Multifunctional immunocyte therapy

Abstract

To provide therapeutic methods for hyperproliferative disorders such as cancer.SOLUTION: Provided herein is a multifunctional chimeric antigen receptor (CAR)-based composition and the use thereof for directing immune responses to a target cell. The composition has an application including treatment of a hyperproliferative disorder such as cancer. The provided method generally comprises the use of a CAR cell in combination with an adapter. The adapter confers an ability to modulate, alter and / or redirect the CAR cell-mediated immune response in vitro or in vivo. In some embodiments, the CAR cell comprises genetic modification to reduce or eliminate the expression of a targeted antigenic determinant.SELECTED DRAWING: None

Description

[Background technology]

[0001] Adoptive transfer of genetically modified T cells is a rapidly evolving innovative treatment for cancer. Chimeric antigen receptor (CAR) genetically modified T cells are renewable agents with the ability to provide sustained functional immunity. Clinical efficacy has been demonstrated with CD19 CAR T in a range of hematological cancers, and promising early clinical data have been reported for other genetically modified CAR T in solid tumors. However, significant challenges must be overcome before CAR technology can more fully realize its substantial potential.

[0002] Current clinical trials using CAR T cells have seen high rates of relapse within a year or less due to the inability of CAR T cells to address antigen escape and the inherent heterogeneity of cancer or tumor phenotype. Furthermore, current CAR technologies cannot accommodate changes in cancer or tumor phenotype. For example, in solid tumors, current CAR technologies show limited efficacy due to the heterogeneity of tumor targets and the inability to reprogram CAR T cells to recognize an expanded set of antigenic targets expressed over time. In addition to improving the durability and sustainability of clinical responses, other significant obstacles to the use of current CAR cell-based technologies include the time required for generation of CAR T cells, suboptimal specificity, efficacy, and safety of CAR cells for use in cancers other than leukemia. Thus, there is a need for CAR cell-based technologies that offer simultaneous and / or sequential targeting multispecificity and the ability to modulate, modify, or redirect in vivo CAR cell-mediated immune responses.

[0003] Bone marrow transplantation (BMT) and hematopoietic stem cell transplantation (HSCT) have the potential to correct any blood or immune disease. Czechowicz et al., Blood 128(22):493(2016). Despite their great potential, the clinical use of BMT and HSCT is significantly limited due to the strong safety and toxicity risks associated with the current high-dose chemotherapy / irradiation conditioning regimens that prepare patients for transplantation and subsequent donor HSC engraftment. The most common toxicities experienced by patients include neutropenia, infections, anemia, mucositis, infertility, organ damage, especially in the bone marrow compartment and secondary malignancies. The complete elimination of these toxic conditioning regimens should dramatically improve the safety profile of BMT and HSCT, expanding their potential applications to include many more non-malignant hematological disorders, a wide variety of autoimmune disorders, as well as facilitating solid organ transplantation. There is therefore a need for the development of improved transplant conditioning regimens that limit or eliminate the toxicity associated with current high-dose chemotherapy / irradiation while at the same time effectively treating the underlying pathology. [Prior art documents] [Non-patent literature]

[0004] [Non-Patent Document 1] Czechowicz et al.,Blood 128(22):493(2016) Summary of the Invention

[0005] Provided herein are multifunctional chimeric antigen receptor (CAR)-based compositions and their use in inducing immune responses against target cells. The compositions have uses including the treatment of hyperproliferative disorders such as cancer. The methods provided generally involve the use of CAR cells in combination with an adaptor. The adaptor confers the ability to modulate, alter, and / or redirect CAR cellular immune responses in vitro and in vivo.

[0006] The present disclosure relates to a composition comprising (a) a cell expressing a chimeric antigen receptor (CAR) comprising an antigenic determinant binding domain (ADBD), and (b) a soluble protein ("adapter") comprising (i) an antigenic determinant (AD) and (ii) an ADBD. The present disclosure also provides methods of killing target cells using the compositions provided herein, including therapeutic applications of the compositions provided herein.

[0007] In some embodiments, the present disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) an ADBD that binds to a first AD on a target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) an ADBD that binds to the first AD and (ii) a second AD on the target cell.

[0008] In some embodiments, the present disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) an ADBD that binds to a first AD on a target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) an ADBD that binds to said first AD and (ii) a second AD on a second target cell.

[0009] In some embodiments, the disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) an ADBD that is an alternative scaffold binding domain (ASBD) that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising an ADBD that binds to (i) the first AD and (ii) a second AD on a target cell.

[0010] In some embodiments, the present disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising an ADBD that comprises (i) the first AD and (ii) an ASBD that binds to a second AD on a target cell.

[0011] In some embodiments, the present disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) a D domain that binds to a second AD on a target cell.

[0012] In some embodiments, the present disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) a D domain that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) an ADBD that binds to a second AD on a target cell.

[0013] In some embodiments, the present disclosure provides a composition comprising: (a) a cell expressing a CAR comprising (i) a first D domain that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) a second D domain that binds to a second AD on a target cell.

[0014] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting a composition comprising a target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on said target cell.

[0015] In some embodiments, the present disclosure provides a method of killing one or more target cells comprising contacting a composition comprising a first target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on a second target cell.

[0016] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting a composition comprising a target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that is an ASBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0017] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting a composition comprising a target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0018] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting a composition comprising a target cell with a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the first target cell further comprises an adaptor comprising (i) said first AD and (ii) an ADBD that binds to a second AD on the target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0019] In some embodiments, the disclosure provides a method of killing one or more target cells comprising contacting a composition comprising the target cells with a cell expressing a CAR, wherein (a) a first AD is present on the first target cell; (b) the composition comprising the first target cell further comprises a second target cell and an adaptor comprising (i) said first AD and (ii) a second AD on the second target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the first target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0020] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting a composition comprising a target cell with a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the target cell further comprises an adaptor comprising (i) an ADBD that binds to said first AD on said target cell, and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0021] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting a composition comprising a target cell with a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the target cell further comprises (i) an ADBD that is an ASBD that binds to said first AD on said target cell, and (ii) an adaptor that comprises a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0022] In some embodiments, the present disclosure provides a method of transmitting an immune response to a target cell comprising contacting a composition comprising a target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on said target cell.

[0023] In some embodiments, the present disclosure provides a method of transmitting an immune response to one or more target cells comprising contacting a composition comprising a first target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on a second target cell.

[0024] In some embodiments, the present disclosure provides a method of transmitting an immune response to a target cell comprising contacting a composition comprising a target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that is an ASBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0025] In some embodiments, the present disclosure provides a method of transmitting an immune response to a target cell comprising contacting a composition comprising a target cell with an adaptor, where (a) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0026] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell comprising contacting a composition comprising the target cell with a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the first target cell further comprises an adaptor comprising (i) said first AD and (ii) an ADBD that binds to a second AD on the target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0027] In some embodiments, the disclosure provides a method of delivering an immune response to one or more target cells comprising contacting a composition comprising the target cells with a cell expressing a CAR, wherein (a) a first AD is present on the first target cell; (b) the composition comprising the first target cell further comprises a second target cell and an adaptor comprising (i) said first AD and (ii) a second AD on the second target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the first target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0028] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell comprising contacting a composition comprising a target cell with a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the target cell further comprises an adaptor comprising (i) an ADBD that binds to said first AD on said target cell, and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0029] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell comprising contacting a composition comprising a target cell with a CAR, wherein (a) a first antigenic determinant (AD) is present on the target cell; (b) the composition comprising the target cell further comprises (i) an ADBD, an ASBD that binds to said first AD on said target cell, and (ii) an adaptor comprising a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0030] In some embodiments, the disclosure provides a method of killing a target cell in a patient comprising administering an adaptor to the patient, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on said target cell.

[0031] In some embodiments, the disclosure provides a method of redirecting killing of a target cell in a patient comprising administering to the patient an adaptor, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on a second target cell.

[0032] In some embodiments, the disclosure provides a method of killing a target cell in a patient comprising administering an adaptor to the patient, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that is an ASBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0033] In some embodiments, the disclosure provides a method of killing a target cell in a patient comprising administering an adaptor to the patient, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0034] In some embodiments, the disclosure provides a method of killing a target cell in a patient comprising administering to the patient a cell expressing a CAR, wherein (a) a first AD and a second AD are present on the target cell; (b) the patient has been treated with an adaptor comprising (i) said first AD and (ii) an ADBD that binds to said second AD on said target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0035] In some embodiments, the disclosure provides a method of inducing death of a target cell in a patient comprising administering to the patient a cell expressing a CAR, where (a) the patient has been treated with an adaptor comprising (i) a first AD and (ii) an ADBD that binds to a second AD on the target cell; and (b) the CAR comprises (i) an ADBD that binds to said first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0036] In some embodiments, the disclosure provides a method of killing a target cell in a patient comprising administering to the patient a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0037] In some embodiments, the disclosure provides a method of killing a target cell in a patient comprising administering to the patient a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that is an ASBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0038] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell in a patient comprising administering an adaptor to the patient, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on said target cell.

[0039] In some embodiments, the disclosure provides a method of redirecting an immune response to a target cell in a patient comprising administering to the patient an adaptor, wherein (a) the patient has undergone cell therapy expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on a second target cell.

[0040] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell in a patient comprising administering an adaptor to the patient, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that is an ASBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0041] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell in a patient comprising administering an adaptor to the patient, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0042] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell in a patient comprising administering to the patient a cell expressing a CAR, wherein (a) a first AD and a second AD are present on the target cell; (b) the patient has been treated with an adaptor comprising (i) said first AD and (ii) an ADBD that binds to said second AD on said target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0043] In some embodiments, the disclosure provides a method of inducing an immune response in a target cell in a patient comprising administering to the patient a cell expressing a CAR, where (a) the patient has been treated with an adaptor comprising (i) a first AD and (ii) an ADBD that binds to a second AD on the target cell; and (b) the CAR comprises (i) an ADBD that binds to said first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0044] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell in a patient comprising administering to the patient a cell expressing a CAR, wherein (a) a first AD is present on a target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0045] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell in a patient comprising administering to the patient a cell expressing a CAR, wherein (a) a first AD is present on a target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that is an ASBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0046] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising contacting a composition comprising a target cell with a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the target cell further comprises (i) an ADBD that is an ASBD that binds to said first AD on said target cell, and (ii) an adaptor that comprises a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0047] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient an adaptor, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) said first AD and (ii) a second AD on said target cell.

[0048] In some embodiments, the disclosure provides a method of redirecting treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection comprising administering to a patient an adaptor, where (a) the patient has been treated with cells expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on a second target cell.

[0049] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient an adaptor, where (a) the patient has been treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that is an ASBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises (i) the first AD and (ii) an ADBD that binds to a second AD on the target cell.

[0050] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient an adaptor, wherein (a) the patient has been treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0051] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient a cell expressing a CAR, wherein (a) a first AD and a second AD are present on a target cell; (b) the patient has been treated with an adaptor comprising (i) said first AD and (ii) an ADBD that binds to said second AD on said target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0052] In some embodiments, the disclosure provides a method of inducing treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection comprising administering to a patient cells expressing a CAR, where (a) the patient has been treated with an adaptor comprising (i) a first AD and (ii) an ADBD that binds to a second AD on a target cell; and (b) the CAR comprises (i) an ADBD that binds to said first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0053] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient a cell expressing a CAR, wherein (a) a first AD is present on a target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0054] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient a cell expressing a CAR, wherein (a) a first AD is present on a target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that is an ASBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0055] In some embodiments, the disclosure provides a method of treating hematological cancer comprising contacting a composition comprising a target cell with a cell expressing a CAR, wherein (a) a first AD is present on the target cell; (b) the composition comprising the target cell further comprises (i) an ADBD, which is an ASBD that binds to said first AD on said target cell, and (ii) an adaptor comprising a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0056] In some embodiments, the disclosure provides a method of treating a hematological cancer comprising administering an adaptor to a patient, wherein (a) the patient is treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first antigenic determinant (AD) on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) the first AD and (ii) a second AD on said target cell.

[0057] In some embodiments, the disclosure provides a method of redirecting treatment of a hematological cancer comprising administering to a patient an adaptor, wherein (a) the patient is treated with cells expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on a second target cell.

[0058] In some embodiments, the disclosure provides a method of treating a hematological cancer comprising administering an adaptor to a patient, wherein (a) the patient is treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that is an ASBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds (i) said first AD and (ii) a second AD on said target cell.

[0059] In some embodiments, the disclosure provides a method of treating a hematological cancer comprising administering an adaptor to a patient, wherein (a) the patient is treated with a cell expressing a CAR, the CAR comprising (i) an ADBD that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is (i) an ASBD that binds to said first AD and (ii) a second AD on said target cell.

[0060] In some embodiments, the disclosure provides a method of treating hematological cancer comprising administering to a patient a cell expressing a CAR, wherein (a) a first AD and a second AD are present on a target cell; (b) the patient has been treated with an adaptor comprising (i) said first AD and (ii) an ADBD that binds to said second AD on said target cell; and (c) the CAR comprises (i) an ADBD that binds to said first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0061] In some embodiments, the disclosure provides a method of inducing treatment of a hematological cancer comprising administering to a patient cells expressing a CAR, where (a) the patient has been treated with an adaptor comprising (i) a first AD and (ii) an ADBD that binds to a second AD on a target cell; and (b) the CAR comprises (i) an ADBD that binds to said first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0062] In some embodiments, the disclosure provides a method of treating a hematological cancer comprising administering to a patient a cell expressing a CAR, wherein (a) a first AD is present on a target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0063] In some embodiments, the disclosure provides a method of treating hematological cancer comprising administering to a patient a cell expressing a CAR, wherein (a) a first AD is present on a target cell; (b) the patient has been treated with an adaptor comprising (i) an ADBD that is an ASBD that binds to said first AD on said target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0064] In some embodiments, the disclosure provides a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) that comprises (1) an antigenic determinant binding domain (ADBD) that specifically binds a human CD45 antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; (b) a genetic modification that abolishes expression of human CD45 AD on the genetically modified cell, wherein the genetically modified cell is capable of inducing an immune response against CD45 AD-expressing cells in an in vitro assay, and wherein the genetically modified cell does not express CD45 AD.

[0065] In some embodiments, the disclosure provides a method of killing a human CD45-expressing target cell comprising contacting the target cell with a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) comprising (1) an antigenic determinant binding domain (ADBD) that specifically binds a human CD45 antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; (b) a genetic modification that abolishes expression of the human CD45 AD on the genetically modified cell.

[0066] In some embodiments, the disclosure provides a method of transducing an immune response to a human CD45-expressing target cell comprising contacting the target cell with a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) comprising (1) an antigenic determinant binding domain (ADBD) that specifically binds a human CD45 antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; (b) a genetic modification that abolishes expression of the human CD45 AD on the genetically modified cell.

[0067] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of genetically modified human immune effector cells, the genetically modified human immune effector cells comprising: (a) a chimeric antigen receptor (CAR) comprising (1) an antigenic determinant binding domain (ADBD) that specifically binds a human CD45 antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; (b) a genetic modification that abolishes expression of the human CD45 AD on the genetically modified cell.

[0068] In some embodiments, the disclosure provides a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) comprising: (1) a first antigenic determinant binding domain (ADBD) that specifically binds a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; (b) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell, wherein the first AD is not the at least one human CD45 AD, and the genetically modified cell used in combination with an adaptor in an in vitro assay is capable of inducing an immune response against CD45-expressing cells, wherein the adaptor comprises a second ADBD that specifically binds the first AD and the at least one human CD45 AD, and wherein the genetically modified cell does not express the at least one human CD45 AD.

[0069] In some embodiments, the disclosure provides a method of killing a target cell comprising contacting the target cell with a genetically modified human immune effector cell and an adaptor, wherein the target cell expresses CD45, and the genetically modified human immune effector cell comprises (a) a chimeric antigen receptor (CAR) comprising (1) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (b) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell, and the adaptor comprises the first AD and a second ADBD that specifically binds to the human CD45 AD.

[0070] In some embodiments, the disclosure provides a method of transmitting an immune response to a target cell comprising contacting the target cell with a genetically modified human immune effector cell and an adaptor, wherein the target cell expresses CD45, and the genetically modified human immune effector cell comprises (a) a chimeric antigen receptor (CAR) comprising (1) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (b) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell, and the adaptor comprises the first AD and a second ADBD that specifically binds to the human CD45 AD.

[0071] In some embodiments, the disclosure provides a method of inducing an immune response against a CD45-expressing target cell in a subject comprising: (a) (i) administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (1) a first antigenic determinant binding domain (ADBD) that specifically binds a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising the first AD and a second ADBD that specifically binds to the human CD45 AD.

[0072] In some embodiments, the disclosure provides a method of inducing an immune response against a CD45-expressing target cell of a subject comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (i) a chimeric antigen receptor (CAR) comprising (1) a first antigenic determinant binding domain (ADBD) that specifically binds a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell, wherein the subject has been administered an adaptor comprising the first AD and a second ADBD that specifically binds to the human CD45 AD.

[0073] In some embodiments, the present disclosure provides a method of inducing an immune response against a CD45-expressing target cell in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to a human CD45 AD, wherein the subject has been administered (i) a chimeric antigen receptor (CAR) comprising (1) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell.

[0074] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection in a subject comprising: (a) (i) administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (1) a first antigenic determinant binding domain (ADBD) that specifically binds a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising the first AD and a second ADBD that specifically binds to the human CD45 AD.

[0075] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (i) a chimeric antigen receptor (CAR) comprising (1) a first antigenic determinant binding domain (ADBD) that specifically binds a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell, wherein the subject has been administered an adaptor comprising the first AD and a second ADBD that specifically binds the human CD45 AD.

[0076] In some embodiments, the present disclosure provides a method of treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to a human CD45 AD, wherein the subject has been administered (i) a chimeric antigen receptor (CAR) comprising (1) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell.

[0077] In some embodiments, the disclosure provides a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) comprising: (i) two or more antigenic determinants (ADBDs) comprising a first antigenic determinant binding domain (ADBD) that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) a genetic modification that abolishes expression of the first AD on the genetically modified cell, such that the genetically modified cell does not express the first AD.

[0078] In some embodiments, the disclosure provides a method of killing a target cell comprising: (a) contacting the target cell with a genetically modified human immune effector cell comprising: (i) two or more chimeric antigen receptors (CARs) comprising a first antigenic determinant (ADBD) that binds to a first ADBD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) a genetic modification that abolishes expression of the first AD on the genetically modified cell.

[0079] In some embodiments, the disclosure provides a method of inducing an immune response against a target cell of a subject comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) comprising: (i) two or more antigenic determinant binding domains (ADBDs) comprising a first antigenic determinant (ADBD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) a genetic modification that abolishes expression of the first AD on the genetically modified cell.

[0080] In some embodiments, the disclosure provides a method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (a) two or more chimeric antigen receptors (CARs) comprising (i) a first antigenic determinant (ADBD) that binds to a first ADBD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) a genetic modification that abolishes expression of the first AD on the genetically modified cell.

[0081] In some embodiments, the disclosure provides a method of inducing an immune response against a target cell of a subject comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (1) two or more antigenic determinant binding domains (ADBDs) comprising a first ADBD that binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of the first AD on the genetically modified cell; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising an AD recognized by the CAR and a second ADBD capable of binding to a second AD on the target cell.

[0082] In some embodiments, the disclosure provides a genetically modified human immune effector cell comprising: (a) a chimeric antigen receptor (CAR) comprising (i) a first antigenic determinant binding domain (ADBD) that specifically binds a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) a genetic modification that abolishes expression of a second AD on the genetically modified cell, wherein the genetically modified cell used in combination with an adaptor is capable of inducing an immune response against cells expressing the second AD in an in vitro assay, wherein the adaptor comprises a second ADBD that specifically binds the first AD and the second AD, and wherein the genetically modified cell does not express the second AD.

[0083] In some embodiments, the disclosure provides a method of inducing an immune response against a target cell of a subject comprising: (a) (i) administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (1) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of a second AD on the genetically modified cell; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising the first AD recognized by the CAR and a second ADBD capable of binding to the second AD expressed on the target cell.

