secondary antibody, such as a secondary scFv, may increase the safety of the subjects, since dual-targeting CAR T can reduce or eliminate on-target / off-tumor effects. For example, referring to Figure 24, the expression of CAIX and CD70 are upregulated and co-expressed on ccRCC. Meanwhile, CAIX is expressed in the bile duct (mainly in the cytoplasm), and CD70 is not expressed in the bile duct. For example, see British Journal of Cancer 103(2010)676-684.

[0049] Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g., F(ab')2 bispecific antibodies). Methods for making bispecific antibodies are known in the art. See, for example, U.S. Patent No. 8,329,178, which is incorporated herein by reference in its entirety.

[0050] Antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE, and IgD, which differ from each other in the nature of the heavy chains present in the molecule. Certain classes also have subclasses, such as IgG1, IgG2, and others. Furthermore, in humans, the light chains can be kappa or lambda chains.

[0051] The term "antigen-binding site" or "binding portion" can refer to the portion of an immunoglobulin molecule that is involved in antigen binding. The antigen-binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light ("L") chains. Three highly divergent stretches within the V regions of the heavy and light chains, called "hypervariable regions", are inserted between more conserved adjacent stretches known as "framework regions" or "FRs". Thus, the term "FR" refers to the amino acid sequences naturally found between and adjacent to the hypervariable regions of immunoglobulins. In an antibody molecule, the three hypervariable regions of the light chain and the three hypervariable regions of the heavy chain are positioned relative to each other in three-dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity determining regions" or "CDRs". See, for example, Tables 1 and 3, which provide the CDRs of anti-CAIX and anti-CD70 antibodies.

[0052] Emerging mechanisms relevant to tumor progression are immune checkpoint pathways, which involve cellular interactions that prevent excessive activation of T cells under normal conditions and allow T cell function in a self-limiting manner. As an evasion mechanism, many tumors can stimulate the expression of immune checkpoint molecules, resulting in an anergic phenotype of T cells that cannot suppress tumor progression. For example, new clinical data highlight the importance of one inhibitory ligand-receptor pair, programmed death ligand 1 (PD-L1, B7-H1 and CD274) and programmed death receptor 1 (PD-1, CD279), as an immune checkpoint that prevents the killing of cancer cells by cytotoxic T lymphocytes. The PD1 receptor is expressed on many cell types, including T cells, B cells, natural killer cells (NK), and host tissues. Tumors and antigen-presenting cells (APCs) expressing PD-L1 can block T cell receptor (TCR) signaling of cytotoxic T lymphocytes via binding to the receptor PD-1, reducing cytokine production and T cell proliferation. Overexpression of PD-L1 is found in many tumor types and mediates immunosuppressive functions through interactions with other proteins, including CD80 (B7.1), and blocks the ability of tumors to activate T cells via binding to CD28.

[0053] Genetic engineering of human lymphocytes to express tumor-targeted chimeric antigen receptors (CARs) can generate anti-tumor effector cells that circumvent tumor immune evasion mechanisms due to abnormalities in protein antigen processing and presentation. Furthermore, these transgenic receptors can be directed to tumor-associated antigens that are not protein-derived. In certain embodiments of the present disclosure, there are lymphocytes modified to contain at least a CAR (CART), and in certain embodiments of the invention, a single CAR targets two or more antigens (e.g., bispecific CARs). In some embodiments, the cells contain split CARs, such as anti-CD70 and anti-CAIX scFvs expressed on the cell surface with distinct costimulatory domains. Additionally, some embodiments include fine-tuned CARs. In some embodiments, the CART is further modified to express and secrete one or more polypeptides, such as, for example, antibodies, or cytokines, such as IL-12, IL-15, or IL-18. Such CARTs are referred to herein as armed CARTs or CAR factories. Armed CART allows for the simultaneous local secretion of polypeptides at the target site (i.e., the tumor site).

[0054] For example, with reference to FIG. 56, a split CAR comprises two or more CARs on the surface of a cell, such as a T cell or NK cell. The CARs can be specific for two or more antigens, such as CD70 and CAIX. FIG. 77 provides an example of a nucleic acid construct encoding a split CAR. In this example, the first CAR is specific for CAIX and the second CAR is specific for CD70. As described herein, the CARs can be in any orientation desired. For example, the first CAR can be specific for CD70 and the second CAR can be specific for CAIX. As shown in the example, the first and second CARs can be expressed from a single nucleic acid construct. In such an example, a nucleic acid encoding a cleavable linker can be placed between the nucleic acid encoding the first CAR and the nucleic acid encoding the second CAR. In other embodiments, the two CARs can be expressed from the same cell but from two separate nucleic acid constructs.

[0055] Engineered TCRs, called chimeric antigen receptors (CARs), e.g., CARs containing single-chain variable antibody fragments (scFvs) previously selected for their high affinity to specific tumor-associated antigens, are a powerful new approach against cancer. The scFvs presented on the CARs are linked to intracellular signaling blocks, including CD3ζ, to induce T cell activation before binding to antigen. This structure is characteristic of first-generation CARs and has been improved in second-generation CARs that link signaling costimulatory endodomains of CD28, 4-1BB, or OX40 to CD3, or in third-generation CARs that link the two elements in tandem to CD3ζ. These endodomains are necessary for full T cell activation during TCR recognition by antigen-presenting cells (APCs) and improve cytokine production and proliferation of CAR-T cells. Due to the difficulty of finding unique tumor-associated antigens, inefficient homing of T cells to the tumor site, poor persistence of T cells in the body, and the immunosuppressive microenvironment of solid tumors, the efficacy of CAR cells has been modest so far in treating solid tumors.

[0056] In certain cases, lymphocytes may contain receptors that are chimeric, non-natural, and at least partially engineered by the hand of man. In certain cases, engineered chimeric antigen receptors (CARs) have one, two, three, four, or more components, and in some embodiments, one or more components facilitate targeting or binding of lymphocytes to one or more tumor antigen-containing cancer cells.

[0057] The CAR according to the present invention comprises at least one transmembrane polypeptide comprising at least one extracellular ligand binding domain and one transmembrane polypeptide comprising at least one intracellular signaling domain, such that the polypeptides assemble together to form a chimeric antigen receptor. Exemplary CARS useful in embodiments of the present disclosure include, for example, those disclosed in PCT / US2006 / 046350, PCT / US2015 / 067178, PCT / US2015 / 067225, and PCT / US2019 / 022272, each of which is incorporated herein by reference in its entirety.

[0058] The term "extracellular ligand-binding domain" as used herein can refer to an oligo- or polypeptide capable of binding to a ligand. The domain can interact with a cell surface molecule. For example, the extracellular ligand-binding domain can be selected to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.

[0059] In particular, the extracellular ligand binding domain may comprise an antigen binding domain or antigen recognition domain derived from an antibody against a target antigen. The antigen binding domain or antigen recognition domain may be an antibody fragment. An "antibody fragment" may be a molecule other than an intact antibody that comprises a portion of an intact antibody that binds to the antigen to which the intact antibody binds. Examples of antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab')2, diabodies, linear antibodies, single-chain antibody molecules (e.g., scFv), and multispecific antibodies formed from antibody fragments. For example, with reference to FIG. 1, one embodiment includes a CAR with two scFvs as antigen recognition domains. For example, with reference to FIG. 14, one embodiment includes a CAR with one scFv as antigen recognition domain.

[0060] The antigen recognition domain can be directed to any antigen target of interest. In embodiments, the antigen target of interest is on the surface of a cell, such as the surface of a cancer cell. Non-limiting examples of antigen targets include CAIX and / or CD70.

[0061] In some embodiments, the CAR is specific for CAIX and / or CD70.

[0062] In an embodiment, the extracellular ligand-binding domain is a single-chain antibody fragment (scFv) comprising a light chain (VL) and a heavy chain (VH) variable fragment of a target antigen-specific monoclonal antibody joined by a flexible linker. Those skilled in the art will recognize that the embodiment can include different linkers typically known in the art. See, for example, Chen, et al. "Fusion protein linkers: property, design and functionality." Advanced drug delivery reviews 65.10 (2013): 1357-1369, which is incorporated herein by reference in its entirety. For example, different linkers can be used to fine-tune the dual-targeting CAR construct. The length of the linker can vary depending on the antibodies of the dual-targeting CAR construct, their angle of approach to the target epitope, and the topography of the target on the tumor cell membrane. For example, referring to FIG. 2, the flexible linker can include GGGS1, GGGGS3, GGGGS5, or IgG1 hinge. In some embodiments, the number of G in the linker can be 2, 3, 4, 5, 6, or 7 in combination with any of S1, S2, S3, S4, S5, or S6. For example, the scFv antibody is specific for CAIX and / or CD70. The orientation of the scFv relative to the linker can vary, for example, as shown in Figures 10 and 50. In one nucleic acid construct shown in Figure 50, the anti-CAIX scFv can be in the first cassette (i.e., before the linker) and the anti-CD70 cassette can be in the second cassette (i.e., after the linker). Alternatively, the anti-CAIX scFv can be in the second cassette and the anti-CD70 scFv can be in the first cassette. For example, with reference to Figure 51, the anti-CAIX scFv G36 can be in the first cassette and the anti-CD70 B7 can be in the second cassette. Alternatively, anti-CAIX scFv G36 can be in the second cassette and anti-CD70 B7 can be in the first cassette. Linkers of various lengths and flexibilities can be utilized as described herein. As shown, different orientations of the two scFvs can affect binding.For example, G36 has higher avidity than the one engineered as the second cassette, whereas the anti-CD70 scFv B7 has no significant preference, as shown in Figure 11.

[0063] Examples of antibodies useful for constructing CARs according to the present disclosure include those detailed herein in Tables 1, 2, 3, or 4. See also, e.g., WO / 2007 / 065027 and WO / 2016 / 100985, the contents of which are incorporated herein by reference in their entireties.

[0064] Antigen recognition domains useful for constructing CAR-T, such as scFVs directed to CAIX and / or CD70, can be synthesized, engineered, and / or produced using nucleic acids (e.g., DNA). The DNA encoding the antigen recognition domain can be cloned in frame with the DNA encoding the necessary CAR-T elements, such as, for example, but not limited to, the CD8 hinge region, transmembrane domain, costimulatory domain, of a molecule of immunological interest, such as, for example, but not limited to, CD28 and 41BB and CD3-zeta intracellular signaling domain. See, for example, Figure 2.

[0065] As non-limiting examples, binding domains other than scFvs, such as camelid single domain antibody fragments or receptor ligands, antibody binding domains, antibody hypervariable loops, or CDRs, can also be used for predefined targeting of lymphocytes.

[0066] In one embodiment, the transmembrane domain further comprises a stalk region between said extracellular ligand binding domain and said transmembrane domain. As used herein, the term "stalk region" can refer to any oligo- or polypeptide that functions to link a transmembrane domain to an extracellular ligand binding domain. In particular, the stalk region is used to provide more flexibility and accessibility to the extracellular ligand binding domain. The stalk region can comprise up to 300 amino acids, e.g., 10-100 amino acids, e.g., 25-50 amino acids. The stalk region can be derived from all or a portion of a naturally occurring molecule, such as all or a portion of the extracellular region of CD8, CD4 or CD28, or all or a portion of an antibody constant region. Alternatively, the stalk region can be a synthetic sequence that corresponds to a naturally occurring stalk sequence, or can be a completely synthetic stalk sequence. In one embodiment, the stalk region is a portion of the human CD8 alpha chain.

[0067] The signal transduction domain or intracellular signaling domain of the CAR of the present invention is involved in intracellular signal transduction after the binding of the extracellular ligand binding domain to the target, resulting in the activation of immune cells and immune response. In other words, the signal transduction domain is involved in the activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed. For example, the effector function of a T cell can be a cytolytic activity or a helper activity, including the secretion of cytokines. Thus, the term "signal transduction domain" can refer to the part of a protein that converts an effector signal function signal and instructs the cell to perform a specific function.

[0068] The signal transduction domain can comprise two different classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation, and those that act antigen-independently to provide secondary or costimulatory signals. Primary cytoplasmic signaling sequences can comprise signaling motifs known as immunoreceptor tyrosine-based activation motifs, which are ITAMs. ITAMs are well-defined signaling motifs found in the cytoplasmic tails of various receptors that function as binding sites for the syk / zap70 class of tyrosine kinases. Examples of ITAMs used in the present invention can include, by way of non-limiting example, those derived from TCR zeta, FcR gamma, FcR beta, FcR epsilon, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. In another embodiment, the signal transduction domain of the CAR can comprise the CD3 zeta signaling domain, or the cytoplasmic domain of the Fc epsilon RI beta or gamma chain. In another embodiment, signaling is provided by CD3 zeta, with costimulation provided by CD28 and a tumor necrosis factor receptor (TNFr), such as, for example, 4-1BB or OX40.

[0069] In one embodiment, the intracellular signaling domain of the CAR of the present invention comprises a costimulatory signal molecule. In some embodiments, the intracellular signaling domain comprises two, three, four or more costimulatory molecules in tandem. A costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligand that is required for an efficient immune response.

[0070] A "costimulatory ligand" can refer to a molecule on an antigen-presenting cell that specifically binds to a cognate co-stimulatory molecule on a T cell, thereby providing a signal that mediates T cell responses, including, but not limited to, proliferation activation, differentiation, etc., in addition to the primary signal provided by, for example, binding of a peptide-loaded MHC molecule to the TCR / CD3 complex. Costimulatory ligands include, but are not limited to, CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1CB, HVEM, lymphotoxin beta receptor, 3 / TR6, ILT3, ILT4, agonists or antibodies that bind the ligand to the Toll ligand receptor, and In particular, they may include, but are not limited to, ligands that specifically bind to B7-H3.Co-stimulatory ligands also include antibodies that specifically bind to co-stimulatory molecules present on T cells, such as, but not limited to, ligands that specifically bind to CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, and CD83.

[0071] "Costimulatory molecule" can refer to the cognate binding partner on T cells that specifically binds to a costimulatory ligand, thereby mediating a costimulatory response by the cell, such as, but not limited to, proliferation. Costimulatory molecules include, but are not limited to, MHC class 1 molecules, BTLA, and Toll ligand receptors. Examples of costimulatory molecules include CD27, CD28, CD8, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds to CD83, and the like.

[0072] In another specific embodiment, the signal transduction domain is the TNFR-associated factor 2 (TRAF2) binding motif, which is the cytoplasmic tail of the costimulatory TNFR family members. The cytoplasmic tail of the costimulatory TNFR family members contains a TRAF2 binding motif that consists of a major conserved motif (P / S / A)X(Q / E)E) or a minor motif (PXQXXD), where X is any amino acid. TRAF proteins are recruited to the intracellular tail of many TNFRs in response to receptor trimerization.

[0073] A chimeric antigen receptor fuses an antigen recognition domain to a signaling domain (also called a stimulatory domain) that regulates (i.e., stimulates) cell signaling. Non-limiting examples of such stimulatory domains include those of CD28, 41BB, and / or CD3-zeta intracellular signaling domains. See, e.g., FIG. 2.

[0074] The distinguishing features of suitable transmembrane polypeptides include their ability to be expressed on the surface of immune cells, particularly lymphocytes or natural killer (NK) cells, and to interact to induce cellular responses of immune cells against a given target cell. The different transmembrane polypeptides of the CAR of the present invention, including extracellular ligand binding domains and / or signal transduction domains, interact together to participate in signal transduction after binding to a target ligand and induce an immune response. The transmembrane domains can be derived from either natural or synthetic origin. The transmembrane domains can be derived from any membrane-bound or transmembrane protein.

[0075] The term "part of" as used herein can refer to any subset of a molecule, i.e., a shorter peptide. Alternatively, amino acid sequence functional variants of a polypeptide can be prepared by mutation of the DNA encoding the polypeptide. Such variants or functional variants include, for example, deletions from, or insertions or substitutions of, residues within the amino acid sequence. Any combination of deletions, insertions, and substitutions may be made to arrive at the final construct, provided that the final construct has the desired activity, and in particular exhibits specific anti-target cellular immune activity. The functionality of the CAR of the present invention in a host cell can be detected in an assay suitable for demonstrating the signaling ability of the CAR upon binding of a specific target. Such assays are available to the skilled artisan. For example, the assay allows the detection of signaling pathways triggered upon target binding, such as assays including measurement of increased calcium ion release, intracellular tyrosine phosphorylation, inositol phosphate turnover, or the resulting production of interleukin (IL)2, interferon gamma, GM-CSF, IL-3, IL-4.

[0076] Carbonic anhydrase IX (CAIX) Several mAbs have been identified that react with surface antigens on RCC. These include mAbs that recognize differentiated and overexpressed antigens, as well as mAbs that identify RCC-associated antigens that are not expressed in normal kidneys (Michael, 2003; Yang, 2003). The gene for CAIX, also known as G250 and MN, is located on chromosome 9p12-13 and encodes a transmembrane protein that binds zinc and has CA activity (Zavada, 1997; Grabmaier, 2000). In HeLa cells and RCC cell lines derived from human carcinomas of the cervix, CAIX / G250 / MN / is found at the plasma membrane and as a nuclear protein with apparent molecular weights of 58 and 54 kDa. It is N-glycosylated, and under non-reducing conditions, it forms oligomers (Pastorekova, 1992). Sequence analysis of the predicted CAIX protein shows that it contains a signal peptide (aa1-37), an extracellular (EC) portion (aa38-414), a hydrophobic transmembrane region of 20 amino acids (aa415-434), and a small C-terminal extracellular portion of 25 amino acids (aa435-459). The human and mouse CAIX amino acid sequences are shown in Figure 59. The extracellular portion is composed of two distinct domains. The region between the signal peptide and the CA domain (aa53-111) shows significant homology (38% identity) with the keratan sulfate attachment domain of aggrecan, a large aggregating proteoglycan in humans (Doege, 1991). In the PG-like domain of CAIX, a hexapeptide motif with the consensus EEDLPE (sequence number [ ]) is repeated seven times. The carbonic anhydrase domain is located close to the plasma membrane (aa135-391). CAIX antigen appears during malignant transformation and stains positive in approximately 95% of clear cell RCC specimens, as well as in most renal cell metastases.

[0077] Epitopes expressed on the cell surface of tumor cells are excellent targets for humoral anticancer therapy because, unlike intracellular antigens, they are accessible to circulating antibodies in vivo. Human monoclonal antibodies (mAbs) have become a well-tolerated treatment option in a growing number of cancers. The concept of selective tumor targeting by antibodies is based on the avid interaction between antibodies and antigens expressed on malignant cells but not on normal tissues. Many mechanisms have been proposed for the ability of antibodies against tumors to mediate their effects in vivo. For example, the engagement of antibody Fc domains with effector cell FcγRs leads to antibody-dependent cell-mediated cytotoxicity (ADCC). Some (antagonistic or inhibitory) antibodies can block signaling on tumor cells and, in this way, may act synergistically with immune effector responses by making tumor cells more susceptible to apoptotic or lytic cell death triggered by immune effector cells (Baselga, 1998). Another way that antibodies can be utilized is through the construction and functional expression of chimeric immune receptors or "T-bodies" on T-lymphocytes, otherwise known as "designer T-cells". The antigen-binding domain of the chimeric receptor can consist of the antigen-binding domain, e.g., a single-chain antibody (scFv), while the intracellular signaling domain is derived from the cell membrane portion of the membrane-bound receptor, which can induce cell activation (Maher, 2002; Pinthus, 2003). T-lymphocytes engrafted with chimeric receptors have the combined advantages of MHC-independent and antibody-based antigen binding with efficient T-cell activation upon specific binding to the receptor ligand. This activation results in the production and secretion of cytokines such as IL-2, interferon, GM-CSF, and TNF-α. Antigen-specific lysis of tumor cells has been reported both in vitro and in vivo. T-lymphocytes can be permanently engrafted with antigen-specific chimeric receptors by retroviral transduction of vector constructs encoding the receptor molecule of choice (reviewed by Riviere, 2004).

[0078] Embodiments of the invention can include isolated human monoclonal antibodies or fragments thereof that immunospecifically bind to carbonic anhydrase IX (G250) protein. Such antibodies can reduce the carbonic anhydrase activity of the protein. For example, such anti-CAIX antibodies can include those described in WO2007 / 065027 and US8,466,263, each of which is incorporated herein by reference in its entirety. See, for example, FIG. 58, which provides a multiple alignment of amino acid sequences of anti-carbonic anhydrase IX (G250) scFv clones. For example, embodiments of the invention include single chain antibodies, such as scFv G6, G9, G10, G17, G21, G27, G28, G36, G37, G39, G40, G45, G57, G62, G98, G104, G119, or G125, as well as any other scFvs identified according to the methods disclosed herein.

[0079] For example, the amino acids of the CDRs of anti-CAIX antibodies are shown in Table 1.

[0080] (Table 1) TIFF0007649239000001.tif211154TIFF0007649239000002.tif63154

[0081] For example, the amino acid sequences of the VH and VL regions of anti-CAIX antibodies are shown in Table 2.

[0082] (Table 2) TIFF0007649239000003.tif139154TIFF0007649239000004.tif231154TIFF0007649239000005.tif231154TIFF0007649239000006.tif105154

[0083] Embodiments can also include consensus sequences of any of the amino acid sequences described herein, for example, if four or more clones have the same amino acid at a given position, then that position in the consensus is designated by that amino acid.

[0084] CD70 CD70 is found on the surface of tumor cells of the kidney (e.g., clear cell carcinoma and papillary carcinoma), pancreas, larynx or pharynx, melanoma, ovary, lung adenocarcinoma, colon, breast, and brain. See, e.g., British Journal of Cancer 103 (2010) 676-684.

[0085] Embodiments of the invention can include isolated human monoclonal antibodies or fragments thereof that immunospecifically bind to CD70. For example, embodiments of the invention include single chain antibodies such as scFv A20, B2, B3, B5, B7, B8, or B9, as well as any other scFv identified according to the methods disclosed herein.

[0086] For example, the amino acids of the CDRs of anti-CD70 antibodies are shown in Table 3.

[0087] (Table 3) TIFF0007649239000007.tif71154

[0088] For example, the amino acid sequences of the VH and VL regions of anti-cd70 antibodies are shown in Table 4.

[0089] (Table 4) TIFF0007649239000008.tif178154

[0090] Embodiments can also include consensus sequences of any of the amino acid sequences described herein, for example, if four or more clones have the same amino acid at a given position, then that position in the consensus is designated by that amino acid.

[0091] cell An embodiment of the present disclosure includes cells expressing a CAR (i.e., CART). The cells can be of any type, including immune cells capable of expressing a CAR for cancer therapy, or cells such as bacterial cells carrying an expression vector encoding a CAR. As used herein, the terms "cell," "cell line," and "cell culture" can be used interchangeably. All of these terms also include their progeny, which are any subsequent generations. All progeny may not be identical, for example, due to deliberate or inadvertent mutations. In the context of expressing a heterologous nucleic acid sequence, a "host cell" can refer to a eukaryotic cell capable of replicating a vector and / or expressing a heterologous gene encoded by the vector. Host cells can and have been used as recipients of vectors. Host cells may be "transfected" or "transformed," which refers to the process by which exogenous nucleic acid is transferred or introduced into a host cell. A transformed cell includes a primary subject cell and its progeny. As used herein, the terms "engineered" and "recombinant" cells or host cells can refer to cells into which an exogenous nucleic acid sequence, such as a vector, has been introduced. Thus, recombinant cells are distinguishable from naturally occurring cells that do not contain recombinantly introduced nucleic acids. In an embodiment of the present invention, the host cells are T cells, including cytotoxic T cells (also known as TCs, cytotoxic T lymphocytes, CTLs, T killer cells, cytolytic T cells, CD8+ T cells, or killer T cells), and NK cells and NKT cells are also encompassed by the present disclosure.

[0092] Some vectors may use control sequences that allow them to be replicated and / or expressed in both prokaryotic and eukaryotic cells. Those skilled in the art will further understand the conditions under which all of the above host cells are incubated to maintain them and allow the replication of the vector. Also understood and known are the techniques and conditions that allow the large-scale production of vectors, and the production of nucleic acids and their cognate polypeptides, proteins, or peptides encoded by the vectors.

[0093] The cells may be autologous, syngeneic, allogeneic or, in some cases, xenogeneic.

[0094] There are many situations in which it may be desirable to be able to kill modified CTLs, such as when it is desired to terminate treatment, when cells become tumorigenic, in studies in which the absence of a cell after its presence is of interest, or for other reasons. For this purpose, one can provide for the expression of a particular gene product capable of killing modified cells under controlled conditions, such as an inducible suicide gene.