[0084] In some embodiments, the disclosure provides a method of inducing an immune response against a target cell of a subject comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (1) two or more antigenic determinant binding domains (ADBDs) comprising a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of the second AD on the genetically modified cell; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising the first AD recognized by the CAR and a second ADBD capable of binding to the second AD expressed on the target cell. [The present invention 1001] 1. A composition suitable for therapeutic use comprising a cell expressing a chimeric antigen receptor (CAR) and an adaptor, (a) the CAR comprises (i) a D domain that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain, and the adaptor comprises an adaptor that comprises (i) the first AD and (ii) an ADBD that binds to a second AD on a target cell, wherein the first AD is AFP p26, AFP, CD123, BCMA, or CS1, and the second AD is CS1, BCMA, CD19, CD22, CD45, CD123, HER2, TACI, BAFFR, or PDL1; (b) the CAR comprises (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a target cell, (ii) a transmembrane domain, and (iii) an intracellular domain, and the adapter comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (c) the CAR comprises (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a target cell, (ii) a transmembrane domain, and (iii) an intracellular domain, and the adapter comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell; (d) the CAR comprises (i) an antigenic determinant binding domain (ADBD) that is an alternative scaffold binding domain (ASBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain, and the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a target cell; (e) the CAR comprises (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain, and the adapter comprises an ADBD that comprises (i) the first AD and (ii) an ASBD that binds to a second AD on a target cell; (f) the CAR comprises (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain, and the adapter comprises (i) the first AD and (ii) a D domain that binds to a second AD on a target cell; (g) the CAR comprises (i) a D domain that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain, and the adapter comprises (i) an ADBD that binds to the first AD and (ii) a second AD on a target cell; (h) The composition, wherein the CAR comprises (i) a first D domain that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain, and the adaptor comprises (i) the first AD and (ii) a second D domain that binds to a second AD on a target cell. [The present invention 1002] The composition of the present invention, wherein the CAR is characterized by one or more of the following: (a) the CAR comprises a single chain variable fragment (scFv) ADBD; (b) the CAR comprises an alternative scaffold binding domain (ASBD) ADBD; (c) the CAR comprises a D domain, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 17-26, and 27 or SEQ ID NOs: 44-1078, and 1079; (d) the CAR comprises two ADBDs; (e) the CAR comprises an ASBD and an scFv; (f) the CAR comprises a D domain and an scFv; (g) the CAR comprises two ASBDs; (h) the CAR comprises two D domains; (i) the intracellular domain of the CAR is a signaling domain; (j) the intracellular domain of the CAR comprises a primary signaling domain; (k) the intracellular domain of the CAR comprises a CD3ζ primary signaling domain; (l) the intracellular domain of the CAR further comprises a costimulatory signaling domain; (m) the intracellular domain of the CAR comprises a costimulatory signaling domain selected from CD28, 41BB, CD27, and CD134; (n) the intracellular domain of the CAR comprises a 41BB costimulatory signaling domain; (o) the CAR binds to an antigen selected from CD19, CD22, CD123, BCMA, CS1, HER2, TACI, BAFFR, and PDL1; (p) the CAR binds to BCMA, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 44-338, and 339; (q) the CAR binds to CD123, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 340-77 and 773; (r) the CAR binds to CD19, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1030-1058 and 1059; (s) the CAR binds to CD22, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1060-1068 and 1069; (t) the CAR binds to CS1, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 780-794 and 795; (u) the CAR binds to HER2, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 800-839 and 840; (v) the CAR binds to TACI or BAFFR; (w) the CAR binds to PDL1, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1010-1016, 1074-1078, and 1079; (x) the CAR binds to AFP p26, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 841-983 and 984; (y) the CAR comprises two ADBDs that bind to separate targets; (z) the CAR binds to CD19 and CD123; (aa) the CAR binds to BCMA and CS1; (bb) the CAR binds to CD22 and CD123; (cc) the CAR binds to PDL1 and CD123; (dd) the CAR comprises a first ASBD that binds CD19 and a second ASBD that binds CD123; (ee) the CAR comprises a first D domain that binds CD19 and a second D domain that binds CD123; (ff) the CAR comprises a D domain that binds to CD19 and an scFv that binds to CD123; (gg) the CAR comprises a first ASBD that binds BCMA and a second ASBD that binds CS1; (hh) the CAR comprises a first D domain that binds BCMA and a second D domain that binds CS1; (ii) the CAR comprises a D domain that binds to CS1 and an scFv that binds to BCMA; (jj) the CAR comprises a D domain that binds BCMA and an scFv that binds CS1; (kk) the CAR comprises a first ASBD that binds CD22 and a second ASBD that binds CD123; (ll) the CAR comprises a first D domain that binds CD22 and a second D domain that binds CD123; (mm) the CAR comprises a D domain that binds to CD22 and an scFv that binds to CD123; (nn) the CAR comprises a first ASBD that binds PDL1 and a second ASBD that binds CD123; (oo) the CAR comprises a first D domain that binds to PDL1 and a second D domain that binds to CD123; (pp) the CAR comprises a D domain that binds to PDL1 and an scFv that binds to CD123; and (qq) The CAR comprises an ASBD that binds to CD19 and an scFv that binds to CD123. [The present invention 1003] The composition of claim 1001 or 1002, wherein the adapter is characterized by one or more of the following: (a) the adapter comprises an AD that is an epitope of AFP p26 or AFP, and optionally comprises amino acid residues of SEQ ID NO: 16 or 1117-1123; (b) the adapter comprises an AD of a tumor antigen, optionally wherein the tumor antigen is selected from the group: BCMA, CD123, CD19, CD22, CS1, HER2, TACI, BAFFR, and PDL1; (c) comprising an ADBD, wherein the adapter is an scFv; (d) the adaptor comprises an ADBD that is an ASBD; (e) the adapter comprises a D domain, and optionally the adapter comprises a sequence selected from the group: SEQ ID NOs: 17-26, and 27, or SEQ ID NOs: 44-1078, and 1079; (f) the adapter comprises two ADBDs, optionally wherein the ADBDs (i) are the same, (ii) bind to the same antigenic determinant, (iii) bind to different ADs of the same antigen, (iv) bind to different antigens on the same cell, or (v) bind to different antigens on different cells; (g) the adapter comprises two ASBDs; (h) the adapter comprises two D domains, and optionally, the adapter comprises an amino acid sequence selected from the group: SEQ ID NOs: 44-1079; (i) the adaptor includes an ADBD that is an scFv and an ADBD that is an ASBD; (j) the adapter comprises an ADBD that is an scFv and an ADBD that is a D domain; (k) the adaptor comprises an ADBD that binds to a member selected from BCMA, CD123, CD19, CD22, CS1, HER2, TACI, BAFFR, and PDL1; (l) the adaptor comprises an ADBD that binds to BCMA, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 44-338, and 339; (m) the adaptor comprises an ADBD that binds to CS1, and optionally, the ADBD comprises a sequence selected from SEQ ID NOs: 780-794, and 795; (n) the adaptor comprises an ADBD that binds to HER2, and optionally, the ADBD comprises a sequence selected from SEQ ID NOs: 800-839, and 840; (o) the adaptor comprises an ADBD that binds to CD123, optionally wherein the ADBD comprises a sequence selected from SEQ ID NOs: 340-772, and 773; (p) the adaptor comprises an ADBD that binds to CD19, and optionally, the ADBD comprises a sequence selected from SEQ ID NOs: 1030-1058, and 1059; (q) the adaptor comprises an ADBD that binds to CD22, optionally wherein the ADBD comprises a sequence selected from SEQ ID NOs: 1060-1068, and 1069; (r) the adaptor comprises an ADBD that binds to TACI; (s) the adaptor comprises an ADBD that binds to BAFFR; (t) the adaptor comprises an ADBD that binds to PDL1, optionally wherein the ADBD comprises a sequence selected from SEQ ID NOs: 1010-1016, 1074-1078, and 1079; (u) the adapter is bispecific; (v) the adaptor comprises an ADBD that binds CD19 and an ADBD that binds CD123; (w) the adaptor comprises an ADBD that binds BCMA and an ADBD that binds CS1; (x) the adaptor comprises an ADBD that binds CD22 and an ADBD that binds CD123; and (y) The adaptor comprises an ADBD that binds to PDL1 and an ADBD that binds to CD123. [The present invention 1004] Any one of compositions 1001 to 1003 of the present invention, (a) the target cell is a tumor cell; (b) the target cell is a tumor cell selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (c) the target cell is a multiple myeloma; (d) at least one target cell is a tumor cell, and optionally the tumor cell is selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (e) the first and second target cells are tumor cells, and optionally the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (f) the first and second target cells are tumor cells of the same type, and optionally the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (g) the first and second target cells are different types of tumor cells, and optionally the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (h) the target cells are cancer cells selected from breast, prostate, ovarian, pancreatic, colon, and lung cancer; and / or (i) The composition, wherein the target cell is a breast or ovarian cancer cell. [The present invention 1005] Any one of compositions 1001 to 1004 of the present invention, (a) the CAR-expressing cell is an immune effector cell; (b) the CAR-expressing cell is a T cell; or (c) The composition, wherein the CAR-expressing cell is a NK cell. [The present invention 1006] A method for killing a target cell, comprising contacting the target cell with any one of the compositions of the present inventions 1001 to 1005. [The present invention 1007] 1. A method for killing a target cell, for transmitting an immune response to a target cell, for treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection, or for treating a hematological cancer, comprising: (a) contacting a composition comprising target cells with an adaptor, (1) the composition comprising the target cell further comprises a cell expressing a CAR, the CAR comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first AD on the target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (2) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (b) contacting a composition comprising a first target cell with an adaptor, (1) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR), the CAR comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first AD on the first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds (i) the first AD and (ii) a second AD on a second target cell; (c) contacting a composition comprising target cells with an adaptor, (1) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR), the CAR comprising (i) an antigenic determinant binding domain (ADBD), the ASBD binding to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (d) contacting a composition comprising target cells with an adaptor, (1) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR), the CAR comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell; (e) contacting the composition comprising the target cells with cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the composition comprising the first target cell further comprises an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) a second AD on the target cell; and (3) the CAR comprises (i) an ADBD that binds to the first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain; (f) contacting the composition comprising the target cells with cells expressing a chimeric antigen receptor (CAR), (1) a first AD is present on a first target cell; (2) the composition comprising the first target cell further comprises a second target cell and an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) a second AD on the second target cell; and (3) the CAR comprises (i) an ADBD that binds to the first AD on the first target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain; (g) contacting the composition comprising the target cells with cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the composition comprising the target cell further comprises an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; and (3) the CAR comprises (i) an ADBD, which is an ASBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain; (h) contacting the composition comprising the target cells with cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the composition comprising the target cell further comprises (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) an adaptor comprising a second AD; and (3) The method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain. [The present invention 1008] Methods for killing target cells, methods for redirecting the killing of target cells in a patient, methods for conveying an immune response to target cells in a patient, methods for inducing an immune response to target cells in a patient, methods for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a patient, methods for redirecting treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a patient, methods for inducing treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a patient, methods for treating a hematological cancer in a patient, methods for redirecting treatment of a hematological cancer in a patient, or methods for inducing treatment of a hematological cancer in a patient, (a) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on the target cell; (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (b) administering to the patient an adaptor, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a first target cell; (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds (i) the first AD and (ii) a second AD on a second target cell; (c) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to a first antigenic determinant (AD); (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (d) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD); (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell; (e) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) and a second AD are present on the target cell; (2) the patient has been treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) the second AD on the target cell; and (3) the CAR comprises (i) an ADBD that binds to the first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain; (f) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) the patient has been treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) a first antigenic determinant (AD) and (ii) a second AD on the target cell; and (2) the CAR comprises (i) an ADBD that binds to the first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain; (g) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the patient has been treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; and (3) the CAR comprises (i) an ADBD, which is an ASBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain; (h) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the patient has been treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) a second AD; and (3) the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain; (i) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on the target cell; (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (j) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a first target cell; (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds (i) the first AD and (ii) a second AD on a second target cell; (k) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to a first antigenic determinant (AD); (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell; (l) administering to the patient an adapter, (1) the patient is treated with a cell expressing a chimeric antigen receptor (CAR), the CAR comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD); (ii) a transmembrane domain; and (iii) an intracellular domain; and (2) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell; (m) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) and a second AD are present on the target cell; (2) the patient has been treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) the second AD on the target cell; and (3) the CAR comprises (i) an ADBD that binds to the first AD on the target cell or the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain; (n) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) the patient has been treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) a first antigenic determinant (AD) and (ii) a second AD on the target cell; and (2) the CAR comprises (i) an ADBD that binds to the first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain; (o) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the patient has been treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; and (3) the CAR comprises (i) an ADBD, which is an ASBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain; (p) administering to the patient cells expressing a chimeric antigen receptor (CAR), (1) a first antigenic determinant (AD) is present on the target cell; (2) the patient has been treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) a second AD; and (3) The method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain. [The present invention 1009] The method of any one of claims 1007 to 1008, wherein said proliferative disorder, cancer or hematological cancer is selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, myelodysplasia, breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, colon cancer, and lung cancer. [The present invention 1010] The method of any one of claims 1007 to 1009, wherein said CAR is characterized by one or more of the following: (a) the CAR comprises a single chain variable fragment (scFv) ADBD; (b) the CAR comprises an alternative scaffold binding domain (ASBD) ADBD; (c) the CAR comprises a D domain, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 17-26, and 27 or SEQ ID NOs: 44-1078, and 1079; (d) the CAR comprises two ADBDs; (e) the CAR comprises an ASBD and an scFv; (f) the CAR comprises a D domain and an scFv; (g) the CAR comprises two ASBDs; (h) the CAR comprises two D domains; (i) the intracellular domain of the CAR is a signaling domain; (j) the intracellular domain of the CAR comprises a primary signaling domain; (k) the intracellular domain of the CAR comprises a CD3ζ primary signaling domain; (l) the intracellular domain of the CAR further comprises a costimulatory signaling domain; (m) the intracellular domain of the CAR comprises a costimulatory signaling domain selected from CD28, 41BB, CD27, and CD134; (n) the intracellular domain of the CAR comprises a 41BB costimulatory signaling domain; (o) the CAR binds to an antigen selected from CD19, CD22, CD123, BCMA, CS1, HER2, TACI, BAFFR, and PDL1; (p) the CAR binds to BCMA, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 44-338, and 339; (q) the CAR binds to CD123, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 340-77 and 773; (r) the CAR binds to CD19, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1030-1058 and 1059; (s) the CAR binds to CD22, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1060-1068 and 1069; (t) the CAR binds to CS1, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 780-794 and 795; (u) the CAR binds to HER2, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 800-839 and 840; (v) the CAR binds to TACI or BAFFR; (w) the CAR binds to PDL1, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1010-1016, 1074-1078, and 1079; (x) the CAR binds to AFP p26, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 841-983 and 984; (y) the CAR comprises two ADBDs that bind to separate targets; (z) the CAR binds to CD19 and CD123; (aa) the CAR binds to BCMA and CS1; (bb) the CAR binds to CD22 and CD123; (cc) the CAR binds to PDL1 and CD123; (dd) the CAR comprises a first ASBD that binds CD19 and a second ASBD that binds CD123; (ee) the CAR comprises a first D domain that binds CD19 and a second D domain that binds CD123; (ff) the CAR comprises a D domain that binds to CD19 and an scFv that binds to CD123; (gg) the CAR comprises a first ASBD that binds BCMA and a second ASBD that binds CS1; (hh) the CAR comprises a first D domain that binds BCMA and a second D domain that binds CS1; (ii) the CAR comprises a D domain that binds to CS1 and an scFv that binds to BCMA; (jj) the CAR comprises a D domain that binds BCMA and an scFv that binds CS1; (kk) the CAR comprises a first ASBD that binds CD22 and a second ASBD that binds CD123; (ll) the CAR comprises a first D domain that binds CD22 and a second D domain that binds CD123; (mm) the CAR comprises a D domain that binds to CD22 and an scFv that binds to CD123; (nn) the CAR comprises a first ASBD that binds PDL1 and a second ASBD that binds CD123; (oo) the CAR comprises a first D domain that binds to PDL1 and a second D domain that binds to CD123; (pp) the CAR comprises a D domain that binds to PDL1 and an scFv that binds to CD123; and (qq) The CAR comprises an ASBD that binds to CD19 and an scFv that binds to CD123. [The present invention 1011] The method of any one of claims 1007 to 1010, wherein the adapter is characterized by one or more of the following: (a) the adapter comprises an AD that is an epitope of AFP p26 or AFP, and optionally comprises amino acid residues of SEQ ID NO: 16 or 1117-1123; (b) the adapter comprises an AD of a tumor antigen, optionally wherein the tumor antigen is selected from the group: BCMA, CD123, CD19, CD22, CS1, HER2, TACI, BAFFR, and PDL1; (c) comprising an ADBD, wherein the adapter is an scFv; (d) the adaptor comprises an ADBD that is an ASBD; (e) the adapter comprises a D domain, and optionally the adapter comprises a sequence selected from the group: SEQ ID NOs: 17-26, and 27, or SEQ ID NOs: 44-1078, and 1079; (f) the adapter comprises two ADBDs, optionally wherein the ADBDs (i) are the same, (ii) bind to the same antigenic determinant, (iii) bind to different ADs of the same antigen, (iv) bind to different antigens on the same cell, or (v) bind to different antigens on different cells; (g) the adapter comprises two ASBDs; (h) the adapter comprises two D domains, and optionally, the adapter comprises an amino acid sequence selected from the group: SEQ ID NOs: 44-1079; (i) the adaptor includes an ADBD that is an scFv and an ADBD that is an ASBD; (j) the adapter comprises an ADBD that is an scFv and an ADBD that is a D domain; (k) the adaptor comprises an ADBD that binds to a member selected from BCMA, CD123, CD19, CD22, CS1, TACI, BAFFR, and PDL1; (l) the adaptor comprises an ADBD that binds to BCMA, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 44-338, and 339; (m) the adaptor comprises an ADBD that binds to CS1, and optionally, the ADBD comprises a sequence selected from SEQ ID NOs: 780-794, and 795; (n) the adaptor comprises an ADBD that binds to HER2, and optionally, the ADBD comprises a sequence selected from SEQ ID NOs: 800-839, and 840; (o) the adaptor comprises an ADBD that binds to CD123, optionally wherein the ADBD comprises a sequence selected from SEQ ID NOs: 340-772, and 773; (p) the adaptor comprises an ADBD that binds to CD19, and optionally, the ADBD comprises a sequence selected from SEQ ID NOs: 1030-1058, and 1059; (q) the adaptor comprises an ADBD that binds to CD22, optionally wherein the ADBD comprises a sequence selected from SEQ ID NOs: 1060-1068, and 1069; (r) the adaptor comprises an ADBD that binds to TACI; (s) the adaptor comprises an ADBD that binds to BAFFR; (t) the adaptor comprises an ADBD that binds to PDL1, optionally wherein the ADBD comprises a sequence selected from SEQ ID NOs: 1010-1016, 1074-1078, and 1079; (u) the adapter is bispecific; (v) the adaptor comprises an ADBD that binds CD19 and an ADBD that binds CD123; (w) the adaptor comprises an ADBD that binds BCMA and an ADBD that binds CS1; (x) the adaptor comprises an ADBD that binds CD22 and an ADBD that binds CD123; and (y) The adaptor comprises an ADBD that binds to PDL1 and an ADBD that binds to CD123. [The present invention 1012] Any of the methods of 1007 to 1011 of the present invention, (a) the target cell is a tumor cell; (b) the target cell is a tumor cell selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (c) the target cell is a multiple myeloma; (d) at least one target cell is a tumor cell, and optionally the tumor cell is selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (e) the first and second target cells are tumor cells, and optionally the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (f) the first and second target cells are tumor cells of the same type, and optionally the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (g) the first and second target cells are different types of tumor cells, and optionally the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia; (j) the target cells are cancer cells selected from breast, prostate, ovarian, pancreatic, colon, and lung cancer; and / or (h) The method, wherein the target cell is a breast or ovarian cancer cell. [The present invention 1013] Any of the methods of 1007 to 1012 of the present invention, (a) the CAR-expressing cell is an immune effector cell; (b) the CAR-expressing cell is a T cell; or (c) the method, wherein the CAR-expressing cell is a NK cell. [The present invention 1014] 1. A genetically modified human immune effector cell, comprising: a. a chimeric antigen receptor (CAR) comprising: (1) an antigenic determinant binding domain (ADBD) that specifically binds to a human CD45 antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and b. A genetic modification that abolishes expression of human CD45 AD on the genetically modified cells; A genetically modified human immune effector cell, wherein said genetically modified cell is capable of inducing an immune response against CD45 AD expressing cells in an in vitro assay, and wherein said genetically modified cell does not express said CD45 AD. [The present invention 1015] A method for killing a target cell or transmitting an immune response to a target cell, comprising contacting said target cell with a genetically modified cell of the invention 1014, wherein said target cell expresses human CD45. [The present invention 1016] A method for inducing an immune response in target cells, treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject, a method for depleting lymphocytes in a subject, a method for depleting memory T cells in a subject, a method for treating an autoimmune disease or disorder in a subject, or a method for treating a hematological cancer in a subject, or a method for pretreating a subject for transplantation, comprising administering an effective amount of a genetically modified cell of the present invention 1014 to the subject in need thereof. [The present invention 1017] 1. A genetically modified human immune effector cell, comprising: a. a chimeric antigen receptor (CAR) comprising: (1) a first antigen determinant binding domain (ADBD) that specifically binds to a first antigen determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and b. comprising a genetic modification that abolishes expression of at least one human CD45 AD on said genetically modified cells; A genetically modified human immune effector cell, wherein the first AD is not at least one human CD45 AD, and wherein the genetically modified cell used in combination with an adapter in an in vitro assay is capable of inducing an immune response against CD45 AD expressing cells, and wherein the adapter comprises a second ADBD that specifically binds to the first AD and at least one human CD45 AD, and wherein the genetically modified cell does not express at least one human CD45 AD. [The present invention 1018] A method for killing a target cell or transmitting an immune response to a target cell, comprising contacting a genetically modified cell of the present invention with an adaptor and said target cell, wherein said target cell expresses CD45, said adaptor comprises said first AD and a second ADBD that specifically binds to human CD45 AD, and optionally said target cell is a blood cancer cell. [The present invention 1019] 1. A method for inducing an immune response in target cells, a method for treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject, a method for depleting lymphocytes in a subject, a method for depleting memory T cells in a subject, a method for treating an autoimmune disease or disorder in a subject, or a method for treating a hematological cancer in a subject, or a method for pre-treating a subject for transplantation, comprising: a. administering to said subject in need thereof a therapeutically effective amount of the genetically modified cells of the invention 1017 and a therapeutically effective amount of an adaptor comprising said first AD and a second ADBD that specifically binds to a human CD45 AD; b. administering a therapeutically effective amount of a genetically modified cell of the invention 1234 to said subject in need thereof, said subject having been administered an adaptor comprising said first AD and a second ADBD that specifically binds to a human CD45 AD; or c. A method comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising the first AD and a second ADBD that specifically binds to a human CD45 AD, wherein the subject has been administered a genetically modified cell of the present invention. [The present invention 1020] 1. A genetically modified human immune effector cell, comprising: a. a chimeric antigen receptor (CAR) comprising: (i) two or more antigen determinant binding domains (ADBDs) comprising a first antigen determinant (ADBD) that binds to a first antigen determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and b. A genetically modified human immune effector cell comprising a genetic modification that abolishes expression of said first AD on said genetically modified cell, such that said genetically modified cell does not express said first AD. [The present invention 1021] 1. A method for killing a target cell or delivering an immune response to a target, comprising: a. contacting the genetically modified cell of the present invention with the target cell; b. contacting the genetically modified cell of the present invention 1020 with an adaptor and the target cell, wherein the adaptor comprises an AD recognized by the CAR and a second ADBD; c. contacting the genetically modified cell of the present invention 1020 with an adaptor and said target cell, said adaptor comprising said CAR and an AD recognized by a second ADBD capable of binding to a second AD on said target cell; or d. A method comprising contacting a genetically modified cell of the present invention 1020 with an adaptor and a cancer cell, wherein the adaptor comprises an AD that is recognized by the CAR and a second ADBD that can bind to a second AD on the cancer cell. [The present invention 1022] 1. A method for inducing an immune response in target cells, a method for treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject, a method for depleting lymphocytes in a subject, a method for depleting memory T cells in a subject, a method for treating an autoimmune disease or disorder in a subject, or a method for treating a hematological cancer in a subject, or a method for pre-treating a subject for transplantation, comprising: a. administering to said subject in need thereof a therapeutically effective amount of the genetically modified cells of the present invention; b. administering to the subject in need thereof a therapeutically effective amount of the genetically modified cells of the present invention 1020 and a therapeutically effective amount of an adaptor comprising an AD recognized by the CAR and a second ADBD capable of binding to a second AD on the target cell; c. administering a therapeutically effective amount of the genetically modified cells of the present invention 1020 to the subject in need thereof, wherein the subject comprises an AD recognized by the CAR and a second ADBD capable of binding to a second AD on the target cell; d. A method comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising an AD recognized by the CAR and a second ADBD capable of binding to a second AD on the target cell, wherein the subject has been administered a genetically modified cell of the present invention 1020. [The present invention 1023] 1. A genetically modified human immune effector cell, comprising: a. a chimeric antigen receptor (CAR) comprising: (i) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and b. A genetically modified human immune effector cell comprising a genetic modification that abolishes expression of a second AD on said genetically modified cell, wherein said genetically modified cell used in combination with an adapter is capable of inducing an immune response against said second AD expressing cells in an in vitro assay, said adapter comprising a second ADBD that specifically binds to said first AD and said second AD, and said genetically modified cell does not express said second AD. [The present invention 1024] 1. A genetically modified human immune effector cell, comprising: a. a chimeric antigen receptor (CAR) comprising: (i) two or more antigen determinant binding domains (ADBDs) comprising a first antigen determinant (ADBD) that specifically binds to a first antigen determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and b. A genetically modified human immune effector cell comprising a genetic modification that abolishes expression of a second AD on said genetically modified cell, wherein said genetically modified cell used in combination with an adapter is capable of inducing an immune response against said second AD expressing cells in an in vitro assay, said adapter comprising a second ADBD that specifically binds to said first AD and said second AD, and said genetically modified cell does not express said second AD. [The present invention 1025] A method for killing a target cell or transmitting an immune response to a target cell, comprising contacting a genetically modified cell of invention 1023 or invention 1024 with an adaptor and said target cell, wherein said adaptor comprises a second ADBD that specifically binds to said first AD and said second AD, said second AD being expressed on said target cell, and optionally said target cell being a blood cancer cell. [The present invention 1026] 1. A method for inducing an immune response in target cells, a method for treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject, a method for depleting lymphocytes in a subject, a method for depleting memory T cells in a subject, a method for treating an autoimmune disease or disorder in a subject, or a method for treating a hematological cancer in a subject, or a method for pre-treating a subject for transplantation, comprising: a. administering to said subject in need thereof a therapeutically effective amount of the genetically modified cells of invention 1023 or invention 1024; b. administering to the subject in need thereof a therapeutically effective amount of the genetically modified cells of the invention 1023 or 1024 and a therapeutically effective amount of an adaptor comprising a second ADBD that specifically binds to the first AD and the second AD, wherein the second AD is expressed on the target cell; c. administering a therapeutically effective amount of the genetically modified cell of invention 1023 or invention 1024 to the subject in need thereof, wherein the subject has been administered an adaptor comprising the first AD and a second ADBD that specifically binds to the second AD, and wherein the second AD is expressed on the target cell; or d. A method comprising the step of administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a second ADBD that specifically binds to the first AD and the second AD, wherein the subject has been administered the genetic modification of invention 1023 or invention 1024 and the second AD is expressed on the target cell. [The present invention 1027] An isolated adaptor polypeptide comprising (1) an antigenic determinant (AD) and (b) one or more antigenic determinant binding domains (ADBDs), wherein at least one ADBD specifically binds to human CD45 AD, and wherein contacting the adaptor with a CD45 AD-expressing target cell in the presence of a genetically modified cell of the present invention 1017 induces an immune response by the genetically modified cell against the target cell in an in vitro assay.