[0095] Armed CART The present invention further includes CARTs modified to secrete one or more polypeptides. Such CARTs may be referred to as CART factories, CAR T cell factories, or armed CARTs. The polypeptides may be, for example, antibodies or fragments thereof as described herein. For example, the polypeptides may be antibodies or cytokines. In embodiments, the antibodies are specific for TIGIT, CAIX, GITR, PD-L1, PD-L2.PD-1, CCR4, CTLA-4, VISTA, or CD70. For example, the CAR T cell factories may secrete PD-L1 mAb locally at tumor sites to restore effective anti-cancer immunity and / or reverse T cell exhaustion. In embodiments, the armed CARTs secrete IL-12, IL-15, or IL-18.

[0096] For example, a second expression construct, which may be on the same DNA vector as that encoding the CAR (e.g., antigen recognition domain) or on a second separate vector, can be used to encode a minibody (scFv-Fc) or an antibody or fragment thereof directed to a single or multiple antigens of interest and can be cloned after an internal ribosome entry site (IRES). Referring to the figure, the second expression cassette contains either a fluorescent molecule or an immunomodulatory minibody.

[0097] Armed CART has the advantage of simultaneously secreting polypeptides at the target site, e.g., tumor site. For example, armed CART can secrete anti-TIGIT antibodies or fragments thereof. TIGIT is a T cell co-inhibitory receptor that limits anti-tumor and other T cell-dependent chronic immune responses, such as CD8+ T cell-dependent immune responses. TIGIT is expressed on a subset of activated T cells and natural killer (NK) cells. For example, TIGIT is highly expressed on tumor-infiltrating T cells. In cancer models, antibody blockade of TIGIT contributed to enhanced CD8+ T cell effector function and tumor clearance.

[0098] In embodiments, the armed CART anti-TIGIT antibody comprises one or more of the anti-TIGIT antibody clones (or fragments thereof, e.g., FR1, FR2, FR3, FR4, CDR1, CDR2, CDR3, or any combination of framework and / or CDR regions therein) described in Figure 81.

[0099] For example, an anti-TIGIT antibody can include a CDR1 of a VH region having the sequence GYTF....TSYG (SEQ ID NO: [ ]), a CDR2 of a VH region having the sequence ISAY..NGNT (SEQ ID NO: [ ]), a CDR3 of a VH region having the sequence ARDPGLWFGLTHDYYFDY (SEQ ID NO: [ ]), a CDR1 of a VL region having the sequence SSNI....GSNT (SEQ ID NO: [ ]), a CDR2 of a VL region having the sequence RN.......N (SEQ ID NO: [ ]), and a CDR3 of a VL region having the sequence AAWDDSRSGPV (SEQ ID NO: [ ]).

[0100] For example, an anti-TIGIT antibody can include a CDR1 of a VH region having the sequence GFTF....SDYS (SEQ ID NO: [ ]), a CDR2 of a VH region having the sequence INSD..GSRT (SEQ ID NO: [ ]), a CDR3 of a VH region having the sequence ARGPGFFGFDI (SEQ ID NO: [ ]), a CDR1 of a VL region having the sequence RSNI....GRNS (SEQ ID NO: [ ]), a CDR2 of a VL region having the sequence SN.......N (SEQ ID NO: [ ]), and a CDR3 of a VL region having the sequence AAWDARLTGPL (SEQ ID NO: [ ]).

[0101] For example, an anti-TIGIT antibody can include a CDR1 of a VH region having the sequence GYSF....TNYW (SEQ ID NO: [ ]), a CDR2 of a VH region having the sequence INPV..NSRT (SEQ ID NO: [ ]), a CDR3 of a VH region having the sequence ARYYYYAMEV (SEQ ID NO: [ ]), a CDR1 of a VL region having the sequence SSNI....GSNT (SEQ ID NO: [ ]), a CDR2 of a VL region having the sequence RN.......N (SEQ ID NO: [ ]), and a CDR3 of a VL region having the sequence EAWDDSLNGPV (SEQ ID NO: [ ]).

[0102] For example, an anti-TIGIT antibody can include a CDR1 of a VH region having the sequence GYTF....TNYG (SEQ ID NO: [ ]), a CDR2 of a VH region having the sequence VDNN..NGNI (SEQ ID NO: [ ]), a CDR3 of a VH region having the sequence ARGLFSSRWYLWFDP (SEQ ID NO: [ ]), a CDR1 of a VL region having the sequence SSDVG...GYNY (SEQ ID NO: [ ]), a CDR2 of a VL region having the sequence EV.......T (SEQ ID NO: [ ]), and a CDR3 of a VL region having the sequence SSYTRSSTSYVV (SEQ ID NO: [ ]).

[0103] For example, an anti-TIGIT antibody can include a CDR1 of a VH region having the sequence GGTF....SSYA (SEQ ID NO: [ ]), a CDR2 of a VH region having the sequence ILPM..FGST (SEQ ID NO: [ ]), a CDR3 of a VH region having the sequence ARGRDIVAPSNSGFDV (SEQ ID NO: [ ]), a CDR1 of a VL region having the sequence SNNV...GNQG (SEQ ID NO: [ ]), a CDR2 of a VL region having the sequence RN.......D (SEQ ID NO: [ ]), and a CDR3 of a VL region having the sequence SAYDRSLNAWV (SEQ ID NO: [ ]).

[0104] In other embodiments, the armed CART can secrete an anti-PDL1 antibody or a fragment thereof. For example, the armed CART can secrete an anti-PDL1 antibody or a fragment thereof disclosed in Provisional Patent Application No. 62 / 624,455, the entirety of which is incorporated herein by reference. Exemplary anti-PDL1 antibodies include antibodies having a VH amino acid sequence with SEQ ID NO: [ ] and / or a VL amino acid sequence with SEQ ID NO: [ ]. See, for example, Figure 78 and Figure 81.

[0105] In embodiments, the armed CART anti-PDL1 antibody comprises one or more of the anti-PDL1 antibody clones (or fragments thereof, e.g., FR1, FR2, FR3, FR4, CDR1, CDR2, CDR3, or any combination of the framework and / or CDR regions therein) described in Figure 78 and / or Figure 81.

[0106] For example, the amino acid sequences of the heavy and light chain complementarity determining regions of the PDL-1 antibody are as follows: TIFF0007649239000009.tif129134

[0107] For example, an anti-PDL1 antibody has a heavy chain having three CDRs each comprising the amino acid sequences of SEQ ID NOs: [ ], [ ], and / or [ ], and a light chain having three CDRs each comprising the amino acid sequences of SEQ ID NOs: [ ], [ ], and / or [ ].

[0108] In other embodiments, the armed CART can secrete an anti-PD1 antibody or a fragment thereof. Exemplary anti-PD1 antibodies include antibodies having a VH amino acid sequence with SEQ ID NO: [ ] and a VL amino acid sequence with SEQ ID NO: [ ]. See, for example, Figure 78 and Figure 83.

[0109] In embodiments, the armed CART anti-PD1 antibody comprises one or more of the anti-PD1 antibody clones (or fragments thereof, e.g., FR1, FR2, FR3, FR4, CDR1, CDR2, CDR3, or any combination of framework and / or CDR regions therein) set forth in Figure 78 and Figure 83. For example, the anti-PD1 antibody has a heavy chain having three CDRs comprising the amino acid sequences of SEQ ID NOs: [ ], [ ], and / or [ ], respectively, and a light chain having three CDRs comprising the amino acid sequences of SEQ ID NOs: [ ], [ ], and / or [ ], respectively. See, e.g., Figure 78 and Figure 83.

[0110] In embodiments, the amino acid sequences of the heavy and light chain complementarity determining regions of the PD-1 antibody are shown below. The heavy chain of the PD-1 antibody (V H ) complementarity determining region (CDR) TIFF0007649239000010.tif114134PD-1 antibody light chain (V L ) complementarity determining region (CDR) TIFF0007649239000011.tif114134

[0111] In other embodiments, the armed CART can secrete an anti-CCR4 antibody or fragment thereof. For example, the armed CART can secrete an anti-CCR4 antibody or fragment thereof as described in WO2009 / 086514, WO2013 / 166500, PCT / US2015 / 054202, or PCT / US2016 / 026232.

[0112] For example, an armed CART anti-CCR4 protein antibody or fragment thereof can include an antibody having a VH CDR1 region having the amino acid sequence GYTFASYY (SEQ ID NO: [ ]), a VH CDR2 region having the amino acid sequence WINPGNVNTKYNEKFKG (SEQ ID NO: [ ]), a VH CDR3 region having the amino acid sequence STYYRPLDY (SEQ ID NO: [ ]), and / or a VL CDR1 region having the amino acid sequence KSSQSILYSSNQKNYLA (SEQ ID NO: [ ]), a VL CDR2 region having the amino acid sequence WASTRES (SEQ ID NO: [ ]), and / or a VL CDR3 region having the amino acid sequence HQYLSSYT (SEQ ID NO: [ ]).

[0113] For example, the armed CAR may comprise an anti-CCR4 protein antibody or a fragment thereof having the VH amino acid sequence TIFF0007649239000012.tif22148 (SEQ ID NO: [ ]) and / or the VL amino acid sequence The antibody may include the antibody having TIFF0007649239000013.tif13148 (sequence number [ ]).

[0114] For example, an armed CART anti-CCR4 protein antibody or fragment thereof can include an antibody having:

[0115] VH chain of antibody 1-44 (SEQ ID NO: [ ]) TIFF0007649239000014.tif22149

[0116] VL chain of antibody 1-44 (SEQ ID NO: [ ]) TIFF0007649239000015.tif13148

[0117] VH chain of antibody 1-49 (SEQ ID NO: [ ]) TIFF0007649239000016.tif22150

[0118] VL chain of antibody 1-49 (SEQ ID NO: [ ]) TIFF0007649239000017.tif13145

[0119] VH chain of antibody 2-1 (SEQ ID NO: [ ]) TIFF0007649239000018.tif22149

[0120] VL chain of antibody 2-1 (SEQ ID NO: [ ]) TIFF0007649239000019.tif13148

[0121] VH chain of antibody 2-2 (SEQ ID NO: [ ]) TIFF0007649239000020.tif22148

[0122] VL chain of antibody 2-2 (SEQ ID NO: [ ]) TIFF0007649239000021.tif13148

[0123] VH chain of antibody 2-3 (SEQ ID NO: [ ]) TIFF0007649239000022.tif22149

[0124] VL chain of antibody 2-3 (SEQ ID NO: [ ]) TIFF0007649239000023.tif13148

[0125] The amino acid sequences of the complementarity determining regions of the heavy and light chains of the anti-CCR4 antibodies are shown in the table below. TIFF0007649239000024.tif135133

[0126] Armed CARTs can be constructed by including a nucleic acid encoding a polypeptide of interest after the intracellular signaling domain. In embodiments, there is an internal ribosome entry site (IRES) located between the intracellular signaling domain and the polypeptide of interest. Those skilled in the art can understand that multiple IRES sequences can be used in tandem to express more than one polypeptide.

[0127] In one embodiment, the methods and compositions presented herein provide target-specific T cells, such as T cells with specificity for CAIX and / or CD70, with the ability to secrete polypeptides in the tumor microenvironment, for example to combat T cell exhaustion. For example, myeloid-derived suppressor cells (MDSCs) are a heterogeneous population of early myeloid progenitors, immature granulocytes, macrophages, and dendritic cells at different stages of differentiation that constitute the tumor microenvironment. MDSCs are induced by proinflammatory cytokines and are found in large numbers in infectious and inflammatory pathologies. Without wishing to be bound by theory, their presence in the tumor microenvironment indicates a causative role in promoting tumor-associated immunosuppression. Human MDSCs express Siglec-3 / CD33 (GENBANK accession numbers NM_001772.4 (nucleotide sequence) and NP_001763.3 (amino acid sequence)) and have heterogeneous expression of CD14 (GENBANK accession numbers NM_000591.4 (nucleotide sequence) and NP_000582.1 (amino acid sequence)) and CD15 (GENBANK accession numbers NM_002033.3 (nucleotide sequence) and NP_002024.1 (amino acid sequence)), indicating the existence of multiple subsets.Other MDSC markers useful for identifying MDSCs include B7-1 / CD8 (NM_001145873.1 (nucleotide sequence), NP_001139345.1 (amino acid sequence)), CCR2 (NM_001123041.2 (nucleotide sequence), NP_001116513.2 (amino acid sequence)), CD1d (NM_001766.3 (nucleotide sequence), NP_001757.1 (amino acid sequence)), CD2 (NM_001328609.2 (nucleotide sequence), NP_001315538.1 (amino acid sequence)), CD31 / PECAM-1 (NM_000442.5 (nucleotide sequence), NP_000433 .4 (amino acid sequence)), CD43 (NM_001030288.3 (nucleotide sequence), NP_001025459.1 (amino acid sequence)), CD44 (NM_000610.4 (nucleotide sequence), NP_000601.3 (amino acid sequence)), gp130 (NM_002184.4 (nucleotide sequence), NP_002175.2 (amino acid sequence)), PD-L1 (NM_014143.4 (nucleotide sequence), NP_054862.1 (amino acid sequence)), and CD162 (NM_001206609.2 (nucleotide sequence), NP_001193538.1 (amino acid sequence)).

[0128] In one embodiment, the methods and compositions presented herein provide target-specific T cells, such as T cells with specificity for CAIX and / or CD70, capable of secreting polypeptides that target MDSCs in the tumor microenvironment. For example, the secreted polypeptides can target one or more MDSC markers (e.g., CD33, CD14, and / or CD15, or other MDSC markers listed herein).

[0129] Introduction of constructs into CTLs The expression vector encoding the CAR can be introduced as one or more DNA molecules or constructs, in which at least one marker can be present that allows for selection of host cells that contain the construct(s).

[0130] The constructs can be prepared by conventional methods, and the genes and regulatory regions can be isolated, ligated, cloned into a suitable cloning host, and analyzed by restriction or sequencing or other convenient means, as appropriate. In particular, PCR can be used to separate individual fragments containing all or part of the functional units, and one or more mutations can be introduced using "primer repair", ligation, in vitro mutagenesis, etc., as appropriate. The construct(s) once completed and demonstrated to have the appropriate sequence can then be introduced into the CTL by any convenient means. The constructs may be incorporated and packaged for infection or transduction into cells, such as non-replicating defective viral genomes, such as adenovirus, adeno-associated virus (AAV), herpes simplex virus (HSV), or retroviral or lentiviral vectors. The constructs may include viral sequences for transfection. Alternatively, the constructs may be introduced by fusion, electroporation, biolistic methods, transfection, lipofection, etc. The host cells can be grown and expanded in culture prior to introducing the construct(s), after which the construct(s) are introduced and treated appropriately to integrate the construct(s). The cells are then expanded and screened for the marker present in the construct. Various markers that can be used successfully include hprt, neomycin resistance, thymidine kinase, hygromycin resistance, etc.

[0131] In some cases, when the construct is integrated into a specific locus, it may have a target site for homologous recombination.For example, it can knock out an endogenous gene and replace it (at the same locus or elsewhere) with the gene encoded by the construct using materials and methods known in the art for homologous recombination.For homologous recombination, it can use either .OMEGA. or O-vector.See, for example, Thomas and Capecchi, Cell (1987) 51, 503-512; Mansour, et al., Nature (1988) 336, 348-352, and Joyner, et al., Nature (1989) 338, 153-156.

[0132] The construct can be introduced as a single DNA molecule that encodes at least CAR and optionally another gene, or as different DNA molecules that have one or more genes.Other genes include, for example, genes that encode therapeutic molecules or suicide genes.The constructs can be introduced simultaneously or sequentially, each with the same or different markers.

[0133] Vectors that contain useful elements, such as bacterial or yeast origins of replication, selectable and / or amplifiable markers, promoter / enhancer elements for expression in prokaryotes or eukaryotes, that can be used to prepare construct DNA stocks and perform transfections, are well known in the art and many are commercially available.

[0134] How to use Aspects of the present disclosure are directed to methods of treating a subject suffering from cancer.

[0135] For example, embodiments of the present disclosure are directed to methods of killing cancer cells, such as renal cancer cells. With reference to Figure 12, for example, B7-GGGGS-G36 CAR T cells had more killing activity against target renal cancer cells (CAIX+CD70+) than non-target cells (CAIX+CD70-, CAIX-CD70+, CAIX-CD70-). Furthermore, with reference to Figure 57, for example, bispecific split CARs achieved superior killing when compared to mono- or bispecific CARs.

[0136] Aspects of the present disclosure are further directed to methods of halting or reducing the progression of, or promoting the regression of, cancer in a subject.

[0137] Still further, embodiments of the present disclosure are directed to a method of reducing cell proliferation of cancer cells in a subject. See, e.g., FIG.

[0138] "Cancer" and "cancerous" can refer to or describe, for example, a physiological state of a mammal characterized by unregulated cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More specific examples of such cancer include squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, lung adenocarcinoma, lung squamous cell carcinoma, peritoneal cancer, hepatocellular carcinoma, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine cancer, salivary gland cancer, kidney cancer, liver cancer, prostate cancer, vulvar cancer, thyroid cancer, liver cancer, and various types of head and neck cancer. For example, the cancer is renal cell carcinoma, such as ccRCC.

[0139] In cancer, normal cell-cell interactions within tissues are disrupted, and the tumor microenvironment evolves to accommodate the growing tumor. The tumor microenvironment (TME) can refer to the cellular environment in which the tumor resides, including components such as surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules, and the extracellular matrix (ECM). The tumor microenvironment is complex and is strongly influenced by the immune system.

[0140] The present invention provides, inter alia, CAR-T cell therapy for renal cell carcinoma (such as those described herein).Secretion of monospecific, bispecific, or trispecific minibodies, antibodies, or minibody / antibody fusion proteins by CAR-T cells at the tumor site may provide additional benefit by altering (i.e., modulating) the immunosuppressive tumor microenvironment.

[0141] In embodiments, the methods include administering to a subject suffering from cancer a therapeutically effective amount of the engineered cells described herein, which may depend on the severity and course of the cancer, previous treatments, the subject's health status, weight, response to drugs, and the judgment of the attending physician.

[0142] The subject may be afflicted with cancer, such as a liquid cancer (i.e., a blood cancer) and / or a solid cancer (i.e., a tumor). The cancer may be benign or malignant, and may be influenced by the immune system.

[0143] The embodiments described herein can modulate the immune system to treat a subject suffering from cancer. "Modulating" can refer to upregulation, induction, stimulation, enhancement, and / or release of inhibition, as well as inhibition, attenuation, and / or downregulation or suppression. In embodiments, the activity of the subject's immune system is modulated, or the microenvironment surrounding the cancer cells and / or tumor is modulated, or both. For example, the embodiments described herein can change the immunosuppressive tumor microenvironment, reduce microenvironment-dependent immunosuppression, and modulate (or enable) the immune system to kill tumor cells.

[0144] One embodiment is directed to the method of treating the subject suffering from renal cell carcinoma.Immunotherapy such as that described herein provides a great treatment option for RCC.For example, an embodiment includes engineering chimeric antigen receptor (CAR) T cells for RCC.

[0145] An "individual" or "subject" may be a mammal. Mammals include, but are not limited to, domestic animals (e.g., cows, sheep, cats, dogs, horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human.

[0146] The cells according to the present disclosure can be used to treat cancer in a patient in need of such treatment. In another embodiment, the isolated cells according to the present invention can be used in the manufacture of a medicament for the treatment of cancer, autoimmune disorders, viral infections in a patient in need of such treatment.

[0147] The present disclosure relies on a method for treating a patient in need of cancer treatment, the method comprising at least one of the following steps: (a) providing a chimeric antigen receptor cell according to the present invention, and (b) administering the cell to the patient.

[0148] The treatment can be ameliorative, curative or preventative.It can be part of autoimmunotherapy or part of allogeneic immunotherapy treatment.Autologous means that the cell, cell line or cell population used for the treatment of a patient is derived from the patient or from a human leukocyte antigen (HLA)-matched donor.Allogeneic means that the cell or cell population used for the treatment of a patient is derived from a donor, not from the patient.

[0149] The present invention is particularly suitable for allogeneic immunotherapy, inasmuch as it allows the transformation of T cells obtained from a donor into non-allo-reactive cells. This can be carried out under standard protocols and can be replicated as many times as necessary. The resulting modified T cells can be pooled and administered to one or several patients, making them available as an "off the shelf" therapeutic product.

[0150] The cells that can be used in the disclosed method are described in the previous section. The treatment can be used to treat patients diagnosed with cancer. The cancers that can be treated include tumors that are not vascularized or are not yet substantially vascularized, as well as vascularized tumors. The cancers can include non-solid tumors (e.g., hematological tumors, such as leukemia and lymphoma) or can include solid tumors. The types of cancers that can be treated with the CAR of the present invention include, but are not limited to, carcinomas, blastomas, and sarcomas, as well as certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignant tumors, such as sarcomas, carcinomas, and melanomas. Adult tumors / cancers and pediatric tumors / cancers are also included.

[0151] It may be a combination treatment with one or more therapies against cancer selected from the group of antibody therapy, chemotherapy, cytokine therapy, dendritic cell therapy, gene therapy, hormone therapy, laser phototherapy and radiation therapy.

[0152] According to an embodiment of the present invention, the treatment can be administered to a patient undergoing immunosuppressive treatment. The present invention uses cells or cell populations that are made tolerant to at least one immunosuppressant due to inactivation of a gene encoding a receptor for the immunosuppressant. In this aspect, the immunosuppressive treatment should aid in the selection and expansion of T cells according to the present invention in the patient.

[0153] In further embodiments, the cell composition of the present invention is administered to the patient in combination with (e.g., before, simultaneously with, or after) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as fludarabine, external beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAM PATH. In another embodiment, the cell composition of the present invention is administered after B-cell ablative therapy, such as agents that react with CD20, e.g., Rituxan. For example, in one embodiment, the subject can receive standard treatment with high-dose chemotherapy followed by a peripheral blood stem cell transplant. In certain embodiments, after transplantation, the subject receives an infusion of the expanded immune cells of the present invention. In further embodiments, the expanded cells are administered before or after surgery. The modified cells obtained by any of the methods described herein can be used in certain embodiments of the invention for treating patients in need of treatment for host-versus-graft (HvG) rejection and graft-versus-host disease (GvHD), and therefore within the scope of the invention is a method of treating a patient in need of treatment for host-versus-graft (HvG) rejection and graft-versus-host disease (GvHD), comprising treating the patient by administering to the patient an effective amount of modified cells comprising an inactivated TCR alpha and / or TCR beta gene.

[0154] Cell administration The present disclosure is particularly suitable for allogeneic immunotherapy insofar as it allows the transformation of T cells obtained from a donor into non-allo-reactive cells. This can be carried out under standard protocols and can be replicated as many times as necessary. The resulting modified T cells can be pooled and administered to one or several patients, making them available as an "off the shelf" therapeutic product.

[0155] Depending on the nature of the cells, the cells can be introduced into a host organism, e.g., a mammal, in a wide variety of ways. In certain embodiments, the cells can be introduced into the site of a tumor, while in alternative embodiments, the cells are hone or modified to be hone into cancer. The number of cells used depends on various circumstances, the purpose of the introduction, the lifespan of the cells, the protocol used, e.g., number of administrations, ability of the cells to grow, stability of the recombinant construct, etc. The cells can be applied, for example, as a dispersion injected at or near the site of interest. The cells can be in a physiologically acceptable medium.

[0156] In some embodiments, the cells are encapsulated to inhibit immune recognition and are located at the site of the tumor.

[0157] The cells can be administered as desired. A variety of protocols can be used depending on the desired response, the method of administration, the longevity of the cells, and the number of cells present. The number of administrations will depend, at least in part, on the factors listed above.

[0158] Administration of the cells or cell populations according to the invention can be by any convenient method, including aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein can be administered to a patient subcutaneously, intradermally, intratumorally, intranodal, intramedullary, intramuscular, intravenous or intralymphatic injection, or intraperitoneally. In one embodiment, the cell compositions of the invention are administered by intravenous injection.

[0159] Administration of the cells or cell population can consist of administration of 104-109 cells per kg of body weight, for example, 105-106 cells / kg of body weight, including all integer values ​​of cell numbers within these ranges. The cells or cell population can be administered in one or more doses. In another embodiment, the effective amount of cells is administered as a single dose. In another embodiment, the effective amount of cells is administered as two or more doses over a period of time. The timing of administration is within the discretion of the attending physician and depends on the clinical condition of the patient. The cells or cell population can be obtained from any source, such as a blood bank or a donor. While individual needs vary, the determination of the optimal range of effective amounts of a given cell type for a particular disease or condition is within the skill of the art. An effective amount means an amount that provides a therapeutic or prophylactic benefit. The dosage administered will depend on the age, health and weight of the recipient, the type of concurrent treatment, if any, the frequency of treatment and the nature of the desired effect.