[0085] In some embodiments, the disclosure provides a method of inducing an immune response against a target cell of a subject comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified human immune effector cell comprising: (1) two or more antigenic determinant binding domains (ADBDs) comprising a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (ii) a genetic modification that abolishes expression of the second AD on the genetically modified cell; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising the first AD recognized by the CAR and a second ADBD capable of binding to the second AD expressed on the target cell.

[0086] In some embodiments, the present disclosure provides the following: [1] A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) an ADBD that binds to a second AD on the target cell. [2] A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) an ADBD that binds to a second AD on a second target cell. [3] A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD), which is an alternative scaffold binding domain (ASBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) an ADBD that binds to a second AD on a target cell. [4] A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) an ADBD comprising an ASBD that binds to a second AD on a target cell. [5]. A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising a D domain that binds to (i) the first AD and (ii) a second AD on a target cell. [6] A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising (i) a D domain that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) an ADBD that binds to a second AD on a target cell. [7] A composition comprising: (a) a cell expressing a chimeric antigen receptor (CAR) comprising: (i) a first D domain that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) an adaptor comprising (i) the first AD and (ii) a second D domain that binds to a second AD on a target cell. [8]. The composition described in any of [1] to [7], wherein the CAR comprises a single-chain variable fragment (scFv) ADBD. [9] The composition described in any of [1] to [7], wherein the CAR comprises an ADBD that is an alternative scaffold binding domain (ASBD).

[10] . The composition of [9], wherein the CAR comprises a D domain, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 17-26, and 27 or SEQ ID NOs: 44-1078, and 1079.

[11] . The composition described in any one of [1] to

[10] , wherein the CAR comprises two ADBDs.

[12] . The composition described in

[11] , wherein the CAR comprises an ASBD and an scFv.

[13] . The composition described in

[11] , wherein the CAR comprises a D domain and an scFv.

[14] . The composition described in

[11] , wherein the CAR comprises two ASBDs.

[15] . The composition described in

[11] , wherein the CAR comprises a 2D domain.

[16] The composition described in any of [1] to

[15] , wherein the intracellular domain of CAR is a signal transduction domain.

[17] . The composition described in

[16] , wherein the intracellular domain of the CAR comprises a primary signaling domain.

[18] . The composition described in

[16] , wherein the intracellular domain of the CAR comprises a CD3ζ primary signaling domain.

[19] . The composition of

[17] or

[18] , wherein the intracellular domain of the CAR further comprises a costimulatory signaling domain.

[20] . The composition described in

[19] , wherein the intracellular domain of the CAR comprises a costimulatory signaling domain selected from CD28, 41BB, CD27, and CD134.

[21] . The composition described in

[20] , wherein the intracellular domain of the CAR comprises a 41BB costimulatory signaling domain.

[22] . The composition described in any of [1] to

[21] , wherein the CAR binds to an antigen selected from CD19, CD22, CD123, BCMA, CS1, HER2, TACI, BAFFR, and PDL1.

[23] . The composition of

[22] , wherein the CAR binds to BCMA, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 44-338, and 339.

[24] . The composition of

[22] , wherein the CAR binds to CD123, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 340-77 and 773.

[25] . The composition of

[22] , wherein the CAR binds to CD19, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1030-1058 and 1059.

[26] . The composition of

[22] , wherein the CAR binds to CD22, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1060-1068, and 1069.

[27] . The composition of

[22] , wherein the CAR binds to CS1, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 780-794 and 795.

[28] . The composition of

[22] , wherein the CAR binds to HER2, and optionally, the CAR comprises a sequence selected from the group: SEQ ID NOs: 800-839 and 840.

[29] . The composition of

[22] , wherein the CAR binds to PDL1, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 1010-1016, 1074-1078, and 1079.

[30] . The composition of any of [1] to

[21] , wherein the CAR binds to AFP p26, and optionally the CAR comprises a sequence selected from the group: SEQ ID NOs: 841 to 983, and 984.

[31] The composition described in any of [1] to

[30] , wherein the CAR comprises two ADBDs that bind to separate targets.

[32] . The composition described in

[31] , wherein the CAR binds to CD19 and CD123.

[33] . The composition of

[31] , wherein CAR binds to BCMA and CS1.

[34] . The composition described in

[31] , wherein the CAR binds to CD22 and CD123.

[35] . The composition described in

[31] , wherein CAR binds to PDL1 and CD123.

[36] The composition described in

[32] , wherein the CAR comprises a first ASBD that binds to CD19 and a second ASBD that binds to CD123.

[37] . The composition described in

[36] , wherein the CAR comprises a first D domain that binds to CD19 and a second D domain that binds to CD123.

[38] The composition described in

[32] , wherein the CAR comprises a D domain that binds to CD19 and an scFv that binds to CD123.

[39] The composition described in

[33] , wherein the CAR comprises a first ASBD that binds to BCMA and a second ASBD that binds to CS1.

[40] . The composition described in

[39] , wherein the CAR comprises a first D domain that binds to BCMA and a second D domain that binds to CS1.

[41] . The composition described in

[33] , wherein the CAR comprises a D domain that binds to CS1 and an scFv that binds to BCMA.

[42] . The composition described in

[39] , wherein the CAR comprises a D domain that binds to BCMA and an scFv that binds to CS1.

[43] The composition described in

[34] , wherein the CAR comprises a first ASBD that binds to CD22 and a second ASBD that binds to CD123.

[44] . The composition described in

[43] , wherein the CAR comprises a first D domain that binds to CD22 and a second D domain that binds to CD123.

[45] . The composition described in

[34] , wherein the CAR comprises a D domain that binds to CD22 and an scFv that binds to CD123.

[46] The composition described in

[35] , wherein the CAR comprises a first ASBD that binds to PDL1 and a second ASBD that binds to CD123.

[47] . The composition described in

[46] , wherein the CAR comprises a first D domain that binds to PDL1 and a second D domain that binds to CD123.

[48] The composition described in

[35] , wherein the CAR comprises a D domain that binds to PDL1 and an scFv that binds to CD123.

[49] The composition described in

[32] , wherein the CAR comprises an ASBD that binds to CD19 and an scFv that binds to CD123.

[50] . The composition of any of [1] to

[49] , wherein the adapter comprises an AD of a tumor antigen, and optionally the tumor antigen is selected from the group: BCMA, CD123, CD19, CD22, CS1, HER2, TACI, BAFFR, and PDL1.

[51] . The composition described in any of [1] to

[50] , wherein the adapter comprises an AD that is an epitope of AFP p26 or AFP, and optionally comprises amino acid residues of SEQ ID NO: 16 or 1117 to 1123.

[52] The composition described in any of [1] to

[51] , comprising an ADBD in which the adaptor is an scFv.

[53] The composition described in any of [1] to

[51] , wherein the adaptor comprises an ADBD that is an ASBD.

[54] . The composition of

[53] , wherein the adaptor comprises a D domain, and optionally, the adaptor comprises a sequence selected from the group: SEQ ID NOs: 17-26, and 27, or SEQ ID NOs: 44-1078, and 1079.

[55] . The composition described in any one of [1] to

[54] , wherein the adaptor comprises two ADBDs.

[56] The composition described in

[55] , wherein the two ADBDs are (a) the same, (b) bind to the same antigenic determinant, (c) bind to different ADs of the same antigen, or (d) bind to different antigens on the same cell, or (e) bind to different antigens on different cells.

[57] The composition of

[55] or

[56] , wherein the adaptor comprises two ASBDs.

[58] . The composition of any one of

[55] to

[57] , wherein the adapter comprises two D domains, and optionally the adapter comprises an amino acid sequence selected from the group: SEQ ID NOs: 44 to 1079.

[59] The composition of any one of

[55] or

[56] , wherein the adaptor comprises an ADBD that is an scFv and an ADBD that is an ASBD.

[60] The composition described in

[59] , wherein the adaptor comprises an ADBD that is an scFv and an ADBD that is a D domain.

[61] The composition described in any of [1] to

[60] , wherein the adaptor comprises an ADBD that binds to a member selected from BCMA, CD123, CD19, CD22, CS1, HER2, TACI, BAFFR, and PDL1.

[62] . The composition of

[61] , wherein the adaptor comprises an ADBD that binds to BCMA, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 44-338, and 339.

[63] . The composition of

[61] , wherein the adaptor comprises an ADBD that binds to CS1, and optionally, the ADBD comprises a sequence selected from the group: SEQ ID NOs: 780-794, and 795.

[64] The composition of

[61] , wherein the adaptor comprises an ADBD that binds to CD123, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 340-772, and 773.

[65] The composition of

[61] , wherein the adaptor comprises an ADBD that binds to CD19, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 1030 to 1058, and 1059.

[66] The composition of

[61] , wherein the adaptor comprises an ADBD that binds to CD22, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 1060-1068, and 1069.

[67] . The composition of

[61] , wherein the adaptor comprises an ADBD that binds to HER2, and optionally, the ADBD comprises a sequence selected from the group: SEQ ID NOs: 800-839, and 840.

[68] The composition described in

[61] , wherein the adaptor comprises an ADBD that binds to TACI or BAFFR.

[69] . The composition of

[61] , wherein the adaptor comprises an ADBD that binds to PDL1, and optionally the ADBD comprises a sequence selected from the group: SEQ ID NOs: 1010-1016, 1074-1078, and 1079.

[70] The composition described in any one of [1] to

[69] , wherein the adaptor is bispecific.

[71] The composition described in

[70] , wherein the adaptor comprises an ADBD that binds to CD19 and an ADBD that binds to CD123.

[72] The composition described in

[70] , wherein the adaptor comprises an ADBD that binds to BCMA and an ADBD that binds to CS1.

[73] The composition described in

[70] , wherein the adaptors comprise an ADBD that binds to CD22 and an ADBD that binds to CD123.

[74] The composition described in

[70] , wherein the adaptor comprises an ADBD that binds to PDL1 and an ADBD that binds to CD123.

[75] The composition described in any of [1] to

[74] , wherein the target cell is a tumor cell.

[76] . The composition of

[75] , wherein the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, myelodysplasia, breast cancer, and ovarian cancer.

[77] . The composition described in

[75] , wherein the tumor cells are multiple myeloma.

[78] The composition described in

[75] , wherein at least one target cell is a tumor cell.

[79] The composition described in

[75] , wherein the first and second target cells are tumor cells.

[80] The composition described in

[79] , wherein the first and second target cells are of the same type.

[81] The composition described in

[79] , wherein the first and second target cells are of different types.

[82] . The composition of

[80] or

[81] , wherein the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, myelodysplasia, breast cancer, and ovarian cancer.

[83] The composition described in

[82] , wherein the tumor cells are multiple myeloma.

[84] The composition described in any of [1] to

[83] , wherein the CAR-expressing cell is an immune effector cell.

[85] The composition described in

[84] , wherein the immune effector cell is a T cell.

[86] The composition described in

[84] , wherein the immune effector cells are NK cells.

[87] The composition described in any of [1] to

[86] , wherein the CAR-expressing cells kill target cells.

[88] The composition described in any of [1] to

[87] , wherein binding of the adapter to the antigenic determinant blocks activity of the antigen, including AD.

[89] . A method for killing a target cell, comprising contacting the target cell with any one of the compositions [1] to

[88] .

[90] . A method for killing a target cell comprising contacting a composition comprising the target cell with an adaptor, (a) the composition comprising a target cell further comprises a cell expressing a CAR comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first AD on the target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[91] . A method for killing one or more target cells comprising contacting a composition comprising a first target cell with an adaptor, (a) the composition comprising a target cell further comprises a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first AD on said first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell.

[92] . A method for killing a target cell comprising contacting a composition comprising the target cell with an adaptor, (a) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD), the ASBD binding to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[93] . A method for killing a target cell comprising contacting a composition comprising the target cell with an adaptor, (a) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR) comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[94] . A method of killing a target cell comprising contacting a composition comprising the target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising the first target cell further comprises an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) a second AD on the target cell; and (c) The method, wherein the CAR comprises (i) an ADBD that binds to the first AD on a target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[95] . A method of killing one or more target cells comprising contacting a composition comprising the target cells with a cell expressing a chimeric antigen receptor (CAR), (a) a first AD is present on a first target cell; (b) the composition comprising the first target cell further comprises a second target cell and an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) a second AD on the second target cell; and (c) The method, wherein the CAR comprises (i) an ADBD that binds to said first AD on a first target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[96] . A method of killing a target cell comprising contacting a composition comprising the target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising a target cell further comprises an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[97] . A method of killing a target cell comprising contacting a composition comprising the target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising a target cell further comprises (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) an adaptor comprising a second AD; and (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[98] . A method for transmitting an immune response to a target cell, comprising contacting a composition comprising the target cell with an adaptor, (a) the composition comprising a target cell further comprises a cell expressing a CAR comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first AD on the target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[99] . A method of delivering an immune response to one or more target cells, comprising contacting a composition comprising a first target cell with an adaptor, (a) the composition comprising a target cell further comprises a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD) that binds to a first AD on said first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell.

[0100] 1. A method of delivering an immune response to a target cell comprising contacting a composition comprising the target cell with an adaptor, (a) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR) comprising: (i) an antigenic determinant binding domain (ADBD), the ASBD binding to a first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0101] 1. A method of delivering an immune response to a target cell comprising contacting a composition comprising the target cell with an adaptor, (a) the composition comprising the target cell further comprises a cell expressing a chimeric antigen receptor (CAR) comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD, (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0102] 1. A method of delivering an immune response to a target cell comprising contacting a composition comprising the target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising the first target cell further comprises an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) a second AD on the target cell; and (c) The method, wherein the CAR comprises (i) an ADBD that binds to the first AD on a target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0103] 1. A method of delivering an immune response to one or more target cells comprising contacting a composition comprising the target cells with a cell expressing a chimeric antigen receptor (CAR), (a) a first AD is present on a first target cell; (b) the composition comprising the first target cell further comprises a second target cell and an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) the first AD and (ii) a second AD on the second target cell; and (c) The method, wherein the CAR comprises (i) an ADBD that binds to said first AD on a first target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0104] 1. A method of delivering an immune response to a target cell comprising contacting a composition comprising the target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising a target cell further comprises an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; and (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0105] 1. A method of delivering an immune response to a target cell comprising contacting a composition comprising the target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising a target cell further comprises (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) an adaptor comprising a second AD; and (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0106] A method of killing a target cell in a patient comprising administering to the patient an adaptor, (a) the patient is treated with a cell expressing a chimeric antigen receptor (CAR) comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0107] 1. A method of redirecting target cell killing in a patient comprising administering to the patient an adaptor, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell.

[0108] A method of killing a target cell in a patient comprising administering to the patient an adaptor, (a) a patient is treated with cells expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0109] A method of killing a target cell in a patient comprising administering to the patient an adaptor, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0110] 1. A method of killing target cells in a patient comprising administering to the patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) and a second AD are present on a target cell; (b) the patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) said first AD and (ii) said second AD on said target cell; (c) The method, wherein the CAR comprises (i) an ADBD that binds to the first AD on a target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0111] 1. A method of inducing target cell death in a patient comprising administering to the patient a cell expressing a chimeric antigen receptor (CAR), (a) a patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) a first antigenic determinant (AD) and (ii) a second AD on a target cell; (b) the method, wherein the CAR comprises (i) an ADBD that binds to the first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0112] 1. A method of killing target cells in a patient comprising administering to the patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0113] 1. A method of killing target cells in a patient comprising administering to the patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to said first AD on said target cell, and (ii) a second AD; (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0114] 1. A method of delivering an immune response to a target cell in a patient comprising administering to the patient an adaptor, (a) the patient is treated with a cell expressing a chimeric antigen receptor (CAR) comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0115] A method of redirecting an immune response to a target cell in a patient comprising administering to the patient an adaptor, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell.

[0116] 1. A method of delivering an immune response to a target cell in a patient comprising administering to the patient an adaptor, (a) a patient is treated with cells expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0117] 1. A method of delivering an immune response to a target cell in a patient comprising administering to the patient an adaptor, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0118] 1. A method of delivering an immune response to a target cell in a patient comprising administering to the patient a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) and a second AD are present on a target cell; (b) the patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) said first AD and (ii) said second AD on said target cell; (c) The method, wherein the CAR comprises (i) an ADBD that binds to the first AD on a target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0119] 1. A method of inducing an immune response against a target cell in a patient comprising administering to the patient cells expressing a chimeric antigen receptor (CAR), (a) a patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) a first antigenic determinant (AD) and (ii) a second AD on a target cell; (b) the method, wherein the CAR comprises (i) an ADBD that binds to the first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0120] 1. A method of delivering an immune response to a target cell in a patient comprising administering to the patient a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0121] 1. A method of delivering an immune response to a target cell in a patient comprising administering to the patient a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to said first AD on said target cell, and (ii) a second AD; (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0122] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising contacting a composition comprising a target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising a target cell further comprises (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) an adaptor comprising a second AD; and (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0123] A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising administering to a patient an adapter, (a) the patient is treated with a cell expressing a chimeric antigen receptor (CAR) comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0124] 1. A method of redirecting treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection comprising administering to a patient an adapter, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell.

[0125] A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising administering to a patient an adapter, (a) a patient is treated with cells expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0126] A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising administering to a patient an adapter, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0127] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) and a second AD are present on a target cell; (b) the patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) said first AD and (ii) said second AD on said target cell; (c) The method, wherein the CAR comprises (i) an ADBD that binds to the first AD on a target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0128] 1. A method of inducing treatment of a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) a first antigenic determinant (AD) and (ii) a second AD on a target cell; (b) the method, wherein the CAR comprises (i) an ADBD that binds to the first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0129] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0130] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or an allograft rejection comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to said first AD on said target cell, and (ii) a second AD; (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0131] The method according to any one of

[0122] to

[0130] , wherein the proliferative disorder or cancer is selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, myelodysplasia, breast cancer, and ovarian cancer.

[0132] .A method according to any one of

[0122] to

[0130] , wherein the proliferative disorder or cancer is multiple myeloma.

[0133] 1. A method of treating a hematological cancer comprising contacting a composition comprising a target cell with a cell expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the composition comprising a target cell further comprises (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to the first AD on the target cell, and (ii) an adaptor comprising a second AD; and (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0134] A method of treating hematological cancer comprising administering to a patient an adaptor, (a) the patient is treated with a cell expressing a chimeric antigen receptor (CAR) comprising (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on said target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0135] 1. A method of redirecting treatment for hematological cancer comprising administering to a patient an adaptor, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD) on a first target cell, (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on a second target cell.

[0136] A method of treating hematological cancer comprising administering to a patient an adaptor, (a) a patient is treated with cells expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0137] A method of treating hematological cancer comprising administering to a patient an adaptor, (a) a patient is treated with a cell expressing a chimeric antigen receptor (CAR) that includes (i) an antigenic determinant binding domain (ADBD) that binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; (b) the adaptor comprises an ADBD that is an ASBD that binds to (i) the first AD and (ii) a second AD on the target cell.

[0138] 1. A method of treating hematological cancer comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) and a second AD are present on a target cell; (b) the patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) said first AD and (ii) said second AD on said target cell; (c) The method, wherein the CAR comprises (i) an ADBD that binds to the first AD on a target cell or an adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0139] A method of inducing treatment of hematological cancer comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a patient is treated with an adaptor comprising an antigenic determinant binding domain (ADBD) that binds to (i) a first antigenic determinant (AD) and (ii) a second AD on a target cell; (b) the method, wherein the CAR comprises (i) an ADBD that binds to the first AD on the adaptor, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0140] 1. A method of treating hematological cancer comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD) that binds to the first AD on the target cell and (ii) a second AD; (c) the CAR comprises (i) an ADBD that is an ASBD that binds to said second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0141] 1. A method of treating hematological cancer comprising administering to a patient cells expressing a chimeric antigen receptor (CAR), (a) a first antigenic determinant (AD) is present on a target cell; (b) the patient is treated with an adaptor comprising (i) an antigenic determinant binding domain (ADBD), which is an ASBD that binds to said first AD on said target cell, and (ii) a second AD; (c) the method, wherein the CAR comprises (i) an ADBD that binds to the second AD, (ii) a transmembrane domain, and (iii) an intracellular domain.

[0142] The method according to any one of

[0133] to

[0141] , wherein the blood cancer is selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, and myelodysplasia.

[0143] .A method according to any one of

[0133] to

[0141] , wherein the blood cancer is multiple myeloma.

[0144] .A method according to any of

[90] to

[0131] , wherein the CAR comprises a single-chain variable fragment (scFv) ADBD.

[0145] The method according to any of claims

[90] to

[0143] , wherein the CAR comprises an ADBD that is an alternative scaffold binding domain (ASBD).

[0146] The method described in

[0145] , wherein the CAR comprises a D domain, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 17 to 26, and 27 or SEQ ID NOs: 44 to 1078, and 1079.

[0147] A method according to any one of

[90] to

[0146] , wherein the CAR comprises two ADBDs.

[0148] The method described in

[0147] , wherein the CAR comprises an ASBD and an scFv.

[0149] The method described in

[0147] , wherein the CAR comprises a D domain and an scFv.

[0150] The method described in

[0147] , wherein the CAR contains two ASBDs.

[0151] The method described in

[0147] , wherein the CAR contains two D domains.

[0152] .A method according to any one of

[90] to

[0151] , wherein the intracellular domain of CAR is a signal transduction domain.

[0153] The method described in

[0152] , wherein the intracellular domain of CAR comprises a primary signaling domain.

[0154] The method described in

[0152] , wherein the intracellular domain of CAR comprises the CD3ζ primary signaling domain.

[0155] The method described in

[0153] or

[0154] , wherein the intracellular domain of CAR further comprises a costimulatory signaling domain.

[0156] The method described in

[0155] , wherein the intracellular domain of CAR comprises a costimulatory signaling domain selected from CD28, 41BB, CD27, and CD134.

[0157] The method described in

[0156] , wherein the intracellular domain of CAR comprises a 41BB costimulatory signaling domain.

[0158] A method according to any one of

[90] to

[0157] , wherein the CAR binds to an antigen selected from CD19, CD22, CD123, BCMA, CS1, HER2, TACI, BAFFR, and PDL1.

[0159] The method according to

[0158] , wherein the CAR binds to BCMA, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 44 to 338, and 339.

[0160] The method described in

[0158] , wherein CAR binds to CS1, and optionally, CAR comprises an array selected from the group: SEQ ID NOs: 780 to 794, and 795.

[0161] The method described in

[0158] , wherein the CAR binds to CD123, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 340 to 772, and 773.

[0162] The method described in

[0158] , wherein the CAR binds to CD19, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 1030 to 1058, and 1059.

[0163] The method described in

[0158] , wherein the CAR binds to CD22, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 1060 to 1068, and 1069.

[0164] The method described in

[0158] , wherein the CAR binds to HER2, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 800 to 839, and 840.

[0165] The method of claim 0158, wherein CAR binds to PDL1, and optionally, CAR comprises an array selected from the group: SEQ ID NOs: 1010-1016, 1074-1078, and 1079.

[0166] A method according to any one of

[90] to

[0157] , wherein the CAR binds to AFP p26, and optionally the CAR comprises an array selected from the group: SEQ ID NOs: 841 to 983, and 984.

[0167] A method according to any one of

[90] to

[0166] , wherein the CAR comprises two ADBDs that bind to separate targets.

[0168] The method described in

[0167] , wherein CAR binds to CD19 and CD123.

[0169] The method described in

[0167] , wherein CAR binds to CD22 and CD123.

[0170] The method described in

[0167] , wherein CAR binds to PDL1 and CD123.

[0171] The method described in

[0167] , wherein CAR binds to CS1 and BCMA.

[0172] The method described in

[0168] , wherein the CAR comprises a first ASBD that binds to CD19 and a second ASBD that binds to C123.

[0173] The method described in

[0172] , wherein the CAR comprises a first D domain that binds to CD19 and a second D domain that binds to CD123.

[0174] The method described in

[0168] , wherein the CAR comprises a D domain that binds to CD19 and an scFv that binds to CD123.

[0175] The method described in

[0169] , wherein the CAR comprises a first ASBD that binds to CD22 and a second ASBD that binds to CD123.

[0176] The method described in

[0175] , wherein the CAR comprises a first D domain that binds to CD22 and a second D domain that binds to CD123.

[0177] The method described in

[0169] , wherein the CAR comprises a D domain that binds to CD22 and an scFv that binds to CD123.

[0178] The method described in

[0170] , wherein the CAR comprises a first ASBD that binds to PDL1 and a second ASBD that binds to CD123.

[0179] The method described in

[0178] , wherein the CAR comprises a first D domain that binds to PDL1 and a second D domain that binds to CD123.

[0180] The method described in

[0170] , wherein the CAR comprises a D domain that binds to PDL1 and an scFv that binds to CD123.

[0181] The method described in

[0168] , wherein the CAR comprises an ASBD that binds to CD19 and an scFv that binds to CD123.

[0182] The method described in

[0171] , wherein CAR comprises a first ASBD that binds to BCMA and a second ASBD that binds to CS1.

[0183] The method described in

[0182] , wherein CAR comprises a first D domain that binds to BCMA and a second D domain that binds to CS1.

[0184] The method described in

[0171] , wherein the CAR comprises a D domain that binds to BCMA and an scFv that binds to CS1.

[0185] The method described in

[0171] , wherein the CAR comprises a D domain that binds to CS1 and an scFv that binds to BCMA.

[0186] .A method according to any one of

[90] to

[0185] , wherein the adapter comprises an AD of a tumor antigen, and optionally the tumor antigen is selected from the group: BCMA, CD123, CD19, CD22, CS1, HER2, TACI, BAFFR, and PDL1.

[0187] The method described in

[90] to

[0186] , wherein the adapter comprises an AD which is an epitope of AFP p26 or AFP, and optionally comprises amino acid residues of SEQ ID NO: 16 or 1117 to 1123.

[0188] .A method according to any one of

[90] to

[0187] , comprising an ADBD in which the adaptor is an scFv.

[0189] .A method according to any one of

[90] to

[0187] , wherein the adaptor comprises an ADBD which is an ASBD.

[0190] The method described in

[0189] , wherein the adapter comprises a D domain, and optionally the adapter comprises an array selected from the group: SEQ ID NOs: 17 to 26, and 27, or SEQ ID NOs: 44 to 1078, and 1079.

[0191] .A method according to any one of

[90] to

[0190] , wherein the adapter comprises two ADBDs.

[0192] The method described in

[0191] , wherein the two ADBDs are (a) the same, (b) bind to the same antigenic determinant, (c) bind to different ADs of the same antigen, or (d) bind to different antigens on the same cell, or (e) bind to different antigens on different cells.

[0193] .The method described in

[0191] or

[0192] , wherein the adapter comprises two ASBDs.

[0194] .A method according to any one of

[0191] ,

[0192] , or

[0193] , wherein the adapter comprises two D domains, and optionally, the adapter comprises an amino acid sequence selected from the group: SEQ ID NOs: 44 to 1079.

[0195] The method described in

[0191] or

[0192] , wherein the adapter comprises an ADBD that is an scFv and an ADBD that is an ASBD.

[0196] The method described in

[0195] , wherein the adapter comprises an ADBD that is an scFv and an ADBD that is a D domain.

[0197] The method of any one of

[90] to

[0196] , wherein the adaptor comprises an ADBD that binds to a member selected from BCMA, CS1, HER2, CD123, CD19, CD22, TACI, BAFFR, and PDL1.

[0198] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to BCMA, and optionally the ADBD comprises an array selected from the group: SEQ ID NOs: 44 to 338, and 339.

[0199] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to CS1, and optionally, the ADBD comprises an array selected from the group: SEQ ID NOs: 780 to 794, and 795.

[0200] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to CD123, and optionally, the ADBD comprises an array selected from the group: SEQ ID NOs: 340 to 772, and 773.

[0201] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to CD19, and optionally, the ADBD comprises an array selected from the group: SEQ ID NOs: 1030 to 1058, and 1059.

[0202] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to CD22, and optionally, the ADBD comprises an array selected from the group: SEQ ID NOs: 1060 to 1068, and 1069.

[0203] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to HER2, and optionally, the ADBD comprises an array selected from the group: SEQ ID NOs: 800 to 839, and 840.

[0204] The method described in

[0197] , wherein the adapter comprises an ADBD that binds to TACI or BAFFR.

[0205] The method described in

[0197] , wherein the adaptor comprises an ADBD that binds to PDL1, and optionally the ADBD comprises an array selected from the group: SEQ ID NOs: 1010-1016, 1074-1078, and 1079.

[0206] .A method according to any one of

[90] to

[0205] , wherein the adapter is bispecific.

[0207] The method described in

[0206] , wherein the adaptor comprises an ADBD that binds to BCMA and an ADBD that binds to CS1.

[0208] The method described in

[0206] , wherein the adaptor comprises an ADBD that binds to CD19 and an ADBD that binds to CD123.

[0209] The method described in

[0206] , wherein the adaptor comprises an ADBD that binds to CD22 and an ADBD that binds to CD123.

[0210] The method described in

[0206] , wherein the adaptor comprises an ADBD that binds to PDL1 and an ADBD that binds to CD123.

[0211] .A method according to any one of

[90] to

[0210] , wherein the target cell is a tumor cell.

[0212] The method according to

[0211] , wherein the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, myelodysplasia, breast cancer, and ovarian cancer.

[0213] The method according to

[0211] , wherein the tumor cells are multiple myeloma.

[0214] The method according to

[0211] , wherein at least one target cell is a tumor cell.

[0215] The method according to

[0211] , wherein the first and second target cells are tumor cells.

[0216] The method according to

[0215] , wherein the first and second tumor cells are of the same type.

[0217] The method according to claim 0215, wherein the first and second tumor cells are of different types.

[0218] The method according to

[0214] or

[0215] , wherein the tumor cells are selected from acute leukemia, chronic leukemia, polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia, myelodysplasia, breast cancer, and ovarian cancer.

[0219] The method according to

[0214] or

[0215] , wherein the tumor cells are multiple myeloma.

[0220] .A method according to any one of

[90] to

[0219] , wherein the CAR-expressing cell is an immune effector cell.

[0221] .The method described in

[0220] , wherein the immune effector cells are T cells.

[0222] The method according to

[0220] , wherein the immune effector cells are NK cells.

[0223] .A method according to any one of

[90] to

[0222] , in which a CAR-expressing cell kills a target cell.

[0224] A genetically modified human immune effector cell, comprising: (a) a chimeric antigen receptor (CAR) comprising (1) an antigenic determinant binding domain (ADBD) that specifically binds to a human CD45 antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (b) A genetically modified human immune effector cell comprising a genetic modification that abolishes expression of human CD45 AD on the genetically modified cell, wherein the genetically modified cell is capable of inducing an immune response against CD45 AD-expressing cells in an in vitro assay, and wherein the genetically modified cell does not express CD45 AD.

[0225] A method for killing a target cell, comprising contacting a genetically modified cell described in

[0224] with the target cell, wherein the target cell expresses human CD45.

[0226] A method for transmitting an immune response to a target cell, comprising contacting the genetically modified cell described in

[0224] with the target cell, wherein the target cell expresses human CD45.

[0227] A method for inducing an immune response against target cells in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cells described in

[0224] .

[0228] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cell described in

[0224] .

[0229] A method for depleting lymphocytes, comprising administering to a subject in need thereof an effective amount of the genetically modified cells described in

[0224] .

[0230] A method for depleting memory T cells, comprising administering an effective amount of the genetically modified cells described in

[0224] to a subject in need thereof.

[0231] A method for treating an autoimmune disease or disorder comprising administering a therapeutically effective amount of the genetically modified cell described in

[0224] to a subject in need thereof.

[0232] A method for pretreating a subject for transplantation, comprising administering to a subject in need thereof an effective amount of the genetically modified cells described in

[0224] .

[0233] A method for treating blood cancer comprising administering a therapeutically effective amount of the genetically modified cell described in

[0224] to a subject in need thereof.

[0234] A genetically modified human immune effector cell, comprising: (a) a chimeric antigen receptor (CAR) comprising: (1) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain; and (b) comprising a genetic modification that abolishes expression of at least one human CD45 AD on the genetically modified cell; A genetically modified human immune effector cell, wherein the first AD is not at least one human CD45 AD, and the genetically modified cell used in combination with the adapter in an in vitro assay is capable of inducing an immune response against CD45 AD expressing cells, and the adapter comprises a second ADBD that specifically binds to the first AD and the at least one human CD45 AD, and the genetically modified cell does not express the at least one human CD45 AD.

[0235] A method for killing a target cell comprising contacting a genetically modified cell as described in

[0234] with an adaptor and a target cell, wherein the target cell expresses CD45 and the adaptor comprises a first AD and a second ADBD that specifically binds to human CD45 AD.

[0236] .A method for transmitting an immune response to a target cell, comprising contacting a genetically modified cell as described in

[0234] with an adaptor and a target cell, wherein the target cell expresses CD45 and the adaptor comprises a first AD and a second ADBD that specifically binds to human CD45 AD.