[0160] It will be appreciated that the system is subject to many variables that may change over time and circumstances, such as cellular response to ligand, expression efficiency and, where appropriate, secretion levels, activity of the expressed product, the specific needs of the patient, loss of cells or the rate of loss of cellular activity as a result of expression activity of individual cells, etc. Thus, with regard to individual patients, even if there are universal cells that can be administered to the entire population, each patient will be monitored for appropriate individual dosing, and such practices of monitoring patients are routine in the art.

[0161] Nucleic Acid-Based Expression Systems The CAR of the present disclosure can be expressed from an expression vector. Recombinant techniques for producing such expression vectors are well known in the art.

[0162] The DNA constructs described herein, which may also be referred to as "DNA vectors", can be cloned into vectors used to transduce and produce chimeric antigen receptor T cells that secrete polypeptides and / or fragments thereof. For example, the DNA constructs can be cloned into lentiviral vectors for the production of lentiviruses that are used to transduce and produce chimeric antigen receptor T cells that secrete monospecific, bispecific, or trispecific immunomodulatory antibodies / minibodies and / or antibody fusion proteins at tumor sites.

[0163] vector The term "vector" can refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated. The nucleic acid sequence can be "exogenous", meaning that it is foreign to the cell into which it is introduced, or that the sequence is homologous to a sequence in the cell, but is in a location within the host cell nucleic acid where the sequence is not normally found. Vectors include plasmids, cosmids, viruses (bacteriophages, animal viruses, and plant viruses), artificial chromosomes (YACs, etc.). Those skilled in the art will be well equipped to construct vectors using standard recombinant techniques (see, for example, Maniatis et al., 1988 and Ausubel et al., 1994, both of which are incorporated herein by reference).

[0164] The term "expression vector" refers to any type of genetic construct that contains a nucleic acid that encodes an RNA that can be transcribed. In some cases, the RNA molecule is then translated into a protein, polypeptide, or peptide. In other cases, these sequences are not translated, for example, in the production of antisense molecules or ribozymes. Expression vectors can contain a variety of "control sequences," which refer to nucleic acid sequences necessary for the transcription and translation of an operably linked coding sequence in a particular host cell. In addition to control sequences that govern transcription and translation, vectors and expression vectors can contain nucleic acid sequences that also perform other functions, as described below.

[0165] Promoters and Enhancers A "promoter" is a control sequence that is a region of a nucleic acid sequence where the initiation and rate of transcription are controlled. It can contain genetic elements to which regulatory proteins and molecules, such as RNA polymerase and other transcription factors, bind to initiate specific transcription of a nucleic acid sequence. The phrases "operably arranged," "operably linked," "under control," and "under transcriptional control" mean that the promoter is in the correct functional location and / or orientation with respect to a nucleic acid sequence to control the initiation and / or expression of the transcription of that sequence.

[0166] Promoters contain sequences that function to position the start site for RNA synthesis. The best known example of this is the TATA box, but in some promoters lacking a TATA box, for example the promoters of the mammalian terminal deoxynucleotidyl transferase gene and the promoters of the SV40 late genes, separate elements that cover the start site themselves help to anchor the start location. Additional promoter elements regulate the frequency of transcription initiation. These are located in the region 30-110 bp upstream of the start site, but some promoters have been shown to contain functional elements downstream of the start site as well. To place a coding sequence "under the control" of a promoter, the 5' end of the transcription start site of the transcriptional reading frame is placed "downstream" (i.e., 3') of the selected promoter. The "upstream" promoter stimulates transcription of the DNA, promoting expression of the encoded RNA.

[0167] In many cases, the spacing between promoter elements is flexible, so that promoter function is maintained even if elements are inverted or moved relative to one another. In the tk promoter, the spacing between promoter elements can be increased by up to 50 bp before activity begins to decline. Depending on the promoter, individual elements appear to be able to function either cooperatively or independently to activate transcription. Promoters may or may not be used in combination with "enhancers," which refer to cis-acting regulatory sequences involved in the transcriptional activation of a nucleic acid sequence.

[0168] A promoter may be one that is naturally associated with a nucleic acid sequence, such as may be obtained by isolating 5 prime' non-coding sequences located upstream of a coding segment and / or exon. Such a promoter may be referred to as "endogenous". Similarly, an enhancer may be one that is naturally associated with a nucleic acid sequence, located either downstream or upstream of that sequence. Alternatively, certain advantages may be obtained by placing a coding nucleic acid segment under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with a nucleic acid sequence in its natural environment. A recombinant or heterologous enhancer also refers to an enhancer that is not normally associated with a nucleic acid sequence in its natural environment. Such promoters or enhancers may include promoters or enhancers of other genes, and promoters or enhancers isolated from other viruses, or from prokaryotic or eukaryotic cells, and promoters or enhancers that are "non-naturally occurring", i.e., that contain different elements of different transcriptional regulatory regions, and / or mutations that alter expression. For example, promoters most commonly used in recombinant DNA construction include the lactamase (penicillinase), lactose and tryptophan (trp) promoter systems. In addition to producing promoter and enhancer nucleic acid sequences synthetically, the sequences may be produced using recombinant cloning and / or nucleic acid amplification techniques, including PCR™, in conjunction with the compositions disclosed herein (see U.S. Patent Nos. 4,683,202 and 5,928,906, each of which is incorporated herein by reference). Additionally, control sequences that direct transcription and / or expression of sequences in non-nuclear organelles, such as mitochondria, chloroplasts, etc., may be used as well.

[0169] Of course, it will be important to use a promoter and / or enhancer that effectively directs the expression of the DNA segment in the organelle, cell type, tissue, organ, or organism selected for expression. Those skilled in the art of molecular biology are generally aware of the use of promoter, enhancer, and cell type combinations for protein expression (see, for example, Sambrook et al. 1989, incorporated herein by reference). The promoter used may be constitutive, tissue-specific, inducible, and / or useful under appropriate conditions to direct high-level expression of the introduced DNA segment, which is advantageous for large-scale production of recombinant proteins and / or peptides. The promoter may be heterologous or endogenous.

[0170] Additionally, any combination of promoters / enhancers can be used to drive expression. The use of T3, T7, or SP6 cytoplasmic expression systems is another embodiment. Eukaryotic cells can support cytoplasmic transcription from certain bacterial promoters if the appropriate bacterial polymerase is provided as part of the delivery complex or as an additional gene expression construct.

[0171] The identity of tissue-specific promoters or elements, as well as assays to characterize their activity, are well known to those of skill in the art.

[0172] Specific initiation signals may also be required for efficient translation of the coding sequence. These signals include the ATG initiation codon or adjacent sequences. Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would be able to readily determine this and provide the necessary signals.

[0173] In certain embodiments of the present disclosure, the use of internal ribosome entry site (IRES) elements is used to create multigenic, or polycistronic, messages, which can be used in the present invention.

[0174] A vector can contain a multiple cloning site (MCS), a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used to digest the vector in conjunction with standard recombinant techniques. "Restriction enzyme digestion" refers to the catalytic cleavage of a nucleic acid molecule by an enzyme that functions only at a specific location in the nucleic acid molecule. Many of these restriction enzymes are commercially available. The use of such enzymes is widely understood by those of skill in the art. Often, restriction enzymes that cut within the MCS are used to linearize or fragment a vector so that an exogenous sequence can be ligated into the vector. "Ligation" refers to the process of forming a phosphodiester bond between two nucleic acid fragments, which may or may not be adjacent to each other. Techniques involving restriction enzymes and ligation reactions are well known to those of skill in the art of recombinant technology.

[0175] Splice sites, termination signals, origins of replication, and selectable markers may also be used.

[0176] Plasmid vectors In certain embodiments, plasmid vectors can be used to transform host cells. Plasmid vectors containing replicon and control sequences derived from species compatible with the host cell are used in connection with these hosts. The vectors usually carry a replication site, as well as marking sequences that can provide phenotypic selection in transformed cells. In a non-limiting example, Escherichia coli (E. coli) is often transformed using derivatives of pBR322, a plasmid derived from the E. coli species. pBR322 contains genes for ampicillin and tetracycline resistance, allowing easy identification of transformed cells. The pBR plasmid, or other microbial plasmids or phages, must also contain, or be modified to contain, a promoter that the microorganism can use for expression of its own proteins, for example.

[0177] Additionally, phage vectors containing replicon and control sequences compatible with host microorganisms can be used as transformation vectors in connection with these hosts. For example, phage lambda GEM.TM.11 can be utilized in generating recombinant phage vectors that can be used to transform host cells, such as E. coli LE392.

[0178] Further useful plasmid vectors include pIN vectors (Inouye et al., 1985), and pGEX vectors, for use in generating glutathione S-transferase (GST) soluble fusion proteins for subsequent purification and isolation or cleavage. Other suitable fusion proteins are those with galactosidase, ubiquitin, etc.

[0179] Bacterial host cells, e.g., E. coli, containing the expression vector are grown in any of a number of suitable media, e.g., LB. As will be appreciated by those skilled in the art, expression of the recombinant protein in a particular vector can be induced by contacting the host cells with an agent specific for the particular promoter, e.g., by adding IPTG to the medium, or by switching the incubation to a high temperature. The bacteria are further cultured, e.g., for 2-24 hours, after which the cells are harvested by centrifugation and washed to remove residual medium.

[0180] Viral Vectors The ability of certain viruses to infect cells via receptor-mediated endocytosis, enter cells, integrate into the genome of host cells, and stably and efficiently express viral genes makes them attractive candidates for the introduction of foreign nucleic acid into cells (e.g., mammalian cells). A component of the present invention can be a viral vector encoding one or more CARs of the present invention. Non-limiting examples of viral vectors that can be used to deliver the nucleic acid of the present invention are described below.

[0181] Adenovirus Vectors A particular method for delivery of nucleic acids involves the use of adenoviral expression vectors. Adenoviral vectors are known to have a low capacity for integration into genomic DNA, but this feature is offset by the high gene transfer efficiency afforded by these vectors. "Adenoviral expression vector" is meant to include constructs that contain sufficient adenoviral sequences (a) to support packaging of the construct, and (b) to ultimately express the tissue- or cell-specific construct cloned therein. The genetic makeup or knowledge that adenovirus is a 36 kb, linear, double-stranded DNA virus allows for the replacement of large pieces of adenoviral DNA with foreign sequences up to 7 kb in size (Grunhaus and Horwitz, 1992).

[0182] AAV vectors Adenovirus-assisted transfection can be used to introduce nucleic acid into cells. Increased transfection efficiency has been reported in cell lines using the adenovirus coupled system (Kelleher and Vos, 1994; Cotten et al., 1992; Curiel, 1994). Adeno-associated virus (AAV) is an attractive vector system for use in the cells of the present invention because of its high frequency of integration and its ability to infect non-dividing cells, and is therefore useful for gene delivery to mammalian cells, for example, in tissue culture (Muzyczka, 1992) or in vivo. AAV has a wide host range of infection (Tratschin et al., 1984; Laughlin et al., 1986; Lebkowski et al., 1988; McLaughlin et al., 1988). Details regarding the generation and use of rAAV vectors are described in U.S. Patent Nos. 5,139,941 and 4,797,368, each of which is incorporated herein by reference.

[0183] Retroviral Vectors Retroviruses are useful as delivery vectors due to their ability to integrate their genes into the host genome, to introduce large amounts of foreign genetic material, to infect a wide range of species and cell types, and to be packaged in specialized cell lines (Miller, 1992).

[0184] To construct a retroviral vector, a nucleic acid (e.g., encoding a sequence of interest) is inserted into the viral genome in place of a certain viral sequence to produce a virus that is replication-defective. To generate virions, a packaging cell line is constructed that contains the gag, pol, and env genes, but does not contain the LTR and packaging components (Mann et al., 1983). When a recombinant plasmid containing a cDNA, along with the retroviral LTR and packaging sequences, is introduced into a special cell line (e.g., by calcium phosphate precipitation), the packaging sequences allow the RNA transcripts of the recombinant plasmid to be packaged into viral particles that are then secreted into the culture medium (Nicolas and Rubenstein, 1988; Temin, 1986; Mann et al., 1983). The medium containing the recombinant retrovirus is then collected, optionally concentrated, and used for gene transfer. Retroviral vectors can infect a wide variety of cell types. However, integration and stable expression require the division of host cells (Paskind et al., 1975).