[0237] A method for treating hematological cancer comprising contacting a genetically modified cell as described in

[0234] with an adaptor and cancer cells, wherein the cancer cells express CD45 and the adaptor comprises a first AD and a second ADBD that specifically binds to human CD45 AD.

[0238] A method of inducing an immune response against a target cell in a subject, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0239] A method for inducing an immune response against target cells in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell described in

[0234] , wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD.

[0240] A method for inducing an immune response against target cells in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0241] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0242] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cell described in

[0234] , wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD.

[0243] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0244] A method for lymphocyte depletion comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0245] A method for depleting lymphocytes comprising administering a therapeutically effective amount of the genetically modified cell described in

[0234] to a subject in need thereof, wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD.

[0246] A method for depleting lymphocytes comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0247] A method for depleting memory T cells, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0248] A method for depleting memory T cells comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0249] A method for depleting memory T cells comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0250] A method for treating an autoimmune disease or disorder, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0251] A method for treating an autoimmune disease or disorder comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0252] A method for treating an autoimmune disease or disorder comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0253] 1. A method of pretreating a subject for transplantation, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0254] A method of pretreating a subject for transplantation comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cells described in

[0234] , wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD.

[0255] A method for pretreating a subject for transplantation comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0256] 1. A method for treating hematological cancer, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to a human CD45 AD.

[0257] .A method for treating hematological cancer comprising administering a therapeutically effective amount of the genetically modified cell described in

[0234] to a subject in need thereof, wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to human CD45 AD.

[0258] A method for treating hematological cancer comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to human CD45 AD, wherein the subject has been administered a genetically modified cell described in

[0234] .

[0259] A genetically modified human immune effector cell, comprising: (a) a chimeric antigen receptor (CAR) comprising: (i) two or more antigen determinant binding domains (ADBDs) each comprising a first antigen determinant (ADBD) that binds to a first antigen determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) comprising a genetic modification that abolishes expression of the first AD on the genetically modified cell; A genetically modified human immune effector cell, wherein the genetically modified cell does not express a first AD.

[0260] A method for killing a target cell, comprising contacting the target cell with a genetically modified cell described in

[0259] .

[0261] .A method for transmitting an immune response to a target cell, comprising contacting the target cell with a genetically modified cell described in

[0259] .

[0262] A method for inducing an immune response against target cells in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cells described in

[0259] .

[0263] .A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cell described in

[0259] .

[0264] A method for depleting lymphocytes, comprising administering to a subject in need thereof an effective amount of the genetically modified cells described in

[0259] .

[0265] A method for pretreating a subject for transplantation, comprising administering to a subject in need thereof an effective amount of the genetically modified cells described in

[0259] .

[0266] A method for treating blood cancer comprising administering a therapeutically effective amount of the genetically modified cell described in

[0259] to a subject in need thereof.

[0267] A method for killing a target cell, comprising contacting a genetically modified cell described in

[0259] with an adaptor and a target cell, wherein the adaptor comprises a CAR and an AD recognized by a second ADBD.

[0268] .A method for transmitting an immune response to a target cell, comprising contacting a genetically modified cell as described in

[0259] with an adaptor and a target cell, wherein the adaptor comprises a CAR and an AD recognized by a second ADBD capable of binding to a second AD on the target cell.

[0269] A method for treating hematological cancer comprising contacting a genetically modified cell as described in

[0259] with an adaptor and a cancer cell, wherein the adaptor comprises an AD recognized by a CAR and a second ADBD capable of binding to a second AD on the target cell.

[0270] A method of inducing an immune response against a target cell in a subject, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0271] A method for inducing an immune response against a target cell in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell described in

[0259] , wherein the subject has been administered an adapter comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on the target cell.

[0272] A method for inducing an immune response against a target cell in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on the target cell, wherein the subject has been administered a genetically modified cell described in

[0259] .

[0273] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0274] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cell described in

[0259] , wherein the subject has been administered an adapter comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0275] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell, wherein the subject has been administered a genetically modified cell described in

[0259] .

[0276] A method for lymphocyte depletion comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0277] A method for depleting lymphocytes comprising administering a therapeutically effective amount of the genetically modified cell described in

[0259] to a subject in need thereof, wherein the subject has been administered an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0278] A method for depleting lymphocytes comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell, wherein the subject has been administered a genetically modified cell described in

[0259] .

[0279] 1. A method of pretreating a subject for transplantation, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0280] A method for pretreating a subject for transplantation comprising administering to a subject in need thereof a therapeutically effective amount of the genetically modified cells described in

[0259] , wherein the subject has been administered an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on the target cell.

[0281] A method for pretreating a subject for transplantation comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell, wherein the subject has been administered a genetically modified cell described in

[0259] .

[0282] 1. A method for treating hematological cancer, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to the invention; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0283] A method for treating hematological cancer comprising administering a therapeutically effective amount of the genetically modified cell described in

[0259] to a subject in need thereof, wherein the subject has been administered an adapter comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell.

[0284] A method for treating hematological cancer comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a CAR and an AD recognized by a second ADBD capable of binding to a second AD on a target cell, wherein the subject has been administered a genetically modified cell described in

[0259] .

[0285] A genetically modified human immune effector cell, comprising: (a) a chimeric antigen receptor (CAR) comprising: (i) a first antigenic determinant binding domain (ADBD) that specifically binds to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) comprising a genetic modification that abolishes expression of a second AD on the genetically modified cell; A genetically modified human immune effector cell, wherein the genetically modified cell used in combination with the adaptor is capable of inducing an immune response against a second AD-expressing cell in an in vitro assay, wherein the adaptor comprises a second ADBD that specifically binds to the first AD and the second AD, and the genetically modified cell does not express the second AD.

[0286] A genetically modified human immune effector cell, comprising: (a) a chimeric antigen receptor (CAR) comprising: (i) two or more first antigenic determinant binding domains (ADBDs) that specifically bind to a first antigenic determinant (AD), (ii) a transmembrane domain, and (iii) an intracellular domain; and (b) comprising a genetic modification that abolishes expression of a second AD on the genetically modified cell; A genetically modified human immune effector cell, wherein the genetically modified cell used in combination with the adaptor is capable of inducing an immune response against a second AD-expressing cell in an in vitro assay, wherein the adaptor comprises a second ADBD that specifically binds to the first AD and the second AD, and the genetically modified cell does not express the second AD.

[0287] A method for inducing an immune response against target cells in a subject, comprising administering a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] to a subject in need thereof.

[0288] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] .

[0289] A method for depleting lymphocytes, comprising administering an effective amount of a genetically modified cell described in

[0285] or

[0286] to a subject in need thereof.

[0290] A method for pretreating a subject for transplantation, comprising administering to a subject in need thereof an effective amount of a genetically modified cell described in

[0285] or

[0286] .

[0291] A method for treating blood cancer, comprising administering a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] to a subject in need thereof.

[0292] A method for killing a target cell, comprising contacting a genetically modified cell described in

[0285] or

[0286] with an adaptor and a target cell, wherein the adaptor comprises a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on the target cell.

[0293] A method for transmitting an immune response to a target cell, comprising contacting a genetically modified cell described in

[0285] or

[0286] with an adaptor and a target cell, wherein the adaptor comprises a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on the target cell.

[0294] A method for treating hematological cancer comprising contacting a genetically modified cell described in

[0285] or

[0286] with an adaptor and a cancer cell, wherein the adaptor comprises a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on the cancer cell.

[0295] A method of inducing an immune response against a target cell in a subject, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to

[0285] or

[0286] ; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the second AD is expressed on a target cell.

[0296] A method for inducing an immune response against target cells in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] , wherein the subject has been administered an adapter comprising a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on the target cells.

[0297] A method for inducing an immune response against target cells in a subject, comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the subject has been administered a genetically modified cell described in

[0285] or

[0286] , and the second AD is expressed on the target cells.

[0298] 1. A method of treating a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection in a subject, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to

[0285] or

[0286] ; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the second AD is expressed on a target cell associated with a proliferative disorder, cancer, an autoimmune disease, an infectious disease, or allograft rejection.

[0299] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject in need thereof, comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] , wherein the subject has been administered an adapter comprising a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on target cells associated with the proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection.

[0300] A method for treating a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection in a subject comprising administering to a subject in need thereof a therapeutically effective amount of an adapter comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the subject has been administered a genetically modified cell described in

[0285] or

[0286] , and the second AD is expressed on target cells associated with the proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection.

[0301] A method for lymphocyte depletion comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to

[0285] or

[0286] ; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the second AD is expressed on a lymphocyte target cell.

[0302] A method for depleting lymphocytes, comprising administering a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] to a subject in need thereof, wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on a lymphocyte target cell.

[0303] A method for depleting lymphocytes, comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the subject has been administered a genetically modified cell described in

[0285] or

[0286] , and the second AD is expressed on lymphocyte target cells.

[0304] 1. A method of pretreating a subject for transplantation, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to

[0285] or

[0286] ; and (b) administering to the subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the second AD is expressed on target cells associated with the transplant.

[0305] A method for pretreating a subject for transplantation comprising administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] , wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on target cells associated with the transplant.

[0306] A method for pretreating a subject for transplantation comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the subject has been administered a genetically modified cell described in

[0285] or

[0286] , and the second AD is expressed on target cells associated with the transplant.

[0307] 1. A method for treating hematological cancer, comprising: (a) administering to a subject in need thereof a therapeutically effective amount of a genetically modified cell according to

[0285] or

[0286] ; and (b) administering to a subject a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the second AD is expressed on a target cell associated with a hematological cancer.

[0308] A method for treating hematological cancer comprising administering a therapeutically effective amount of a genetically modified cell described in

[0285] or

[0286] to a subject in need thereof, wherein the subject has been administered an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, and the second AD is expressed on a target cell associated with the hematological cancer.

[0309] A method for treating hematological cancer comprising administering to a subject in need thereof a therapeutically effective amount of an adaptor comprising a first AD and a second ADBD that specifically binds to the second AD, wherein the subject has been administered a genetically modified cell described in

[0285] or

[0286] , and the second AD is expressed on target cells associated with the hematological cancer.

[0310] 1. An isolated adaptor polypeptide comprising: (1) an antigenic determinant (AD) and (b) one or more antigenic determinant binding domains (ADBDs), An isolated adaptor polypeptide, wherein at least one ADBD specifically binds to human CD45 AD, and wherein contacting the adaptor with a CD45 AD-expressing target cell in the presence of a genetically modified cell as described in

[0234] is capable of inducing an immune response by the genetically modified cell against the target cell in an in vitro assay. [Brief description of the drawings]

[0087] [Figure 1] We compared the cytolytic activity of CD123-specific (cg06) and BCMA-specific (bc-40) CARs to a CAR with no known target specificity (α3D) for a range of tumors using effector cell:target cell ratios ranging from 1:4 to 1:64. Briefly, 20,000 CAR T cells expressing bc40, cg06, or α3D were incubated with increasing numbers of CD123+ / BCMA- tumor targets (MOLM13) (Figure 1A); CD123- / BCMA+ tumor targets (H929) (Figure 1B); CD123- tumor targets (RAJI) (Figure 1C); or CD123+ / BCMA- tumor targets (MOLM13) (Figure 1D). After 16 h, cells were washed and luciferase activity was assessed. [Diagram 2] Adapter binding correlates the binding specificity of the adapter and the CAR. Jurkat NFAT luciferase reporter cells were transduced with a negative control CAR (α3D), an AFP(p26)-binding CAR (af03), or a BCMA-binding CAR (bc40). In Figure 2A, CAR-transduced Jurkat cells were incubated with 0.5 μg of adapter protein (20 min at 4° C.), washed, and stained with anti-His PE (clone J095G46, 20 min at 4° C.). Figure 2B shows CAR expression by FLAG staining (clone L5) compared to mock-transduced Jurkat cells. [Figure 3-1] We show that adaptor binding of matched specificities CAR:adapter and target:adapter promotes lysis of target cells. In Figure 3A, 40,000 CD123+BCMA-MOLM13-GFP / luciferase cells were incubated with various adaptors for 16 hours in the presence or absence of 20,000 T cells (E:T ratio = 1:2, donor D14-053017, day 7) transduced with BCMA-binding CAR (bc40). After 16 hours, cells were washed and luciferase activity was assessed. The lysis % was assessed relative to MOLM13-GFP / luciferase wells cultured in the absence of T cells or adaptor protein. Control CD123-specific CAR T cells (cg06) cultured at the same ratio were used as a positive control for lysis. [Figure 3-2]We show that adaptor binding of matched specificities CAR:adapter and target:adapter promotes lysis of target cells. In Figure 3B, 40,000 CD123+BCMA-MOLM13-GFP / luciferase cells were incubated with CD123(cg06)-AFP(p26) adaptor for 16 hours in the presence or absence of 20,000 T cells (E:T ratio = 1:2, donor D16-061317, day 7) transduced with AFP-conjugated CAR (Af03 or Af05). After 16 hours, cells were washed and luciferase activity was assessed. Percent lysis was assessed relative to MOLM13-GFP / luciferase wells cultured in the absence of T cells or adaptor protein. Control CD123-specific CAR T cells (cg06) cultured at the same ratio were used as a positive control for lysis. In Figure 3C, 40,000 BCMA+NCI H929-GFP / luciferase cells were incubated with the bc40-AFP(p26) adaptor for 16 hours in the presence or absence of 10,000 T cells (E:T ratio = 1:4, donor D15-062017, day 8) mock-transduced or transduced with AFP-linked CAR (Af03 or Af05). After 16 hours, cells were washed and luciferase activity was assessed. % lysis was assessed relative to NCI-H929-GFP / luciferase wells cultured in the absence of T cells or adaptor protein. [Figure 4-1] We show that adaptor ligation of matched specificity CAR:adaptor and target:adaptor promotes cytokine production by CAR T cells. In Figures 4A and 4B, donor D14-053017 T cells transduced with BCMA-binding CAR (bc40) were cultured overnight with various adaptors in the presence or absence of CD123+BCMA-MOLM13 cells (25,000 T cells and target cells). Culture supernatants were collected and assessed for production of IL-2 (Figure 4A) and IFN-γ (Figure 4B). [Figure 4-2]We show that adaptor ligation of matched specificities, CAR:adapter and target:adapter, promotes cytokine production by CAR T cells. In Figures 4C and 4D, donor D15-062017 T cells transduced with AFP-conjugated CARs (Af03 and Af05) were cultured overnight with the cg06-AFP(p26) adaptor in the presence or absence of CD123+BCMA-MOLM13 cells (25,000 T cells and target cells). Culture supernatants were collected and assessed for production of IL-2 (Figure 4C) and IFN-γ (Figure 4D). [Diagram 5] Specificity-matched CAR:adapter and target:adapter adaptor ligation promotes CAR T cell proliferation. Donor D16-062717 cells transduced with AFP-conjugated CAR (Af03) were CFSE-labeled (0.5 μM for 10 min) and then cultured for 72 h in the presence or absence of mitomycin C-treated CD123-BCMA+NCI-H929 cells (25,000 cells) and in the presence of CD123-specific or BCMA-specific adaptors (25,000 cells). At 72 h, cells were stained for CD3 and then the absolute number of CD3+ cells was analyzed by flow cytometry. [Figure 6] We show that adaptor ligation of matched CAR:adapter and target:adapter promotes signaling by CAR-expressing Jurkat NFAT-luciferase reporter cells. In Figure 6A, luciferase activity was assessed after 50,000 reporter cells previously transduced with BCMA-binding CAR (bc40) were cultured for 5 hours in the presence or absence of 50,000 CD123+BCMA-MOLM14 cells in the presence of various adaptor proteins. In Figure 6B, luciferase activity was assessed after 50,000 reporter cells previously transduced with AFP(p26)-binding CAR (af03) were cultured for 5 hours in the presence or absence of 50,000 BCMA+NCI-H929 cells in the presence of nonspecific α3D-adapter or BCMA-specific Bc40-adapter protein. [Figure 7]We show that CD123-specific adaptors with BCMA antigenic determinants can function together with BCMA-specific D-domain CAR (bc40) or BCMA-specific scFv CAR (c11D5-3). In Figure 7A, 40,000 CD123+BCMA-MOLM13-GFP / luciferase cells were incubated for 16 hours with Cg06-BCMA adaptors in the presence or absence of 20,000 T cells (E:T ratio = 1:2, donor D14-062717, day 9) transduced with a non-specific CAR (α3D), a BCMA-binding D-domain CAR (bc40), or a BCMA-binding scFv CAR (c11D5-3). After 16 hours, cells were washed and luciferase activity was assessed. The % lysis was assessed relative to MOLM13-GFP / luciferase wells cultured in the absence of T cells or adaptor protein. The solid line shows the calculated three-parameter nonlinear curve, the dotted line is for c11D5-3 and is presented for illustrative purposes only. In Figure 7B, CD123+BCMA-MOLM13-GFP / luciferase cells were cultured with transduced T cells in the absence of adaptor protein in the same experiment as in Figure 7A. [Figure 8] We show that AFP-specific CARs can simultaneously have CD123 and BCMA binding capabilities through incubation with multiple adaptor proteins. 105 Jurkat NFAT luciferase transduced with AFP(p26)-binding CAR (af03) were incubated with 0.5 μg total adaptor proteins at various ratios of BCMA-specific adaptors to CD123-specific adaptors (4° C. for 20 min), washed, incubated with CD123-Fc and biotinylated BCMA (0.5 μg each) (4° C. for 20 min), washed, and binding was detected with anti-Fc A488 and streptavidin-PE. Figure 8A shows flow cytometry analysis of CD123 binding and BCMA binding to their respective target proteins, and Figure 8B shows a comparison of the mean fluorescence intensity (MFI) of the A488 MFI (CD123 binding, left axis) and PE MFI (BCMA binding, right axis) flow cytometry data presented in Figure 8A. [Figure 9] Compared to single-binding domain adaptor proteins, dual-binding domain adaptor proteins promote enhanced signaling by CAR-expressing Jurkat NFAT luciferase reporter cells. In Figure 9A, luciferase activity was assessed after 50,000 reporter cells pre-transduced with AFP (p26 domain)-conjugated CAR (af03) were cultured for 5 hours in the presence of 50,000 CD123+ or CD123-deficient MOLM13 cells in the presence of CD123-specific Cg06-adaptor (Cg06-p26) or Cg06-dual adaptor protein (Cg06-p26-Cg06). CD123-deficient cells were generated using CRISPR / Cas9 genetic engineering techniques. In Figure 9B, 50,000 reporter cells pre-transduced with an AFP (p26 domain)-conjugated CAR (af03) were cultured for 5 h in the presence or absence of 50,000 BCMA+ U266 cells in the presence of the BCMA-specific Bc40-adapter (Bc40-p26) or Bc40-dual adaptor protein (Bc40-p26-Bc40), after which luciferase activity was assessed. [Figure 10] Figure 2 shows that binding of truncated and full-length p26 to human FcRn is pH dependent. [Figure 11-1] We show that adaptors containing CS1 (SLAMF7, CRACC, CD319) specific ADBDs regulate intracellular signaling and killing of CS1 positive tumors. In FIG. 11A, cc02 and cc08 ADBDs show the strongest NFAT signaling when cultured in the presence of af59-CAR expressing JNL10 cells and in the presence of the CS1 positive tumor cell line, MM.1S (FIG. 11A). FIG. 11B shows that the bispecific bc98-p26-cc02 adaptor, which can bind both CS1 and BCMA, was stronger in its ability to signal than the monospecific BCMA binding bc98-p26-α3DQ19E adaptor and the monospecific CS1 binding α3DQ19E-p26-cc02 adaptor. [Figure 11-2]Adapters containing CS1 (SLAMF7, CRACC, CD319) specific ADBDs regulate intracellular signaling and killing of CS1 positive tumors. Figures 11C and 11D show that the bispecific bc98-p26-cc02 is an effective adaptor in terms of killing of HT929 (high expression of both BCMA and CS1, Figure 11C) and MM.1S (high expression of BCMA, low expression of CS1; Figure 11D). [Figure 12A] Adapters containing HER2-binding ADBD induce signaling in Af59-CAR-expressing JNL10-cells cultured with HER2-positive SKBR3 tumors. Figure 12A shows that eb08 HER2-binding ADBD was the most potent stimulator in this assay. [Figure 12B] Adapters containing HER2-binding ADBD induce signaling in Af59-CAR-expressing JNL10-cells cultured with HER2-positive SKBR3 tumors. Figure 12B shows that NFAT signaling in JNL10 cells mediated by adapters containing eb08 is greater than that mediated by adapters containing zHER:4, comparable to that mediated by adapters containing 9.29, and less than that of G3 and zHER2:342. [Figure 12C] Adapters containing HER2-binding ADBD induce signaling in Af59-CAR-expressing JNL10-cells cultured with HER2-positive SKBR3 tumors. Figure 12C shows that adapters containing HER2-binding eb08 or eb04 regulate tumor lysis in a dose-dependent manner. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0088] I. Definition Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly interpreted by one of ordinary skill in the art to which this disclosure belongs.

[0089] Whenever an embodiment is described herein with the term "comprising," other similar embodiments are likewise provided that are described with the terms "consisting of" and / or "consisting essentially of." However, when used as transitional phrases in the claims, each should be construed separately and in the appropriate legal and factual context (e.g., "comprising" is considered the more open-ended phrase, "consisting of" is considered the more exclusive, and "consisting essentially of" is considered intermediate between the two).

[0090] As used herein, the singular forms "a," "an," and "the" include plural references unless specifically stated otherwise.

[0091] The term "and / or" as used in phrases such as "A and / or B" is intended herein to include both A and B; A or B; A (single); and B (single). Similarly, the term "and / or" as used in phrases such as "A, B and / or C" encompasses each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (single); B (single); and C (single).

[0092] The term "about" as used herein, when referring to a measurable value, such as an amount, a time period, and other measurable values known in the art, is intended to encompass a ±20% variation from the specified value, or in some embodiments, a ±10% variation, or in some embodiments, a ±5% variation, or in some embodiments, a ±1% variation, or in some embodiments, a ±0.1% variation, as such variations are appropriate for practicing the disclosed methods.

[0093] The terms "protein" and "polypeptide" are used interchangeably herein to refer to a biological polymer comprising units derived from amino acids linked via peptide bonds; a protein may be composed of two or more polypeptide chains.

[0094] "Cell surface receptor" refers to molecules and complexes of molecules that can receive signals and transmit such signals across the cell membrane of a cell. An example of a cell surface receptor provided herein is an activated integrin receptor, such as an activated αvβ3 integrin receptor on a metastatic cell. As used herein, "cell surface receptor" also encompasses molecules expressed on the cell surface, including CARs that can bind to a target antigenic determinant. The term "receptor" refers to a cell-associated protein that binds to or interacts with a molecule (e.g., a ligand) and mediates the action of the ligand on the cell. In some embodiments, the molecule that interacts with the receptor is a bioactive molecule. Membrane-associated cell surface receptors are characterized by a multi-domain structure, which includes a ligand-binding domain, a transmembrane domain, and an intracellular effector domain that is usually involved in signal transduction.

[0095] As used herein, the term "chimeric antigen receptor" or "CAR" or "CARs" refers to a genetically engineered chimeric polypeptide that transfers antigen or target specificity to a cell, such as an immune cell (e.g., a T cell, such as a naive T cell, a central memory T cell, an effector memory T cell, a NK cell, a NKT, or a plurality or combination thereof). CARs may also be referred to herein as artificial T cell receptors, chimeric T cell receptors, or chimeric immune receptors. CARs share structural or functional properties with cellular immune function receptors or adapter molecules. Upon binding to a cognate antigen, CARs can activate or inactivate cytotoxic cells in which they are located, or can modulate the antitumor activity of a cell, or can otherwise modulate a cellular immune response. In some embodiments, CARs include one or more elements (e.g., domains) from a T cell receptor (TCR, e.g., zeta chain bound to the T cell receptor complex) or from a natural killer cell receptor (NKR). In some embodiments, a CAR comprises (1) an antigenic determinant binding domain (ADBD) that specifically binds to an antigenic determinant (AD), (2) a transmembrane domain, and (3) an intracellular domain. In some embodiments, a CAR comprises two or more antigenic determinant binding domains. In some embodiments, a CAR comprises two or more antigenic determinant binding domains that bind to different antigenic determinants of the same antigen, different antigenic determinants on different antigens, or antigenic determinants expressed by different target cells.

[0096] As used herein, the term "immune cell" refers to cells of a mammalian immune system, including, but not limited to, antigen-presenting cells, B cells, basophils, cytotoxic T cells, dendritic cells, eosinophils, granulocytes, helper T cells, leukocytes, lymphocytes, macrophages, mast cells, memory cells, monocytes, natural killer cells, neutrophils, phagocytes, plasma cells, and T cells.

[0097] The terms "T cells" and "T lymphocytes" are interchangeable and are used synonymously herein. Examples include, but are not limited to, naive T cells, central memory T cells, effector memory T cells, or combinations thereof.

[0098] "Autologous" as the term is used herein means any material derived from the same individual to which it is subsequently re-administered.

[0099] "Allogeneic" as the term is used herein means any material derived from a different animal of the same species as the individual to which it is introduced. Two or more individuals are said to be allogeneic to each other when their genes are not identical at one or more loci. In some embodiments, allogeneic materials derived from individuals of the same species may be genetically different enough to interact antigenically.

[0100] The term "effector cell" refers to a leukocyte that expresses one or more FcRs and performs effector functions. The cell preferably expresses at least FcRIII and performs ADCC effector functions. Examples of human leukocytes that mediate ADCC include peripheral blood mononuclear cells (PBMCs), natural killer (NK) cells, monocytes, cytotoxic T cells, and neutrophils, with PBMCs and NK cells being preferred in certain embodiments. Effector cells can be isolated from their natural sources, such as blood or PBMCs, as described herein or known in the art. In certain embodiments, the effector cells are human effector cells.

[0101] The term "effector function" refers to a specialized function of a differentiated cell. The effector function of a T cell can be, for example, cytolytic activity or helper activity, including secretion of cytokines.

[0102] As used herein, the term "immune response" refers to immunity, including but not limited to innate immunity, humoral immunity, cellular immunity, immunity, inflammatory response, acquired immunity, autoimmunity, and / or hyperactive immunity. Indicators of immune response may include secretion of cytokines by immune cells, proliferation of immune cell populations, production of antibodies, degranulation of cytotoxic cells, and target cell killing. Such indicators may be measured in a routine manner using readily available assays, such as ELISA or ELISPOT, known in the art.

[0103] As used herein, the term "adapter" refers to a multidomain soluble protein that includes an antigenic determinant (AD) and an antigenic determinant binding domain (ADBD) that binds to a second AD. In addition to this AD and ADBD, the adapter may include additional ADs, additional ADBDs, and / or other additional domains.

[0104] The terms "antibody" or "immunoglobulin" as used interchangeably herein include whole antibodies. Whole antibodies contain at least two heavy (H) chains and two light (L) chains linked together by disulfide bonds. Each heavy chain consists of a heavy chain variable region (abbreviated as VH) and a heavy chain constant region. The heavy chain constant region consists of three domains, CH1, CH2, and CH3. Each light chain consists of a light chain variable region (abbreviated as VL) and a light chain constant region. The light chain constant region consists of one domain, Cl. The VH and VL regions can be further subdivided into regions of hypervariability called complementarity determining regions (CDRs) interspersed with more conserved regions called framework regions (FWs). Each VH and VL consists of three CDRs and four FWs, arranged from amino terminus to carboxy terminus in the following order: FW1, CDR1, FW2, CDR2, FW3, CDR3, FW4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibody can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1q) of the classical complement system.

[0105] As used herein, the term "antibody fragment" and the like includes any functional domain of an antibody, such as an antigen-binding fragment or a single chain thereof, an effector domain, a salvage receptor binding epitope, or a portion thereof. The antibody fragments described herein may exist in various forms. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, disulfide-linked Fv (sdFv), Fd fragments consisting of VH and CH1 domains, scFv, minibodies, BiTEs, Tandabs, diabodies ((VL-VH)2 or (VH-VL)2), single domain antibodies (e.g., sdAbs (VL or VH), such as nanobodies, and camelid VHH domains), and multispecific antibodies formed from antibody fragments. In some embodiments, the "antibody fragment" corresponds to the antigen-binding or epitope-binding site of an antibody. In other embodiments, the "antibody fragment" corresponds to other functional regions of the antibody, such as an effector domain or portion thereof, or a salvage receptor binding epitope or portion thereof.

[0106] As used herein, the term "single chain variable fragment," or "scFv" antibody, refers to a form of an antibody (e.g., an antibody fragment) that contains only the variable regions of the heavy and light chains joined by a linker peptide. An scFv can contain VL-linker-VH or VH-linker-VL. scFv antibodies are typically 220-250 amino acids in length and contain a linker of 10-25 amino acids in length.

[0107] As used herein, the term "Fc region" or simply "Fc" is understood to mean the carboxyl-terminal portion of an immunoglobulin chain constant region, preferably an immunoglobulin heavy chain constant region, or a portion thereof. For example, an immunoglobulin Fc region may include (1) a CH1 domain, a CH2 domain, and a CH3 domain, (2) a CH1 domain and a CH2 domain, (3) a CH1 domain and a CH3 domain, (4) a CH2 domain and a CH3 domain, or (5) a combination of two or more domains and an immunoglobulin hinge region. In a preferred embodiment, an immunoglobulin Fc region includes at least an immunoglobulin hinge region, a CH2 domain, and a CH3 domain, and preferably lacks a CH1 domain. In one embodiment, the class of immunoglobulin from which the heavy chain constant region is derived is IgG (Igγ) (γ subclasses 1, 2, 3, or 4). Other classes of immunoglobulins, IgA (Igα), IgD (Igδ), IgE (Igε) and IgM (Igμ) may also be used. Selection of appropriate immunoglobulin heavy chain constant regions is discussed in detail in U.S. Patent Nos. 5,541,087 and 5,726,044. Each of these patents is incorporated herein by reference in its entirety. Selection of specific immunoglobulin heavy chain constant region sequences from specific immunoglobulin classes and subclasses to achieve particular results is considered to be within the level of skill in the art. The portion of the DNA construct encoding the immunoglobulin Fc region preferably includes at least a portion of the hinge domain, and preferably includes at least a portion of the CH3 domain of Fc gamma or a homologous domain of either IgA, IgD, IgE, or IgM. Additionally, substitutions or deletions of amino acids within the immunoglobulin heavy chain constant region may be useful in carrying out the methods and compositions disclosed herein. One example would be to introduce amino acid substitutions in the upstream CH2 region to generate Fc variants with reduced affinity for Fc receptors (Cole, J. Immunol. 159:3613 (1997)).

[0108] "Antibody-dependent cellular cytotoxicity" or "ADCC" refers to a cell-mediated reaction in which non-specific cytotoxic cells expressing Fc receptors (FcR) (e.g., natural killer (NK) cells, neutrophils, and macrophages) recognize bound antibodies on target cells and subsequently lyse (or cause other cytotoxic effects on) the target cells. To assess the ADCC activity of a molecule of interest, any in vitro ADCC assay known in the art can be used, such as those described in U.S. Pat. No. 5,500,362 or U.S. Pat. No. 5,821,337. Effector cells useful for such assays include, but are not limited to, peripheral blood mononuclear cells (PBMCs) and natural killer cells (NK) cells. Alternatively, or in addition, the ADCC activity of a molecule of interest can be assessed in vivo, for example, using an animal model such as that disclosed in Clynes et al., PNAS 95:652-656 (1998).

[0109] The term "antigenic determinant binding domain" or "ADBD" is used herein as a term to refer to a sequence of a polypeptide (e.g., an adaptor or CAR) sufficient to confer recognition and specific binding to a target antigenic determinant (AD). In some embodiments, the ADBD is an antigen-binding antibody fragment, scFv, or an antigen-binding peptide not based on an antibody or antibody fragment sequence (e.g., a D domain or an affibody). In some embodiments, the ADBD comprises a non-antibody-based binding scaffold (e.g., a D domain, an affibody, a fibronectin domain, a nanobody, a lipocalin domain, an ankyrin domain, a maxibody, a protein A domain, or an affilin domain). In some embodiments, the ADBD is a D domain. In some embodiments, the ADBD is an antibody-based binding sequence. In some embodiments, the ADBD is an scFv or a domain antibody (dAb). In some embodiments, the ADBD has the ability to bind to a target antigen on the surface of a cell. In some embodiments, the ADBD has the ability to bind to a target antigen on the surface of an immune effector cell. In some embodiments, the ADBD has the ability to bind to a growth factor receptor or a hormone receptor.

[0110] In certain embodiments, the ADBD is a non-antibody scaffold-based polypeptide sequence sufficient to confer recognition and specific binding to a target antigenic determinant. In some embodiments, the non-antibody-based ADBD is a polypeptide capable of binding to a target antigen on the surface of a cell. In some embodiments, the non-antibody-based ADBD is capable of binding to a growth factor receptor or a hormone receptor. In some embodiments, the ADBD is a D-domain-based polypeptide. In certain embodiments, the ADBD is a D-domain-based polypeptide sufficient to confer recognition and specific binding to a target antigenic determinant. In some embodiments, the ADBD is a D-domain-based polypeptide capable of binding to a target antigen on the surface of a cell. In some embodiments, the ADBD is a D-domain-based polypeptide capable of binding to a growth factor receptor or a hormone receptor. In some embodiments, the ADBD is a D-domain-based polypeptide capable of binding to a target antigen on a serum protein.

[0111] The term "specifically binds" or "has selective affinity for" means that a binding agent, such as an adapter or CAR, reacts or binds to an epitope, protein, or target molecule more frequently, more rapidly, for a longer period of time, with greater affinity for the target epitope, or some combination thereof, than to other agents, including unrelated proteins. Due to sequence identity between homologous proteins in different species, specific binding, in some embodiments, includes a binding agent that recognizes a protein or target in more than one species. Similarly, due to homology within sequence regions of a particular polypeptide of different proteins, specific binding may include a binding agent that recognizes more than one protein or target. In certain embodiments, a binding agent that specifically binds to a first target may or may not specifically bind to a second target. Thus, "specific binding" does not necessarily require (although it can include) exclusive binding, e.g., binding to a single target. Thus, a binding agent may, in certain embodiments, specifically bind to more than one target. In certain embodiments, multiple targets may be bound by the same antigen binding site on the binding agent.

[0112] The terms "linker," "spacer," and "hinge" are used interchangeably herein to refer to a peptide or other chemical link between two or more otherwise independent functional domains of an adaptor or a CAR. For example, a linker can be placed between an antigenic determinant domain and an antigenic determinant binding domain of an adaptor. Similarly, a linker can be placed between two antigenic determinant binding domains of a CAR, or between an antigenic binding domain and a transmembrane domain. Suitable linkers for linking two or more domains of an adaptor are described herein and / or will be apparent to one of skill in the art for other reasons.

[0113] As used herein, the term "operably linked" refers to two molecules linked together such that each retains at least some level of the functional activity that each molecule had alone. In some embodiments where one molecule does not have a functional activity, it is operably linked to another molecule if the other molecule has at least some level of its functional activity. Operatively linked can also refer to the linkage of two non-functional molecules. Two molecules can be "operably linked" whether they are directly or indirectly (e.g., via a linker).

[0114] By "target" is meant any molecule or combination of molecules that can be bound by an adaptor or CAR, or an element of an adaptor or CAR, e.g., an antigenic determinant binding domain.

[0115] As used herein, the term "target cell" refers to a cell that is involved in a disease and can be targeted by a CAR, adapter, and / or CAR / adapter composition provided herein. A target cell includes any cell in a subject (e.g., a human or animal) that can be targeted by a CAR, adapter, and / or CAR / adapter composition. A target cell can be a cell that expresses or overexpresses a target that is specifically bound by a CAR, adapter, and / or CAR / adapter composition.

[0116] Expressions such as "binding affinity to a target", "binding to a target" and similar expressions known in the art refer to a property of a polypeptide that can be measured directly by determining the affinity constant, for example, the amount of adapter that binds and dissociates at a given antigen concentration. Alternative methods can be used to characterize molecular interactions, including, but not limited to, competitive analysis, equilibrium analysis and microcalorimetry, and real-time interaction analysis based on surface plasmon resonance interactions (e.g., using a Biacore® instrument). These methods are well known to those skilled in the art and are described, for example, in Neri et al., Tibtech 14:465-470 (1996), and Jansson et al., J.Biol.Chem.272:8189-8197 (1997).

[0117] The terms "antigenic determinant" and "epitope" are used interchangeably herein and refer to a portion of any molecule (e.g., a target or adaptor) that can be recognized and specifically bound by a specific binding agent (e.g., an adaptor or CAR). When the recognized molecule is a polypeptide, an epitope is formed from contiguous and non-contiguous amino acids and / or chemically active surface groups of other molecules (such as carbohydrates) juxtaposed by tertiary folding of the protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturation, whereas epitopes formed by tertiary folding are typically lost upon protein denaturation. An epitope typically comprises at least 3 amino acids, more commonly at least 5 or 8-10 amino acids, in a unique spatial conformation.

[0118] As used herein, the term "derived from" indicates a relationship between a first and a second molecule. It usually refers to a structural similarity between the first and second molecules, and does not imply or include a limitation on the process or source of the first molecule derived from the second molecule. For example, in the case of an intracellular signaling domain derived from a CD3ζ molecule, the intracellular signaling domain retains the appropriate CD3ζ structure such that it has the required function, i.e., the ability to generate a signal under appropriate conditions. It does not imply or include a limitation on the particular process of generating the intracellular signaling domain, e.g., it does not mean to start with the CD3ζ sequence and delete or mutate undesired sequences to obtain the intracellular signaling domain to arrive at the intracellular signaling domain.

[0119] The term "native" when used in reference to biological material, such as nucleic acid molecules, polypeptides, antigenic determinants, and host cells, means that which is found in nature and has not been modified by man. Conversely, when used in reference to biological material, the terms "non-natural" or "synthetic" mean that which is not found in nature and has been modified by man.

[0120] As used herein, a "modification" to a reference sequence includes substitutions, deletions, insertions, and / or additions to the sequence compared to the corresponding amino acid positions of the reference sequence.

[0121] A "substitution" relative to a reference sequence refers to the replacement of a particular amino acid residue with a different amino acid residue at a corresponding amino acid position in the reference sequence.

[0122] A "conservative" amino acid substitution is one in which one amino acid residue is replaced with another amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine (K), arginine (R), histidine (H)), acidic side chains (e.g., aspartic acid (D), glutamic acid (E)), uncharged polar side chains (e.g., glycine (G), asparagine (N), glutamine (Q), serine (S), threonine (T), tyrosine (Y), cysteine (C), cysteine (D), cysteine (E), cysteine (F), cysteine (G), cysteine (F ... Conservative substitutions include conservative side chains such as alanine (A), valine (V), leucine (L), isoleucine (I), proline (P), phenylalanine (F), methionine (M), tryptophan (W), beta-branched side chains such as threonine (T), valine (V), isoleucine (I), and aromatic side chains such as tyrosine (Y), phenylalanine (F), tryptophan (W), histidine (H). For example, a substitution of tyrosine for phenylalanine is a conservative substitution. In one embodiment, a conservative substitution in the sequence of an adaptor or CAR retains specific binding of the adaptor or CAR containing the substitution to the target to which it binds. Methods for identifying nucleotide and amino acid conservative and non-conservative substitutions that confer, alter or maintain selective binding affinity are known in the art (see, e.g., Brummell, Biochem. 32:1180-1187 (1993); Kobayashi, Protein Eng. 12(10):879-884 (1999); and Burks, PNAS 94:412-417 (1997)).

[0123] A "non-conservative" amino acid substitution is one in which one amino acid residue is replaced with another amino acid residue having a heterologous side chain. In one embodiment, a non-conservative substitution in the sequence of an adaptor or CAR retains specific binding of the adaptor or CAR containing the substitution to the binding target.