[0185] Lentiviruses are complex retroviruses that contain other genes with regulatory or structural functions in addition to the common retroviral genes gag, pol, and env. Lentiviral vectors are well known in the art (see, for example, Naldini et al., 1996; Zufferey et al., 1997; Blomer et al., 1997, U.S. Patent Nos. 6,013,516 and 5,994,136). Some examples of lentiviruses include human immunodeficiency viruses: HIV-1, HIV-2, and simian immunodeficiency viruses: SIV. Lentiviral vectors are generated by multiple attenuation of HIV pathogenic genes, for example, genes env, vif, vpr, vpu, and nef are deleted, making them biologically safe vectors.

[0186] Recombinant lentivirus vectors can infect non-dividing cells and can be used for gene transfer and expression of nucleic acid sequences both in vivo and ex vivo. For example, recombinant lentiviruses can infect non-dividing cells in which suitable host cells are transfected with two or more vectors carrying packaging functions, namely gag, pol, and env, as well as rev and tat, as described in U.S. Patent No. 5,994,136, which is incorporated herein by reference. To target a receptor on a specific cell type, recombinant viruses can be targeted by binding of envelope proteins to antibodies or specific ligands. For example, by inserting a sequence of interest (including regulatory regions) into a viral vector together with another gene that codes for a ligand for a receptor on a specific target cell, the vector is now target-specific.

[0187] Other viral vectors Other viral vectors can be used as vaccine constructs in the present invention. Vectors derived from viruses such as vaccinia virus (Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al., 1988), Sindbis virus, cytomegalovirus and herpes simplex virus can be used. These offer several attractive features in various mammalian cells (Friedmann, 1989; Ridgeway, 1988; Baichwal and Sugden, 1986; Coupar et al., 1988; Horwich et al., 1990).

[0188] Delivery using modified viruses The nucleic acid to be delivered may be housed within an infectious virus engineered to express a specific binding ligand. Thus, the viral particle specifically binds to the cognate receptor of the target cell and delivers its contents to the cell. A new approach designed to enable specific targeting of retroviral vectors was developed based on the chemical modification of retroviruses by chemical addition of lactose residues to the viral envelope. This modification allows specific infection of hepatocytes via sialoglycoprotein receptors.

[0189] Another approach to targeting recombinant retroviruses was designed, using biotinylated antibodies against retroviral envelope proteins and specific cellular receptors. The antibodies were conjugated through the biotin moiety by using streptavidin (Roux et al., 1989). Using antibodies against major histocompatibility complex class I and class II antigens, they demonstrated in vitro infection of a variety of human cells bearing these surface antigens by ecotropic viruses (Roux et al., 1989).

[0190] Vector delivery and cell transformation Suitable methods for nucleic acid delivery for cell transfection or transformation are known to those skilled in the art. Such methods include, but are not limited to, direct delivery of DNA by ex vivo transfection, injection, etc. Cells can be stably or transiently transformed by applying techniques known in the art.

[0191] Ex vivo transformation Methods for transfecting eukaryotic cells and tissues ex vivo that are removed from a living organism are known to those skilled in the art. Thus, the nucleic acid of the present invention can be used to remove cells or tissues and transfect them ex vivo. In some aspects, the transplanted cells or tissues can be placed in an organism. In other embodiments, the nucleic acid is expressed in the transplanted cells.

[0192] Kits of the Invention Any of the compositions described herein can be included in the kit.In a non-limiting example, the kit can include one or more cells for use in cell therapy that contain recombinant expression vector, and / or reagents for generating one or more cells for use in cell therapy.The components of the kit are provided in suitable container means.

[0193] Some components of the kit may be packaged in aqueous media or in lyophilized form. The container means of the kit may include at least one vial, test tube, flask, bottle, syringe, or other container means into which the components may be placed and suitably dispensed. If there are two or more components in the kit, the kit may also contain a second, third, or other additional container into which the additional components may be placed separately. However, various combinations of components may be included in the vial. The kit of the present invention may also include a means for containing the components in close confinement for commercial sale. Such containers may include injection molded or blow molded plastic containers into which the desired vials are retained.

[0194] When the components of the kit are provided in one and / or more liquid solutions, the liquid solution is an aqueous solution, with a sterile aqueous solution being particularly useful. In some cases, the container means itself may be a syringe, pipette, and / or other similar device from which the formulation may be applied to an infected area of ​​the body, injected into an animal, and / or applied to and / or mixed with other components of the kit.

[0195] However, the components of the kit may also be provided as a dry powder(s). When reagents and / or components are provided as dry powders, the powder may be reconstituted by the addition of a suitable solvent. For example, the solvent may also be provided in another container means. The kit may also comprise a second container means for containing a sterile pharma- ceutically acceptable buffer and / or other diluent.

[0196] In certain embodiments of the present invention, the cells used for cell therapy are provided in a kit, and in some cases, the cells are essentially the only component of the kit. The kit may include reagents and materials for producing the desired cells. In certain embodiments, the reagents and materials include primers for amplifying the desired sequence, nucleotides, appropriate buffers or buffer reagents, salts, etc., and in some cases, the reagents include vectors and / or DNA encoding the CAR described herein and / or regulatory elements therefor.

[0197] In certain embodiments, there are one or more devices in the kit suitable for extracting one or more samples from an individual. The device may be a syringe, a scalpel, etc.

[0198] In some cases of the invention, the kit, in addition to the cell therapy embodiment, also includes a second cancer therapy, such as, for example, chemotherapy, hormonal therapy, and / or immunotherapy. The kit(s) can be tailored to the individual's particular cancer and can include the individual's respective second cancer therapy.

[0199] Combination therapy In certain embodiments of the present invention, the method of the present invention for clinical aspects is combined with other agents effective in treating hyperproliferative diseases, such as anti-cancer agents. An "anti-cancer" agent can adversely affect cancer in a subject, for example, by killing cancer cells, including apoptosis in the cancer cells, reducing the rate of proliferation of cancer cells, reducing the incidence or number of metastases, reducing tumor size, inhibiting tumor growth, reducing blood supply to the tumor or cancer cells, promoting an immune response to the cancer cells or tumor, preventing or inhibiting the progression of cancer, or increasing the life span of a subject with cancer; for example, these other compositions will be provided in a combined amount effective to kill or inhibit proliferation of the cells. This process can include contacting the cancer cells with the expression construct and the agent(s) or factor(s) simultaneously. This can be accomplished by contacting the cells with a single composition or pharmacological formulation that includes both agents, or by contacting the cells with two different compositions or formulations at the same time, one composition that includes the expression construct and the other that includes the second agent(s).

[0200] Tumor cell resistance to chemotherapy and radiotherapy is a major problem in clinical oncology.One goal of current cancer research is to find ways to improve the efficacy of chemotherapy and radiotherapy by combining them with other treatments.In one embodiment, cell therapy can be used in conjunction with chemotherapy, radiotherapy, or immunotherapy intervention, as well as with proapoptotic or cell cycle regulators.

[0201] Alternatively, the treatment of the present invention may precede or follow the treatment of the other agent by intervals ranging from minutes to weeks. In embodiments in which the other agent and the present invention are applied separately, it is generally ensured that the effective period has not expired between the time of each delivery so that the agent and the treatment of the present invention can still exert their beneficial combined effect on the cells. In such cases, the cells may be contacted with both modalities within about 12-24 hours of each other (e.g., within about 6-12 hours of each other). In some situations, it may be desirable to extend the treatment period significantly, where days (2, 3, 4, 5, 6, or 7) to weeks (1, 2, 3, 4, 5, 6, 7, or 8) pass between the respective administrations.

[0202] Treatment cycles would be repeated as necessary. For example, various standard therapies, as well as surgical interventions, may be applied in combination with the cell therapy of the present invention.

[0203] chemotherapy Cancer treatment also includes a variety of combination therapies using both chemical and radiation-based therapies. Combination chemotherapy includes, but is not limited to, for example, Abraxane, altretamine, docetaxel, herceptin, methotrexate, novantrone, zoladex, cisplatin (CDDP), carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, ifosfamide, melphalan, chlorambucil, busulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide (VP16), tamoxifen, raloxifene, estrogen receptor binding agents, taxol, gemcitabine, navelbine, farnesyl protein tansferase inhibitors, transplatinum, 5-fluorouracil, vincristine, vinblastine, and methotrexate, or variants of any of the foregoing analogs or derivatives, and combinations thereof.

[0204] In certain embodiments, chemotherapy for an individual is employed in combination with the present invention, eg, before, during, and / or after administration of the present invention.

[0205] Radiation therapy Other agents that cause DNA damage and have been widely used include gamma radiation, commonly known as X-rays, and / or the guided delivery of radioisotopes to tumor cells. Other forms of DNA damaging agents, such as microwave and ultraviolet radiation, are also useful. All of these agents most likely cause widespread damage to DNA, the precursors of DNA, DNA replication and repair, and chromosome assembly and maintenance. X-ray doses range from daily doses of 50-200 roentgens for prolonged periods (3-4 weeks) to single doses of 2000-6000 roentgens. Dose ranges for radioisotopes vary widely and depend on the half-life of the isotope, the strength and type of radiation emitted, and uptake by neoplastic cells.

[0206] As used herein, the terms "contact" and "exposure" as applied to a cell are used to describe the process by which a therapeutic construct and a chemotherapeutic or radiotherapeutic agent are delivered to or directly juxtaposed with a target cell. To achieve cell killing or stasis, both agents are delivered to the cell in a combined amount effective to kill the cell or prevent it from dividing.

[0207] immunotherapy Immunotherapy relies on the use of immune effector cells and molecules to target and destroy cancer cells. The immune effector can be, for example, an antibody specific for some marker on the surface of the tumor cell. The antibody alone can function as the effector of therapy or can recruit other cells to actually kill the cell. The antibody can also be conjugated to a drug or toxin (chemotherapeutic agent, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc.) and simply function as a targeting agent. Alternatively, the effector can be a lymphocyte carrying a surface molecule that interacts directly or indirectly with the tumor cell target. Various effector cells include cytotoxic T cells and NK cells.

[0208] Thus, immunotherapy other than the therapy of the present invention described herein can be used as part of a combination therapy in combination with the cell therapy. The combination therapy approach is described herein. For example, tumor cells must have some markers that are amenable to targeting, i.e., not present on the majority of other cells. There are many tumor markers, any of which may be suitable for targeting in the context of the present invention. Common tumor markers include PD-1, PD-L1, CTLA4, carcinoembryonic antigen, prostate specific antigen, urinary tumor associated antigen, fetal antigen, tyrosinase (p97), gp68, TAG-72, HMFG, sialyl Lewis antigen, MucA, MucB, PLAP, estrogen receptor, laminin receptor, erb B and p155.

[0209] gene In yet another embodiment, the secondary treatment is gene therapy in which a therapeutic polynucleotide is administered before, after, or simultaneously with the clinical embodiments of the invention.A variety of expression products are encompassed by the invention, including inducers of cell proliferation, inhibitors of cell proliferation, or regulators of programmed cell death.

[0210] surgery Approximately 60% of cancer patients undergo some type of surgery, including preventative, diagnostic, staging, curative and palliative surgery. Curative surgery is a cancer treatment that can be used in combination with other therapies, such as the treatment of the present invention, chemotherapy, radiation therapy, hormonal therapy, gene therapy, immunotherapy and / or alternative therapies.

[0211] Curative surgery includes resection, where all or part of the cancerous tissue is physically removed, excised, and / or destroyed. Tumor resection refers to the physical removal of at least a portion of the tumor. In addition to tumor resection, surgical treatment includes laser surgery, cryosurgery, electrosurgery, and microsurgery (Mohs surgery). For example, the present invention can be used in combination with the removal of superficial cancers, pre-cancers, or incidental amounts of normal tissue.

[0212] Removal of all cancerous cells, tissues, or parts of a tumor may result in the formation of a cavity in the body. Treatment may be accomplished by perfusion, direct injection, or local application to the site with additional anticancer therapy. Such treatments may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks, or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. These treatments may be of various dosages as well.