[0124] "Unnatural amino acid", "amino acid analog" and "non-standard amino acid residue" are used interchangeably herein. Unnatural amino acids that can be substituted in the adaptors provided herein are known in the art. In one embodiment, the unnatural amino acid is 4-hydroxyproline, which can be substituted for proline, 5-hydroxylysine, which can be substituted for lysine, 3-methylhistidine, which can be substituted for histidine, homoserine, which can be substituted for serine, and ornithine, which can be substituted for lysine. Additional examples of unnatural amino acids that can be substituted in the adaptors include, but are not limited to, molecules such as D-isomers of the common amino acids, 2,4-diaminobutyric acid, α-aminoisobutyric acid, A-aminobutyric acid, Abu, 2-aminobutyric acid, γ-Abu, ε-Ahx, 6-aminohexanoic acid, Aib, 2-aminoisobutyric acid, 3-aminopropionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, β-alanine, lanthionine, dehydroalanine, γ-aminobutyric acid, selenocysteine, and pyrrolidine fluoroamino acids, designer amino acids such as β-methyl amino acids, Cα-methyl amino acids, and Nα-methyl amino acids, or combinations of unnatural amino acids. Further additional unnatural amino acids can include 4-aminobutyric acid, 4-amino-3-hydroxy-5-phenylpentanoic acid, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-thienylalanine, and / or D-isomers of amino acids. As discussed herein, in some embodiments, the unnatural amino acids or amino acid analogs can include deletions of one or more amino acids from the sequence.

[0125] The terms "polynucleotide" and "nucleic acid" are used interchangeably herein to refer to any length of polymeric form of nucleotides, ribbon nucleotides or deoxynucleotides. These terms include, but are not limited to, DNA, RNA, cDNA (complementary DNA), mRNA (messenger RNA), rRNA (ribosomal RNA), shRNA (small hairpin RNA), snRNA (small nuclear RNA), snoRNA (small nucleolar RNA), miRNA (microRNA), genomic DNA, synthetic DNA, synthetic RNA, and / or tRNA. In some embodiments, the isolated polynucleotide is a modified mRNA that includes non-natural nucleosides or nucleotides. In some embodiments, the modified mRNA includes 2-thiouridine, pseudouridine, or 1-methylpseudouridine.

[0126] As used herein, the term "naked DNA" refers to DNA (e.g., histone-free DNA) encoding a protein such as an adapter or CAR cloned into a suitable expression vector (e.g., a plasmid) in the proper orientation for expression. Viral vectors that can be used include, but are not limited to, SIN lentiviral vectors, retroviral vectors, foamy virus vectors, adenoviral vectors, adeno-associated virus (AAV) vectors, hybrid vectors, and / or plasmid transposons (e.g., Sleeping Beauty transposon system), or integrase-based vector systems. Other vectors that can be used in connection with the generation and use of adapters and CARs are described herein or known in the art.

[0127] As used herein, the terms "vector," "cloning vector," and "expression vector" refer to a vehicle by which a nucleic acid sequence (e.g., an adapter or CAR coding sequence) can be maintained or propagated in or introduced into a host cell (e.g., a cloning vector) to transform the host and promote expression (e.g., transcription and translation) of the introduced sequence. Vectors include plasmids, phages, viruses, and the like.

[0128] "Host cells" include individual cells or cell cultures that can be or have been recipients of nucleic acids encoding an adapter or CAR. Host cells include, but are not limited to, viral particles, phagemids, bacteria, yeast, plants, animals, and mammalian cells. Host cells include the progeny of a single host cell, which progeny need not be completely identical (in morphology or total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutations and / or alterations. Host cells include cells transfected or infected with nucleic acids encoding an adapter or CAR in vivo, in vitro, or ex vivo. In some examples, the host cell can express the adapter. In some examples, the host cell can express and secrete the adapter. In some examples, the host cell can express the CAR. In some examples, the host cell can express and display the CAR on its surface. "Expression" includes transcription and / or translation.

[0129] As used herein, the terms "pharmacologically acceptable" or "physiologically acceptable" and grammatical variations thereof, when referring to compositions, carriers, diluents and reagents, are used interchangeably to indicate that the substance can be administered to humans without the production of therapeutically prohibited undesirable physiological effects, such as nausea, dizziness, acute gastric peristalsis and other therapeutically prohibited undesirable physiological effects known in the art.

[0130] "Parenteral" administration of the immunogenic compositions includes, for example, subcutaneous (sc), intravenous (iv), intramuscular (im), or intrasternal injection, or infusion techniques.

[0131] The term "stimulate" or "stimulation" refers to a primary response induced by binding of a stimulatory molecule with its cognate ligand, thereby inducing a signaling event, such as, for example, but not limited to, signaling through an appropriate receptor, such as a T receptor or an NK receptor.

[0132] "Modulate" or "modulation" refers to the regulation or control of magnitude, frequency, extent, or activity. In another related aspect, such modulation can be positive (e.g., increasing frequency, extent, or activity) or negative (e.g., decreasing frequency, extent, or activity). In some embodiments, the modulation, either positive or negative, is relative to the function of the cell, tissue, or organ prior to administration of the therapeutic agent. In further embodiments, the modulation, either positive or negative, is relative to the function of a healthy, intact cell, tissue, or organ.

[0133] An "effective amount" of a CAR cell, adaptor, and / or CAR cell / adaptor composition provided herein is an amount sufficient to accomplish a specifically stated purpose, such as causing an observable change in one or more biological activities associated with the target to which the CAR cell and / or adaptor binds. In certain embodiments, the change increases the level of the target activity. In other embodiments, the change decreases the level of the target activity. An "effective amount" can be determined empirically and routinely in relation to the stated purpose. The term "therapeutically effective amount" refers to an amount of CAR cell and / or adaptor or other therapeutic agent effective to "treat" (e.g., reduce symptoms of a disease or disorder) a disease or disorder in a subject (mammal). A "prophylactically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result.

[0134] "Patient," "subject," "animal," and "mammal" are used interchangeably and refer to mammals, such as human patients and non-human primates, as well as laboratory animals, such as rabbits, rats, mice, and other animals. Animals include all vertebrates, e.g., mammals and non-mammals, such as chickens, amphibians, and reptiles. As used herein, "mammal" refers to any member of the class Mammalia, including, but not limited to, humans and non-human primates, e.g., chimpanzees and other apes and monkey species; livestock animals, such as cows, sheep, pigs, goats, and horses; domestic mammals, such as dogs and cats; laboratory animals, such as rodents, such as mice, rats, guinea pigs, and other members of the class Mammalia known in the art. In certain embodiments, the patient is a human. The term does not denote a particular age or sex. Thus, adult and neonatal / pup subjects, as well as fetuses / pups, regardless of male or female, are intended to be included within the scope of the term.

[0135] As used herein, the terms "treat", "treatment" and "treating" refer to both therapeutic and prophylactic or preventative treatment, where the purpose is to prevent or delay (reduce or delay) symptoms, complications, or biochemical manifestations of a disease, condition, or disorder, to alleviate the disease, condition, or disorder, or to prevent or inhibit its further development. "Treatment" can be targeted to a pathology, prophylactic (preventing or delaying the onset of a disease or preventing the clinical or asymptomatic manifestations thereof) or therapeutic inhibition or alleviation of symptoms after the onset of a disease, condition, or disorder, preventing a pathology, pursuing or obtaining a beneficial outcome, or reducing the probability of the development of a particular condition, even if the treatment is ultimately unsuccessful. Subjects in need of treatment include those already with the condition, as well as those prone to the condition, or those in whom the condition is to be prevented. Treatment can involve the use of CAR cells, adaptors, and / or CAR cell / adaptor compositions, alone or in combination with additional therapeutic agents. In some embodiments, the terms "treat", "treatment" and "treating" as used herein refer to both therapeutic and prophylactic or preventative treatments, where the objective is to prevent or slow (reduce or delay) a symptom, complication, or biochemical manifestation of a proliferative disorder, or to ameliorate one or more symptoms (preferably one or more identifiable symptoms) of a proliferative disorder. In certain embodiments, the terms "treat", "treatment" and "treating" refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as tumor growth, which may not necessarily be identifiable by the patient. In other embodiments, the terms "treat", "treatment" and "treating" refer to the inhibition of progression of a proliferative disorder, either physically, e.g., by stabilization of an identifiable symptom, or physiologically, e.g., by stabilization of a physical parameter, or both.In another embodiment, the terms "treat", "treatment" and "treating" refer to the reduction or stabilization of tumors, tumor cell growth or survival, or cancer cell numbers.

[0136] "Cancer," "tumor," or "malignant tumor" are used interchangeably and refer to any of a number of diseases characterized by uncontrolled, abnormal proliferation of cells, spread of infected cells locally or via the bloodstream and lymphatic system to other parts of the body (metastasis), and a number of distinctive structural and / or molecular features. As used herein, "tumor" refers to all neoplastic cell growth and proliferation, and all pre-cancerous and cancerous cells and tissues, whether malignant or benign. "Cancerous tumor," or "malignant cells," are understood to be cells that have specific structural characteristics, lack differentiation, and are capable of invasion and metastasis. Cancers that can be treated using the CAR cells, adaptors, and / or CAR cell / adaptor compositions provided herein include, but are not limited to, breast cancer, lung cancer, brain cancer, neck cancer, skin cancer, bone cancer, liver cancer, bone cancer, pancreatic cancer, colorectal cancer, renal cancer, head and neck cancer, ovarian cancer, hematopoietic cancer (e.g., leukemia), and prostate cancer, and lymphoma. Other types of cancers and tumors that can be treated using CAR cells, adaptors, and / or CAR cell / adaptor compositions are described herein or known in the art. A particular "type" is understood to mean a cancer, tumor, or tumor cell characterized by a particular disease. For example, in some embodiments, the first and second cancers of the same type are mixed cell type Hodgkin lymphoma and lymphocyte-rich Hodgkin lymphoma. In other embodiments, the first and second cancers of the same type are precursor B-cell acute lymphoblastic leukemia (ALL) and mature B-cell ALL. Examples of first and second cancers of different types include, for example, Hodgkin lymphoma and ALL.

[0137] The term "tumor antigen" refers to an antigen common to a particular hyperproliferative disorder, such as cancer. The terms "tumor antigen" and "cancer antigen" are used interchangeably herein. In certain embodiments, the antigen is derived from cancer, including, but not limited to, primary or metastatic melanoma, thymoma, lymphoma, sarcoma, lung cancer (e.g., NSCLC or SCLC), liver cancer, non-Hodgkin's lymphoma, Hodgkin's lymphoma, leukemia, multiple myeloma, glioblastoma, neuroblastoma, uterine cancer, cervical cancer, renal cancer, thyroid cancer, bladder cancer, kidney cancer, mesothelioma, and adenocarcinoma, such as breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, colon cancer, and other cancers known in the art. In some embodiments, the cancer is one or more of B-cell acute lymphoblastic leukemia ("BALL"), T-cell acute lymphoblastic leukemia ("TALL"), acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML); one or more chronic leukemias, such as, but not limited to, chronic myeloid leukemia (CML), chronic lymphocytic leukemia (CLL); and additional blood cancers or hematological conditions including: chronic large B-cell lymphoma, follicular lymphoma, hairy cell leukemia, small cell or large cell follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma, mantle cell lymphoma, marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndromes, non-Hodgkin's lymphoma, plasmablastic lymphoma, blastic plasmacytoid dendritic cell neoplasm, Waldenstrom's hypergammaglobulinemia.

[0138] Tumor and cancer antigens may be further defined as "tumor specific antigens (TSA)", "cancer specific antigens (CSA)", "tumor associated antigens (TAA)", or "cancer associated antigens (CAA)". TSAs are antigens that are unique to tumor cells and do not occur on other cells in the body. TAAs are antigens found on both tumors and some normal cells. TAAs may be expressed on normal cells under conditions that do not induce a state of immune tolerance to the antigen. Expression of TAAs on tumors may occur under conditions that allow the immune system to respond to the antigen. TAAs are expressed on normal cells during fetal development when the immune system is immature and unable to respond, or may normally be present at very low levels on normal cells, but are expressed at much higher levels on tumor cells. Due to the dynamic nature of tumors, in some cases tumor cells may express antigens that are unique at certain stages, and in other cases express antigens that are also expressed on non-tumor cells. Thus, the inclusion of a particular marker such as a TAA does not exclude it from being considered a TSA. In some embodiments, the TAA and / or TSA comprising an antigenic determinant specifically bound by the CAR cells, adaptors, and / or CAR cell / adaptor compositions provided herein is selected from the following: BCMA, CD19, CD20, CD22, CD30, CD33 / lL3Ra, CD70, CD123, CD171 (L1-CAM), CS1, EGFRvIII, GD2, Lewis γ、ROR 1, IL13Ra2, cMet, PSMA, free radical α(FR-α), CEA, ErbB2( HER-2 / neu); EGFR(HER), PSCA, PSA, MUC1, MUC16, CD44v6, CD 44v6 / 7, CD44v7 / 8, CD55, IL11Ra, EphA2, EGP40, TAG72, CAIX, HMW-MAA(CSPG4), MAGEA4, NKG2D, β-HCG, Glycolipid F77, HLA-A2(NY-ESO-1), HMW-MAA, GD3, TCR, MAGE A3, MARTI, WT1, Mulberry, gp100(Pmel 17) TRP1, TRP2, HLA-A1, MAGE1, MAGE3, BAGE, GAGE1, GAGE 2, pi5, p53, Ras, BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR;VE GFR2, FAP, FAR, EBVA, HPV vaccine E6, HPV vaccine E7, TSP-180, MAGE4, MAGE5, M AGE6, RAGE, pl85erbB2, pl80erbB3, nm-23Hl, CA19-9, CA72-4, CAM 17.1 NuMa, K-ras, β-linkage, CDK4, Mum-1, p15, p 16, 43-9F, α-protein, BCA225, BTAA, CA125, CA 15-3, CA 27.29(BCAA), CA195, CA242, CA50, CAM43, CD68, CO-029, FGF5, G250, HTgp-175 344. MA50, MG7-Ag, NB / 70K, NY-CO-1, RCAS1, SDCCAG16, M2BP, TAAL6, TLP, およ, 3TPS.

[0139] As used herein, the term "CS1" is an NK cell receptor that regulates immune function and is expressed on B cells, T cells, dendritic cells, NK-T cells, and monocytes alike. CS1 is overexpressed in multiple myeloma and has been successfully targeted for immunotherapy of multiple myeloma (Malaer & Mathew, Am J Cancer Res. 7(8):1637-1641 (2017)). CS1 is also known as SLAM7, protein 19A, CRACC, and CD319. The term "CS1" includes variants, isoforms, homologs, orthologs, and paralogs. CS1 is a transmembrane protein with a variety of alternatively spliced isoforms. In some embodiments, the amino acid sequence of human CS1 comprising a 22 amino acid residue N-terminal signal sequence (MAGSPTCLTLIYILWQLTGSAA, SEQ ID NO:1119) and an extracellular domain comprising 226 N-terminal residues (SEQ ID NO:1120) has GenBank Accession Number NP_067004 (SEQ ID NO:1121). In some embodiments, the amino acid sequence of human CS1 has GenBank Accession Number NP_001269517, NP_001269518, NP_001269519, NP_001269520, NP_001269521, NP_001269522, NP_001269523, NP_001269524, or NP_001269525.

[0140] As used herein, the term "autoimmune disease" is defined as a disorder resulting from an autoimmune response. Autoimmune diseases are the result of an inappropriate, excessive response to self-antigens. Examples of autoimmune diseases include, but are not limited to, Addison's disease, alopecia areata, ankylosing spondylitis, autoimmune hepatitis, autoimmune parotitis, Crohn's disease, diabetes mellitus (type I), dystrophic epidermolysis bullosa, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, systemic lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus vulgaris, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathy, thyroiditis, vasculitis, leukoplakia, myxedema, pernicious anemia, and ulcerative colitis, among others.

[0141] As used herein, the term "transduction" refers to the introduction of foreign nucleic acid into a cell using a viral vector. As used herein, the term "gene transfer" refers to the introduction of foreign nucleic acid into a cell using recombinant DNA technology. The term "transformation" refers to the introduction of a "foreign" (e.g., exogenous, extracellular, or otherwise non-endogenous) nucleic acid (DNA or RNA) sequence into a host cell, which expresses the introduced nucleic acid to produce a substance, such as a protein or enzyme, encoded by the desired introduced coding sequence. The introduced nucleic acid sequence may also be referred to as a "cloned" or "foreign" gene or sequence, and may include regulatory or control sequences, such as start, stop, promoter, signal, secretion, or other sequences used by the genetic machinery of the cell. The nucleic acid sequence may include nonfunctional sequences with no known function. A host cell that receives and expresses an introduced nucleic acid (e.g., DNA or RNA) has been "transformed" and is a "transformant" or a "clone." The DNA or RNA introduced to a host cell can come from any source, including cells of the same genus or species as the host cell, or cells of a different genus or species, or can be non-naturally occurring.

[0142] The term "D domain" refers to a target-binding polypeptide that shares a specific sequence and specific structural features of the following reference scaffold sequence: MGSWAEFKQRLAAIK TRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRK EAAAIRDELQAYRHN (SEQ ID NO: 1) (see WO 2016 / 164305 and WO 2016 / 164308, which are incorporated herein by reference in their entirety). The reference scaffold is a non-natural, targetless antiparallel three helical bundle reference polypeptide variant that was originally modified for protein folding training (see Walsh et al., PNAS 96:5486-5491 (1999), which is incorporated herein by reference in its entirety). It has been discovered that polypeptides containing modifications of the targetless reference scaffold having the amino acid sequence of SEQ ID NO: 1 can specifically bind to the target. Thus, D domains or molecules containing D domains can specifically (intentionally) bind to target molecules. Without being bound by theory, it is believed that in the design of D domains, the structural constraints on surface-exposed residues (which can be modified) confer the ability of the surface-exposed residues to specifically bind to the target.

[0143] As used herein, "co-expressed" refers to the expression of two or more protein coding sequences by the same cell or population of cells. The coding sequences may be, for example, nucleic acids that each encode a single protein or a chimeric protein as a single polypeptide chain.

[0144] As used herein, "antigen loss escape variant" refers to a cell that exhibits reduced or lost expression of the target antigen, the antigenic determinant of which is targeted by an adaptor or CAR.

[0145] II. Antigenic determinants (AD) An antigenic determinant (AD) is an epitope that can be recognized and specifically bound by an antigenic determinant binding domain (ADBD) (e.g., an antigen-binding fragment (e.g., a D domain) of an antibody or an alternative scaffold binding domain (ASBD). The ADs in the adapters and on the target cells provided herein can be bound by the CARs discussed below.

[0146] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an AD present in a naturally occurring protein or other molecule. In some embodiments, the AD is an AD that is endogenous to humans.

[0147] In some embodiments, the AD in the adaptor is an AD present on a target cell.

[0148] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an AD present in a transmembrane protein, e.g., an AD present in the extracellular portion of a transmembrane protein. In some embodiments, the AD is a tumor antigen. In some embodiments, the AD is a tumor-associated antigen. In some embodiments, the AD is a tumor-specific antigen.

[0149] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is a cancer antigen. In some embodiments, the AD is a cancer-associated antigen. In some embodiments, the AD is a cancer-specific antigen.

[0150] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of BCMA. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:5.

[0151] In some embodiments, the AD is an epitope of CD 19. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:3.

[0152] In some embodiments, the AD is an epitope of CD20. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NOs: 6-9, or 10.

[0153] In some embodiments, the AD is an epitope of CD22. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:41.

[0154] In some embodiments, the AD is an epitope of CD 123. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:11.

[0155] In some embodiments, the AD is an epitope of CD37. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 12 or 13.

[0156] In some embodiments, the AD is an epitope of CS1. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 1139. In further embodiments, the AD is an epitope of CS1 bound by elotuzumab.

[0157] In some embodiments, the AD is an epitope of HER2. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:42.

[0158] In some embodiments, the AD is an epitope of AFP. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:15.

[0159] In some embodiments, the AD is an epitope of AFP p26. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 16. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 1117. In further embodiments, the AD comprises amino acid residues of SEQ ID NO: 16, 1117, 1118, 1119, 1120, 1121, 1122, or 1123.

[0160] In some embodiments, the AD (eg, in the adaptor and / or on the target cell) is expressed on the surface of an immune effector cell.

[0161] In some embodiments, the AD is an epitope of the extracellular domain (ECD) of human CD45. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all of residues 29-766 of SEQ ID NO:1106.

[0162] In some embodiments, the AD is an epitope of human CD45 bound by the UCHL-1, A6, or ODP4 antibody. In some embodiments, the AD is an epitope of human CD45 bound by the 4KB5, MB1, KiB3, 2H4, or MT2 antibody.

[0163] In some embodiments, the AD is an epitope of CD26. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all of residues 29-766 of SEQ ID NO:1113.

[0164] In some embodiments, the AD is an epitope of CD30. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all of residues 19-379 of SEQ ID NO:1114.

[0165] In some embodiments, the AD is an epitope of CD33. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all of residues 18-259 of SEQ ID NO:1115.