[0213] Other drugs In some embodiments, other agents can be used in combination with the present invention to improve the therapeutic efficacy of the treatment. These additional agents include immunomodulators, agents that affect the upregulation of cell surface receptors and GAP junctions, cytostatic and differentiation agents, cell adhesion inhibitors, or agents that enhance the sensitivity of hyperproliferative cells to apoptosis inducers. Immunomodulators include tumor necrosis factor, interferon alpha, beta, gamma; IL-2 and other cytokines; F42K and other cytokine analogs; or MIP-1, MIP-1 beta, MCP-1, RANTES, and other chemokines. In some embodiments, upregulation of cell surface receptors or their ligands, such as Fas / Fas ligand, DR4, or DR5 / TRAIL, will enhance the apoptosis-inducing ability of the present invention by establishing an autocrine or paracrine effect on the hyperproliferative cells. Increasing intercellular signaling by increasing the number of GAP junctions increases the anti-hyperproliferative effect on adjacent hyperproliferative cell populations. In other embodiments, cytostatic or differentiation agents can be used in combination with the present invention to improve the anti-hyperproliferative efficacy of the treatment. Cell adhesion inhibitors can also be used to improve the efficacy of the present invention. Examples of cell adhesion inhibitors are focal adhesion kinase (FAK) inhibitors and lovastatin. In some embodiments, other agents that enhance the sensitivity of hyperproliferative cells to apoptosis, such as antibody c225, can be used in combination with the present invention to improve therapeutic efficacy.

[0214] Methods for assessing the activity of engineered CAR T cells Aspects of the present disclosure are further directed to methods and kits for evaluating the killing capacity of engineered CAR T cells. Specifically, embodiments are directed to immunocomplex analysis methods and kits for determining CAR T cell activity during co-culture with cancer cells. First, various target cancer cells (e.g., HEK293T, MDA-MB-231, MDA-MB-468, HCC38, and skrc59) are stained with a dye (e.g., ViaStain™ Tracer Blue dye), seeded into a plate (e.g., a 96-well plate), and incubated for a period of time (e.g., 12 hours, or overnight). Next, different T cell types (e.g., two different T cell types) are added to the wells (e.g., at an effector to target (E:T) ratio of 20:1) and allowed to co-culture for a period of time (e.g., 24 hours). Finally, the plate is scanned and analyzed (e.g., using bright field and blue fluorescent channels). Immune complexes were analyzed by confluence measurements and compared to a negative control of non-transduced T cells. As a result, data plots displayed the activity of CAR T cells for all target and effector cell combinations tested. The use of an image cytometry platform allows visual confirmation of the interactions between effector and target cells, resulting in accurate and robust results. EXAMPLES

[0215] Examples are provided below to facilitate a more complete understanding of the present invention. The following examples illustrate exemplary ways of making and carrying out the present invention. However, the scope of the present invention is not limited to the specific embodiments disclosed in these examples, and are for illustrative purposes only, since alternative methods can be used to obtain similar results.

[0216] Example 1 Clear cell renal cell carcinoma (ccRCC) is the leading type of RCC and one of the 10 most common cancers in both men and women. Chimeric antigen receptor (CAR) T cells have proven to be a potent and clinically translatable immunotherapy for hematological malignancies. However, these results are not translatable to solid tumors due to inefficient homing of CAR T cells, the inhibitory tumor microenvironment, and on-target off-tumor toxicity resulting from sharing of CAR T-targeting epitopes on healthy tissues. To combat the inhibitory microenvironment, immune checkpoint blockade has shown enhanced effects on antitumor responses by restoring local antitumor immunity. We engineered a CAR T cell factory to empower CAR T cells by secreting human anti-immune checkpoint inhibitor monoclonal antibodies (mAbs) locally at the tumor site. Our results show that reversing the exhaustion of CAR T cells and tumor-infiltrating lymphocytes (TILs) dramatically improves CAR T-mediated killing of ccRCC in vivo and in vitro.

[0217] CAIX is an ideal target for ccRCC therapy and is used as the CAR target in the first clinical trial (see, for example, Lamers, Sleijfer et al. 2006; Lamers, Willemsen et al. 2011). However, it caused serious side effects due to CAIX expression on the bile duct. Therefore, it is important to develop CARs with high efficacy and safety (such as limiting on-target off-tumor effects). To achieve that, second-generation CARs are developed by introducing a second targeting scFv (e.g., anti-CD70 scFv) together with the first targeting scFv (e.g., anti-CAIX scFv) into the CAR T cell factory, allowing the CAR to target two unique antigens simultaneously. See, for example, Figure 1. By IHC staining of ccRCC patient samples, we found that the target CD70 is an ideal target to utilize as the second target because it is highly expressed on ccRCC and co-expressed with CAIX.

[0218] Our 27 billion member human scFv-phage display library was panned against antigen expressing skrc-59 ccRCC cells, subtracting antigen-free skrc-59 ccRCC cells, to identify new scFvs. Their binding kinetics (Kon / Koff) and affinity (Kd) were then measured via OctetRed 96 instrument, and scFvs with desirable kinetics were evaluated for their ability to bind antigen expressing cells. Candidates were cloned into a vector in which anti-CD70 and anti-CAIX scFvs were combined in different permutations by changing the order of two targeting scFvs with various linkers connected to costimulatory domains (CD28, 41BB) and activation domains (CD3). Using a fourth generation lentiviral packaging system, CAR lentivirus was obtained and transduced into primary T cells isolated from PBMCs to express the dual CARs, which were then tested against different cell lines in vitro. For further evaluation in vivo, a humanized orthotopic ccRCC mouse model was established by injecting luciferized ccRCC cells under the kidney capsule of NSG-SGM3 mice with a reconstituted human immune system.

[0219] In summary, a series of CARs with different scFvs, linkers and hinges are generated by utilizing the double CAR T discovery platform.Those skilled in the art will recognize that embodiments can include different combinations of scFvs, linkers and hinges.For example, different combinations of scFvs, linkers and hinges can be used to treat different cancers.

[0220] By combining the best dual CARs with payloads such as immune checkpoint inhibitor payloads, second generation CAR Ts have been discovered. Without wishing to be bound by theory, second generation CAR T cell factories can be used to treat cancers such as ccRCC, eliminating side effects on normal tissues.

[0221] References cited in this example Lamers, CH, S. Sleijfer, AGVulto, WHKruit, M. Kliffen, R. Debets, JW Gratama, G. Stoter and E. Oosterwijk (2006).”Treatment of metastatic renal cell carcinoma with autologous T-lymphocytes genetically retargeted against carbonic anhydrase IX:first clinical experience.”J Clin Oncol 24(13):e20-22. Lamers, CH, R. Willemsen, P. van Elzakker, S. van Steenbergen-Langeveld, M. Broertjes, J. Oosterwijk-Wakka, E. Oosterwijk, S. Sleijfer, R. Debets and JW Gratama (2011).”Immune responses to transgene and retroviral vector in patients treated with ex vivo-engineered T cells.”Blood 117(1):72-82.

[0222] Example 2 Chimeric antigen receptor (CAR) T cells have proven to be a potent immunotherapy for hematological malignancies, but these have not been translated to solid tumors. Our CAR T cell factories empower CAR T cells by secreting antibodies, such as human anti-immune checkpoint inhibitor monoclonal antibodies (mAbs), locally at the tumor site to restore the tumor microenvironment and achieve cure of solid tumors. With the introduction of one or more additional scFvs, second-generation CARs have shown great promise in the clinic with improved efficacy and safety.

[0223] Bispecific tandem CARs were designed to target tumor-associated antigens such as CAIX and CD70 (see, e.g., Figures 1 and 2), which are highly expressed and co-expressed on ccRCC primary cells by IHC (Figure 3). Several anti-CD70 scFvs were identified by successful panning of a 27 billion member phage display library (see, e.g., Figure 6). Anti-CAIX scFvs and anti-CD70 scFvs that we previously discovered were cloned into pHAGE vectors with different linkers (see, e.g., Figure 9). The lentiviruses were then packaged and transduced with primary T cells. CAR T cells were obtained and evaluated in four different CRISPR engineered cell lines (see, e.g., Figure 5). Killing activity was evaluated in Celigo and Cr51 release assays (see, e.g., Figures 12 and 13). Selectivity was demonstrated as described herein.

[0224] This CAR T cell factory can be used to treat CAIX and / or CD70 overexpressing cancers or in combination with other therapies.

[0225] Example 3 Quantification of dual IHC staining for CAIX and CD70 TIFF0007649239000025.tif149166

[0226] equivalent Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific substances and procedures specifically described herein which are considered to be within the scope of the invention and covered by the appended claims.

Claims

1. 1. An engineered cell comprising a chimeric antigen receptor (CAR), the chimeric antigen receptor comprising an extracellular ligand binding domain, the extracellular ligand binding domain comprising a first antigen binding domain and a second antigen binding domain, the first antigen binding domain being specific for CAIX and the second antigen binding domain being specific for CD70, the extracellular ligand binding domain comprising an antibody or antigen binding fragment thereof; 5. The antibody or antigen-binding fragment thereof specific for CAIX, VH CDR1, CDR2, and CDR3, according to the amino acid sequences SYAMS, AISGSGGSTYYADSVKG, and SHSSGGFDY, respectively; and VL CDR1, CDR2, and CDR3, with the amino acid sequences TGSSSNIGRGYNVH, GNTNRPS, and QSYDSSLSAWV, respectively. Including, 5. The antibody or antigen-binding fragment thereof specific for CD70, (a) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SGSIASNY, EDN, and QSYDSGNRRV, respectively; (b) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTFSSYA, ISGSGGSR, and ARGRGGHGMDV, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SSNIGSNY, RNN, and AAWDDSLNGLV, respectively; (c) a VH CDR1, CDR2, and CDR3, with the amino acid sequences GGTFSSQA, IIPFFGVP, and AVLKGRGNFDF, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences YSVFHSPNNKNY, WAS, and QQRSNWPLT, respectively; (d) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences ALPKKY, EDS, and YSTDSSGNHKV, respectively; (e) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSTSH, KDSGGKT, and ARARPSDPYDGSGFDAFDI, respectively; and VL CDR1, CDR2, and CDR3, according to the amino acid sequences SNNVGNQG, RNN, and SAWDSSLSAWV, respectively; or (f) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFIFSDYY, IRSRRGET, and ARHRKSFTDLDAFDL, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences QDIGTD, KAS, and QHFNNYPAT, respectively Including, Engineered cells.

2. 2. The engineered cell of claim 1, wherein the CAR further comprises a transmembrane polypeptide and an intracellular signaling domain.

3. 3. The engineered cell of claim 2, wherein the CAR further comprises a stalk region located between the extracellular ligand binding domain and the transmembrane domain.

4. 4. The engineered cell of claim 2 or 3, wherein the CAR further comprises a costimulatory domain.

5. The engineered cell of any one of claims 1 to 4, wherein the antibody or antigen-binding fragment thereof specific for CAIX comprises: VH with the amino acid sequence QVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARSHSSGGFDYWGQGTLVTVSS, and VL with amino acid sequence QSVLTQPPSVSGAPGQRVTISCTGSSSNIGRGYNVHWYQQLPGTAPKLLIYGNTNRPSGVPDRFSGSKSGTSASLAITGLQAEDEGDYYCQSYDSSLSAWVFGGGTKLTVLG.

6. 5. The engineered cell of any one of claims 1 to 4, wherein the antibody or antigen-binding fragment thereof specific for CD70 comprises: (a) a VH with the amino acid sequence QVQLVQSGGGLVQPRGSLRLSCAASGFTVSNYAMSWVRQAPGKGLEWVATKSGSDGRTYYADSVKGRFTIARDNSKNSLYLQMNSLRAADTAVYYCAKGIYDVTGSSFDS, and VL with amino acid sequence NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSGNRRV; (b) a VH with the amino acid sequence QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSLISGSGGSRYYADSVKGRFTISRDNSKNTLYLQMNNLRAEDTAVYYCARGRGGHGMDV, and VL with amino acid sequence QPGLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLIYRNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGLV; (c) a VH with the amino acid sequence QVQLVQSGAEVKKPGSSVKVSCRSSGGTFSSQAFSWVRQAPGQGLEWMGRIIPFFGVPTYAQRFQGRVTITADKSPTTAYMELTSLRSDDTAVYYCAVLKGRGNFDF, and VL with amino acid sequence DIVMTQSPDSLAVSLGERATINCKSSYSVFHSPNNKNYLAWYQQRPGQPPKLLIYWASTRGSGVPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLT; (d) a VH with the amino acid sequence QVQLVQSGGGLVQPRGSLRLSCAASGFTVSNYAMSWVRQAPGKGLEWVATKSGSDGRTYYADSVKGRFTIARDNSKNSLYLQMNSLRAADTAVYYCAKGIYDVTGSSFDS, and VL with amino acid sequence SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVMFEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNHKV; (e) a VH with the amino acid sequence EVQLVESGGGVVQPGRSLRLSCAASGFTVSTSHMSWVRQAPGKGLEWLSGKDSGGKTYYADSVRGRFTIARDDSLNTVFLQMNNMRDEDSGVYYCARARPSDPYDGSGFDAFDI, and VL with the amino acid sequence SYELTQPPSVSKGLRQTATLTCTGNSNNVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSAWDSSLSAWV; or (f) a VH with the amino acid sequence QVQLVQSGGGLVKPRGSLRLSCAASGFIFSDYYMSWIRQAPGKGLQWVASIRSRRGETNYADSVKGRFTIARDNAEKSLYLQMNSLRAEDAAVYYCARHRKSFTDLDAFDL, and VL with the amino acid sequence DIVMTQSPSTLSASVGDRVTITCRASQDIGTDLSWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQHFNNYPAT.

7. 5. The engineered cell of any one of claims 1 to 4, wherein the extracellular ligand binding domain comprises a VH and a VL as described in claim 5, and a VH and a VL as described in any one of claims 6(a) to (f).

8. The engineered cell of any one of claims 1 to 7, which expresses and secretes a recombinant polypeptide.

9. The engineered cell of claim 8 , wherein the recombinant polypeptide comprises an antibody or an antigen-binding fragment thereof, or a cytokine.

10. The engineered cell of claim 8 or 9, wherein the recombinant polypeptide modulates the immune system of a subject.

11. The engineered cell of claim 8 or 9, wherein the recombinant polypeptide is an immune checkpoint blockade antibody.

12. The engineered cell of claim 8 or 9, wherein the recombinant polypeptide regulates tumor angiogenesis.

13. 13. The engineered cell of claim 12, wherein the recombinant polypeptide specifically binds to VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1.

14. 9. The engineered cell of claim 8, wherein the recombinant polypeptide comprises an antibody or antigen-binding fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4.

15. 10. The engineered cell of claim 9, wherein the cytokine comprises IL-12, IL-15, or IL-18.

16. The engineered cell of any one of claims 1 to 15, wherein the cell comprises a T cell, an NK cell, or an NKT cell.

17. 17. The engineered cell of claim 16, wherein the T cells are CD4+, CD8+, CD3+ pan T cells, or any combination thereof.

18. 17. The engineered cell of claim 16, wherein the T cells are a mixed population of CD4+ and CD8+ T cells.

19. A nucleic acid construct encoding a chimeric antigen receptor, the chimeric antigen receptor comprising an extracellular ligand-binding domain specific for a first antigen and a second antigen on the surface of a cancer cell, the first antigen comprising CAIX, the second antigen comprising CD70, and the extracellular ligand-binding domain comprising an antibody or antigen-binding fragment thereof; 5. The antibody or antigen-binding fragment thereof specific for CAIX, VH CDR1, CDR2, and CDR3, according to the amino acid sequences SYAMS, AISGSGGSTYYADSVKG, and SHSSGGFDY, respectively; and VL CDR1, CDR2, and CDR3, with the amino acid sequences TGSSSNIGRGYNVH, GNTNRPS, and QSYDSSLSAWV, respectively. Including, 5. The antibody or antigen-binding fragment thereof specific for CD70, (a) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SGSIASNY, EDN, and QSYDSGNRRV, respectively; (b) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTFSSYA, ISGSGGSR, and ARGRGGHGMDV, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SSNIGSNY, RNN, and AAWDDSLNGLV, respectively; (c) a VH CDR1, CDR2, and CDR3, with the amino acid sequences GGTFSSQA, IIPFFGVP, and AVLKGRGNFDF, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences YSVFHSPNNKNY, WAS, and QQRSNWPLT, respectively; (d) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences ALPKKY, EDS, and YSTDSSGNHKV, respectively; (e) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSTSH, KDSGGKT, and ARARPSDPYDGSGFDAFDI, respectively; and VL CDR1, CDR2, and CDR3, according to the amino acid sequences SNNVGNQG, RNN, and SAWDSSLSAWV, respectively; or (f) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFIFSDYY, IRSRRGET, and ARHRKSFTDLDAFDL, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences QDIGTD, KAS, and QHFNNYPAT, respectively Including, Nucleic acid constructs.

20. 20. The nucleic acid construct of claim 19, wherein the chimeric antigen receptor further comprises a transmembrane polypeptide and an intracellular signaling domain.

21. 21. The nucleic acid construct of claim 20, wherein the chimeric antigen receptor further comprises a costimulatory domain.

22. 22. The nucleic acid construct of any one of claims 19 to 21, further encoding a recombinant polypeptide.

23. 23. The nucleic acid construct of claim 22, wherein the recombinant polypeptide is capable of being secreted from the engineered cell.

24. 24. The nucleic acid construct of claim 22 or 23, wherein the recombinant polypeptide comprises an antibody or an antigen-binding fragment thereof, or a cytokine.

25. The nucleic acid construct of any one of claims 22 to 24, wherein the recombinant polypeptide modulates the immune system of a subject.

26. The nucleic acid construct of any one of claims 22 to 24, wherein the recombinant polypeptide is an immune checkpoint blocking antibody.

27. The nucleic acid construct according to any one of claims 22 to 24, wherein the recombinant polypeptide modulates tumor angiogenesis.

28. 23. The nucleic acid construct of claim 22, wherein the recombinant polypeptide comprises an antibody or antigen-binding fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4.

29. The nucleic acid construct of claim 24 , wherein the cytokine comprises IL12, IL15, or IL18.

30. 28. The nucleic acid construct of claim 27, wherein the recombinant polypeptide specifically binds to VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1.

31. A vector comprising the nucleic acid construct according to any one of claims 19 to 30.

32. A cell comprising the vector of claim 31.

33. A pharmaceutical composition for treating a subject suffering from cancer, comprising a therapeutically effective amount of the engineered cells of any one of claims 1 to 18.

34. 20. A pharmaceutical composition for reducing the progression or promoting the regression of cancer in a subject, comprising a therapeutically effective amount of the engineered cells of any one of claims 1 to 18.

35. A pharmaceutical composition for reducing cell proliferation of cancer cells in a subject, comprising a therapeutically effective amount of an engineered cell according to any one of claims 1 to 18.

36. The pharmaceutical composition of any one of claims 33 to 35, wherein the cancer comprises renal cell carcinoma.

37. A chimeric antigen receptor (CAR) comprising an extracellular ligand-binding domain, the extracellular ligand-binding domain being specific for a first antigen and a second antigen on a surface of a cancer cell, the first antigen comprising CAIX and the second antigen comprising CD70, the extracellular ligand-binding domain comprising an antibody or an antigen-binding fragment thereof; 5. The antibody or antigen-binding fragment thereof specific for CAIX, VH CDR1, CDR2, and CDR3, according to the amino acid sequences SYAMS, AISGSGGSTYYADSVKG, and SHSSGGFDY, respectively; and VL CDR1, CDR2, and CDR3, with the amino acid sequences TGSSSNIGRGYNVH, GNTNRPS, and QSYDSSLSAWV, respectively. Including, 5. The antibody or antigen-binding fragment thereof specific for CD70, (a) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SGSIASNY, EDN, and QSYDSGNRRV, respectively; (b) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTFSSYA, ISGSGGSR, and ARGRGGHGMDV, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SSNIGSNY, RNN, and AAWDDSLNGLV, respectively; (c) a VH CDR1, CDR2, and CDR3, with the amino acid sequences GGTFSSQA, IIPFFGVP, and AVLKGRGNFDF, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences YSVFHSPNNKNY, WAS, and QQRSNWPLT, respectively; (d) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences ALPKKY, EDS, and YSTDSSGNHKV, respectively; (e) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSTSH, KDSGGKT, and ARARPSDPYDGSGFDAFDI, respectively; and VL CDR1, CDR2, and CDR3, according to the amino acid sequences SNNVGNQG, RNN, and SAWDSSLSAWV, respectively; or (f) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFIFSDYY, IRSRRGET, and ARHRKSFTDLDAFDL, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences QDIGTD, KAS, and QHFNNYPAT, respectively Including, Chimeric antigen receptor.

38. The CAR of claim 37, further comprising a transmembrane polypeptide and an intracellular signaling domain.

39. The CAR of claim 38, further comprising a costimulatory domain.

40. A cell comprising the chimeric antigen receptor (CAR) of any one of claims 37 to 39.

41. An engineered cell comprising a first chimeric antigen receptor and a second chimeric antigen receptor, wherein the first chimeric antigen receptor comprises an extracellular ligand binding domain specific for CAIX and the second chimeric antigen receptor comprises an extracellular ligand binding domain specific for CD70; The extracellular ligand-binding domain specific for CAIX is VH CDR1, CDR2, and CDR3, according to the amino acid sequences SYAMS, AISGSGGSTYYADSVKG, and SHSSGGFDY, respectively; and VL CDR1, CDR2, and CDR3, with the amino acid sequences TGSSSNIGRGYNVH, GNTNRPS, and QSYDSSLSAWV, respectively. and an antibody or antigen-binding fragment thereof comprising The extracellular ligand binding domain specific for CD70 comprises: (a) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SGSIASNY, EDN, and QSYDSGNRRV, respectively; (b) a VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTFSSYA, ISGSGGSR, and ARGRGGHGMDV, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences SSNIGSNY, RNN, and AAWDDSLNGLV, respectively; (c) a VH CDR1, CDR2, and CDR3, with the amino acid sequences GGTFSSQA, IIPFFGVP, and AVLKGRGNFDF, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences YSVFHSPNNKNY, WAS, and QQRSNWPLT, respectively; (d) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSNYA, KSGSDGRT, and AKGIYDVTGSSFDS, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences ALPKKY, EDS, and YSTDSSGNHKV, respectively; (e) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFTVSTSH, KDSGGKT, and ARARPSDPYDGSGFDAFDI, respectively; and VL CDR1, CDR2, and CDR3, according to the amino acid sequences SNNVGNQG, RNN, and SAWDSSLSAWV, respectively; or (f) VH CDR1, CDR2, and CDR3, according to the amino acid sequences GFIFSDYY, IRSRRGET, and ARHRKSFTDLDAFDL, respectively; and VL CDR1, CDR2, and CDR3, with amino acid sequences QDIGTD, KAS, and QHFNNYPAT, respectively and an antibody or antigen-binding fragment thereof comprising Engineered cells.

42. 42. The engineered cell of claim 41, which expresses and secretes a recombinant polypeptide.

43. 43. The engineered cell of claim 42, wherein the recombinant polypeptide comprises an antibody or an antigen-binding fragment thereof, or a cytokine.

44. 44. The engineered cell of claim 42 or 43, wherein the recombinant polypeptide modulates the immune system of a subject.

45. The engineered cell of claim 42 or 43, wherein the recombinant polypeptide is an immune checkpoint blocking antibody.

46. 44. The engineered cell of claim 42 or 43, wherein the recombinant polypeptide regulates tumor angiogenesis.

47. 43. The engineered cell of claim 42, wherein the recombinant polypeptide comprises an antibody or antigen-binding fragment thereof specific for TIGIT, GITR, PD-L1, PD-L2, PD-1, CTLA-4, VISTA, CD70, TIM-3, LAG-3, CD40L, or CCR4.

48. 44. The engineered cell of claim 43, wherein the cytokine comprises IL12, IL15, or IL18.

49. 47. The engineered cell of claim 46, wherein the recombinant polypeptide specifically binds to VEGF, VEGFR1, VEGFR2, PDGF, Ang-1, or AT1.

50. 50. The engineered cell of any one of claims 41 to 49, wherein the cell comprises a T cell or a NK cell.

51. 51. The engineered cell of claim 50, wherein the T cells are CD4+, CD8+, CD3+ pan T cells, or any combination thereof.

52. 51. The engineered cell of claim 50, wherein the T cells are a mixed population of CD4+ and CD8+ T cells.

53. 53. The engineered cell of any one of claims 41-52, wherein the first chimeric antigen receptor and the second chimeric antigen receptor are expressed from a single nucleic acid construct.

Images