[0166] In some embodiments, the AD is an epitope of CD38. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all of residues 43-300 of SEQ ID NO:1116.

[0167] In some embodiments, the AD is an epitope of a human intracellular protein. In further embodiments, the AD is an epitope of an intracellular portion of a membrane-bound receptor protein selected from the group: cytokine receptor, chemokine receptor, T cell receptor, B cell receptor, NK cell receptor, myeloid cell receptor, endothelial cell receptor, and epithelial cell receptor. In some embodiments, the AD is an epitope of an intracellular portion of CD3, CD137, CD279, CD223, CD152, CD28, and VEGFR-2. In some embodiments, the AD is an epitope of a human nuclear protein.

[0168] In some embodiments, the AD (e.g., in the adapter and / or on the target cell) is an epitope of a tumor antigen associated with a malignant tumor. In some embodiments, the AD is an epitope of a tissue-specific antigen from melanoma. In some embodiments, the AD is an epitope of a tissue-specific melanoma antigen selected from MART-1, tyrosinase, and GP100. In some embodiments, the AD is an epitope of a tissue-specific antigen from prostate cancer. In some embodiments, the tissue-specific prostate cancer antigen is selected from prostatic acid phosphatase (PAP) and prostate specific antigen (PSA). In some embodiments, the AD is an epitope of a transformation-associated molecule. In further embodiments, the AD is an epitope of ErbB2 (HER2). In some embodiments, the AD is an epitope of a carcinoembryonic antigen. In some embodiments, the AD is an epitope of a carcinoembryonic antigen (CEA). In some embodiments, the AD is an epitope of a B-cell lymphoma-specific idiotypic immunoglobulin. In some embodiments, the AD is an epitope of a B-cell differentiation antigen. In some embodiments, the AD is an epitope of a B cell differentiation antigen selected from CD19, CD20, and CD37. In some embodiments, the AD is an epitope of an antigen on a myeloid cell. In some embodiments, the AD is an epitope of a myeloid cell antigen selected from TSLPR and IL-7R. In some embodiments, the AD is an epitope of a cancer testis (CT) antigen. In some embodiments, the AD is an epitope of a cancer testis (CT) antigen selected from NY-ESO-1 and LAGE-1a. In some embodiments, the AD is an epitope of an antigen selected from CS1, CD38, CD138, MUC1, HM1.24, CYP1B1, SP17, PRAME, Wilms' tumor 1 (WT1), and heat shock protein gp96 on multiple myeloma cells.

[0169] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of a TSA or TAA. In some embodiments, the AD is an epitope of a tumor differentiation antigen. In some embodiments, the AD is an epitope of a tumor differentiation antigen selected from MART1 / MelanA, gp100 (Pmel 17), tyrosinase, TRP1, and TRP2. In some embodiments, the AD is an epitope of a tumor specific multilineage antigen. In some embodiments, the AD is an epitope of a tumor specific multilineage antigen selected from MAGE1, MAGE3, BAGE, GAGE1, GAGE2, and p15. In some embodiments, the AD is an epitope of an overexpressed fetal antigen. In some embodiments, the AD is an epitope of CEA. In some embodiments, the AD is an epitope of an overexpressed oncogene or a mutated tumor suppressor gene product. In some embodiments, the AD is an epitope of an overexpressed oncogene or a mutated tumor suppressor gene product selected from p53, Ras, and HER2 / neu. In some embodiments, the AD is an epitope of a unique tumor antigen resulting from a chromosomal translocation. In some embodiments, the AD is an epitope of a unique tumor antigen resulting from a chromosomal translocation selected from BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, and MYL-RAR. In some embodiments, the AD is an epitope of a viral antigen. In some embodiments, the AD is an epitope of the Epstein-Barr virus antigen EBVA. In some embodiments, the AD is an epitope of the human papillomavirus (HPV) antigen E6 or E7. In some embodiments, the AD is an epitope of a large protein-based antigen.

[0170] In some embodiments, the AD (e.g., in the adapter and / or on the target cell) is an epitope of a hematological tumor antigen. In some embodiments, the AD is an epitope of BCMA, CD19, CD20, CD22, CD30, CD138, CD33, CD38, CD123, CS1, ROR1, Lewis Y, an epitope of an antigen selected from Ig kappa light chain, TCR, BCMA, TACI, BAFFR (CD268), and NKG2DL ligand.

[0171] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of a solid tumor antigen. In some embodiments, the AD is an epitope of an antigen selected from disialoganglioside (GD2), o-acetyl GD2, EGFRvIII, HER2 (ErbB2), VEGFR2, FAP, mesothelin, IL13Ra2 (glioma), cMET, PSMA, folate receptor alpha, L1CAM, carcinoembryonic antigen (CEA), and EGFR.

[0172] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of an antigen selected from the group consisting of CD137, PDL1, CTLA4, CD47, KIR, TNFRSF10B (DR5), TIM3, PD1, cMet, glycolipid F77, EGFRvIII, HLAA2 (NY-ESO-1), LAG3, CD134 (OX40), HVEM, BTLA, TNFRSF25 (DR3), CD133, MAGE A3, PSCA, MUC1, CD44v6, CD44v6 / 7, CD44v7 / 8, IL11Ra, ephA2, CAIX, MNCAIX, CSPG4, MUC16, EPCAM (EGP2), TAG72, EGP40, ErbB receptor family, ErbB2 (HER2), ErbB3 / 4, RAGE1, GD3, FAR, Lewis Y, NCAM, HLAA1 / MAGE1, MAGEA1, MAGEA3, MAGE-A4, B7H3, WT1, MelanA (MART1), HPV E6, HPV E7, thyroglobulin, tyrosinase, PSA, CLL1GD3, Tn Ag, FLT3, KIT, PRSS21, CD24, PDGFR-β, SSEA4, prostase, PAP, ELF2M, ephB2, IGF1, IGFII, IGFI receptor, LMP2, gp100, bcr-ab1, fucosyl GM1, sLe, GM3, TGS5, folate receptor β, TEM1 (CD248), TEM7R, CLDN6, TSHR, GPRC5D, CXORF61, CD97, CD7a, HLE, CD179a, ALK, prisialic acid, PLAC1, GloboH, NY-BR-1, UPK2, HAVCR1, ADRB3, PANX3, GPR20, LY6K, OR51E2, TARP, LAGE1a, legumain, E7, ETV6-AML, sperm protein 17, XAGE1, Tie 2, MAD-CT1, MAD-CT2, Fos-related antigen 1, p53, p53 mutant, prosteine, survivin, telomerase, PCTA1 (galectin 8), Ras mutant, hTERT, sarcoma translocation breakpoint, ML-IAP, ERG (TMPRSS2 ETS fusion gene), NA17, PAX3, androgen receptor, cyclin B1, MYCN, RhoC, TRP2, CYP1B1, BORIS, SART3, PAX5, OY-TES1, LCK, AKAP4, SSX2, reverse transcriptase, RU1, RU2, intestinal carboxylesterase, neutrophil elastase, mut hsp70-2, CD79a, CD79b, CD72, LAIR1, FCAR, LILRA2, CD300LF, CLEC12A, BST2, EMR2, LY75, GPC3, FCRLS, I GLL1, TSP-180, MAGE4, MAGE5, MAGE6, VEGFR1, IGF1R, hepatocyte growth factor receptor, p185ErbB2, p180ErbB-3, nm-23H1, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, β-catenin, CDK4, Mum1, p15, p16, 43-9F, 5T4, 791Tgp72, β-human chorionic gonadotropin, BCA225, BTAA, CA125, CA15-3, CA 27.29 (BCAA), CA195, CA242, CA-50, CAM43, CD68, CO-029, FGF5, G250, HTgp-175, M344, MA50, MG7-Ag, MOV18, NB / 70K, NY-CO1, RCAS1, SDCCAG16, M2BP, TAAL6, TLP, and TPS, glioma-associated antigen, alpha-fetoprotein (AFP), p26 fragment of AFP or its mutants, lectin-reactive AFP, and TLR4.

[0173] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of a TSA or TAA. In some embodiments, the AD is an epitope of an antigen selected from PTGER4, ITGA4, CD37, CD52, CD62L (L-selectin), CXCR4, CD69, EVI2B (CD361), SLC39A8, MICB, LRRC70, CLELC2B, HMHA1, LST1, and CMTM6 (CKLFSF6). In some embodiments, the AD is an epitope of BCMA. In some embodiments, the AD is an epitope of CS1.

[0174] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of an antigen selected from the following: PDGFRA, VEGFR1, VEGFR3, Neuropilin 1 (NRP1), Neuropilin 2 (NRP2), Betacellulin, PLGF, RET (rearranged during gene transfer), TIE1, TIE2 (TEK), CA125, CD3, CD4, CD7, CD10, CD13, CD25.CD32, CD32b, CD44 (e.g., CD44v6), CD47, CD49e (integrin α5), CD54 (ICAM), CD55, CD64, CD74, CD80, CD90, CD200, CD147, CD166, CD200, ESA, SHH, DHH, IHH, patched 1 (PTCH1), smoothened 1 (SMO), WNT1, WNT2B, WNT3A, WNT4, WNT4A, WNT5A, WNT5B, WNT7B, WNT8A, WNT10A, WNT10B, WNT16B, LKP5, LRP5 , LRP6, FZD1, FZD2, FZD4, FZD5, FZD6, FZD7, FZD8, Notch, Notch1, Notch3, Notch4, DLL4, Jagged, Jagged1, Jagged2, Jagged3, TNFRSF1A (TNFR1, p55, p60), TNFRSF1B (TNFR2), TNFRSF6 (Fas, CD95), TNFRSF6B (DcR3), TNFRSF7 (CD27), TNFSF9 (41BB ligand), TNFRSF8 (CD30), TNFRSF10A (TRAILRl, DR4), TNF RSF11A(RANK), TNFRSF12(TWEAKR), TNFRSF19L(KELT), TNFRSF19(TROY), TNFRSF21(DR6), ILIRI, 1L1R2, IL2R, IL5R, IL6R, 1L8R, IL10R, IL1 2R, IL13R, IL15R, IL18R, IL19R, IL21R, IL23R, XAG1, XAG3, REGIV, FGFR1, FGFR2, FGFR3, ALK, ALK1, ALK7, ALCAM, Axl, TGFb, TGFb2, TGFb3, TG FBR1, IGFIIR, BMPRI, N-cadherin, E-cadherin, VE-cadherin, ganglioside GM2, ganglioside GD3, PSGR, DCC, CDCP1, CXCR2, CXCR7, CCR3, CCR4, CCR5, CCR7, CCR10, claudin 1, claudin 2, claudin 3, claudin 4, TMEFF2, neuregulin, MCSF, CSF, CSFR(fms), GCSF, GCSFR, BCAM, BRCA1, BRCA2, HLA-DR, ABCC3, ABCB5, HM 1.24, LFA1, LYNX, S100A8, S100A9, SCF, von Willebrand factor, Lewis Y6 receptor, CAG250 (CA9), CRYPTO, VLA5, HLADR, MUCl8, mucin CanAg, EGFL7, integrin avb3, integrin α5β activin Blα, leukotriene B4 receptor (LTB4R), neurotensin NT receptor (NTR), 5T4 carcinoembryonic antigen, tenascin-C, MMP, MMP2, MMP7, MMP9, MMP12, MMP14, MMP26, cathepsin G, SULF1, SULF2, MET, CA9, TM4SF1, syndecan (SDCl), ephrin B4, TEM1, TGFβ1, and TGFBRII.

[0175] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of an antigen associated with an autoimmune disorder, associated with an inflammatory or other disorder of the immune system, or associated with modulation of the immune response.

[0176] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of an immunosuppressive target. In some embodiments, the AD is an epitope of an immunosuppressive target selected from IL1Ra, IL6R, CD26L, CD28, CD80, FcGamma RIIB. In some embodiments, the AD in the adaptor is an epitope of an immunosuppressive target selected from CD25, CD28, CTLA4, PD1, B7H1 (PDL1), B7H4 TGFbeta, TNFRSF4 (OX40), TNFRSF5 (CD40), TNFRSF9 (41BB, CD137), TNFRSF14 (HVEM), TNFRSF25 (DR3), and TNFRSF18 (GITR).

[0177] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is a target epitope selected from IL1Rb, C3AR, C5AR, CXCR1, CXCR2, CCR1, CCR3, CCR7, CCR8, CCR9, CCR10, ChemR23, MPL, GP130, TLR2, TLR3, TLR4, TLR5, TLR7, TLR8, TLR9, TREM1, TREM2, CD49a (integrin alpha 1), integrin a5b3, alpha 4 integrin subunit, A4B7 integrin, cathepsin G, TNF RSF3(LTBR), TNFRSF6(Fas, CD95), TNFRSF6B(DcR3), TNFRSF8(CD30), TNFRSF11A(RANK), TNFRSF16(NGFR), TNFR SF19L(RELT), TNFRSF19(TROY), TNFRSF21(DR6), CD14, CD23, CD36, CD36L, CD39, CD91, CD153, CD164, CD200, CD20 0R, B71(CD80), B72(CD86), B7h, B7DC(PDL2), ICOS, ICOSL, MHC, CD, B7H2, B7H3, B7x, SLAM, KIM1, SLAMF2, SLAMF3 , SLAMF4, SLAMF5, SLAMF6, SLAMF7, TNFRSF1A(TNFR1, p55, p60), TNFRSF1B(TNFR2), TNFRSF7(CD27), TNFRSF12(TW EAKR), TNFRSF5(CD40), IL1R, IL2R, IL4Ra, IL5R, IL6RIL15R, IL17R, IL17Rb, IL17RC, IL22RA, IL23R, TSLPR, B7RP 1, cKit, GMCSF, GMCSFR, CD2, CD4, CD11a, CD18, CD30, CD40, CD86, CXCR3, CCR2, CCR4, CCR5, CCR8, RhD, IgE, and Rh.

[0178] In some embodiments, the AD (eg, in the adaptor and / or on the target cell) is an epitope of an antigen associated with a neurological disorder.

[0179] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an epitope of an antigen selected from amyloid beta (Abeta), beta amyloid, PLP, ROBO4, ROBO, LINGO, gpIIB, gpIIIa, integrin a2bB3, AOC3, TNFRSF19L (RELT), TNFRSF19 (TROY), and sclerostin.

[0180] The above targets and those described elsewhere herein are intended to be illustrative and not limiting.

[0181] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is bound by a chimeric antigen receptor (CAR). In some embodiments, the AD is bound by a cell expressing a chimeric antigen receptor. In some embodiments, the AD is bound by an scFv. In some embodiments, the AD is bound by an alternative scaffold binding domain (ASBD). In some embodiments, the AD is bound by a D domain. In some embodiments, the AD is bound by an antibody or antigen-binding fragment thereof.

[0182] III. Antigenic determinant binding domain (ADBD) A protein domain that binds an antigenic determinant (AD) (e.g., as described in Sections II and XI) is referred to herein as an "antigenic determinant binding domain" or "ADBD." In some embodiments, the ADBD is sufficient to confer recognition and specific binding to a target. The ADBDs described herein can be present in an adapter (e.g., as described in Sections V and XI) and / or in a chimeric antigen receptor (CAR) (e.g., as described in Sections VI and XI).

[0183] The target that is specifically bound by the ADBD (e.g., of the adaptor and / or CAR) can be any molecule to which it is desirable for the adaptor and / or CAR to bind, for example, any of the ADs described herein (e.g., as described in Sections II and XI). In some embodiments, the target that is specifically bound by the ADBD can be any target that is purified, manufactured, formulated, therapeutic, diagnostic or prognostic relevant or prognostic. In some embodiments, the target of the ADBD can be natural or synthetic. In some embodiments, the target of the ADBD can be an extracellular component, an intracellular component, a soluble factor (e.g., an enzyme, hormone, cytokine, growth factor, toxin, venom, contaminant, etc.), or a transmembrane protein (e.g., a cell surface receptor).

[0184] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) specifically binds to a target on the surface of a target cell. In some embodiments, the ADBD specifically binds to a cell surface receptor. In some embodiments, the ADBD specifically binds to a target that is a member of a family selected from phosphatase receptors, growth factor receptors, tyrosine kinase receptors, TNF family receptors, G protein-coupled receptors, and chemokine receptors. In some embodiments, the ADBD binds to multiple members of the same family (e.g., to the TNF receptors TRAILR1 and TRAILR2). In some embodiments, the ADBD binds to members from different families. Thus, for example, in some embodiments, the ADBD can bind to a growth factor receptor and a TNF receptor, or a G protein-coupled receptor and a chemokine receptor.

[0185] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) binds to a tumor antigen. In some embodiments, the ADBD binds to a tumor-associated antigen. In some embodiments, the ADBD binds to a tumor-specific antigen.

[0186] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) binds to a cancer antigen. In some embodiments, the ADBD binds to a cancer-associated antigen. In some embodiments, the ADBD binds to a cancer-specific antigen.

[0187] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) binds to an antigen expressed on the surface of an immune effector cell.

[0188] In some embodiments, the target bound by the ADBD (e.g., of the adaptor and / or CAR) is a human protein. In one embodiment, the ADBD binds to a human protein target and its monkey (e.g., cynomolgus), mouse, rabbit, hamster and / or rabbit orthologues.

[0189] In another embodiment, the ADBD (e.g., of the adaptor and / or CAR) binds to a peptide tag present on the target. Such peptide tags provide a useful means for detecting, monitoring, and / or attaching one or more additional moieties to the adaptor. In one embodiment, the ADBD binds to a peptide tag selected from a hexahistidyl (His6) tag, a mic tag, and a FLAG tag. Other peptide tags are described herein or known in the art.

[0190] The affinity requirements for a given ADBD binding event depend on a variety of factors, including, but not limited to, the composition and complexity of the binding matrix, the valency and density of both the ADBD and the target molecule, and the functional application of the ADBD. In one embodiment, the ADBD binds to a target molecule with a binding affinity of 5×10 -3 M, 10 -3 M, 5x10 -4 M, 10 -4 M, 5x10 -5 M, or 10 -5 In further embodiments, the ADBD binds to the target with a dissociation constant (KD) of 5x10 -6 M, 10 -6M, 5x10 -7 M, 10 -7 M, 5x10 -8 M, or 10 -8 In a further embodiment, the ADBD binds to the target with a KD of 5x10 -9 M, 10 -9 M, 5x10 -10 M, 10 -10 M, 5x10 -11 M, 10 -11 M, 5x10 -12 M, 10 -12 M, 5x10 -13 M, 10 -13 M, 5x10 -14 M, 10 -14 M, 5x10 -15 M, or 10 -15 In some embodiments, the ADBDs produced by the methods disclosed herein bind with a KD of 10 -4 M and 10 -5 Between M and 10 -5 M and 10 -6 Between M and 10 -6 M and 10 -7 Between M and 10 -7 M and 10 -8 Between M and 10 -8 M and 10 -9 Between M and 10 -9 M and 10 -10 Between M and 10 -10 M and 10 -11 Between M and 10 -11 M and 10 -12 M has a dissociation constant selected from the group consisting of

[0191] In one embodiment, the ADBD binds to the target in an active form. In one embodiment, the ADBD reversibly binds to the target in an active form and releases the binding target in an active form. In one embodiment, the ADBD binds to the target in a natural form. In a particular embodiment, the ADBD binds to the target in a natural form. -10 seconds -1 , 5x10 -9 seconds -1 , 10 -9 seconds -1 , 5x10 -8 seconds -1 , 10-8 seconds -1 、 5 x 10 -7 seconds -1 、 10 -7 seconds -1 、 5 x 10 -6 seconds -1 、 10 -6 seconds -1 、 5 x 10 -5 seconds -1 、 10 -5 seconds -1 、 5 x 10 -4 seconds -1 、 10 -4 seconds -1 、 5 x 10 -3 seconds -1 、 10 -3 seconds -1 、 5 x 10 -2 seconds -1 、 10 -2 seconds -1 、 5 x 10 -1 seconds -1 、 or 10 -1 seconds -1 bind to the target specifically with a dissociation rate constant or Koff of 10 seconds or more.

[0192] Binding experiments for determining KD and the dissociation rate constant can be carried out under many conditions including, but not limited to, [pH 6.0, 0.01% Tween 20], [pH 6.0, 0.1% gelatin], [pH 5.0, 0.01% Tween 20], [pH 9.0, 0.1% Tween 20], [pH 6.0, 15% ethylene glycol, 0.01% Tween 20], [pH 5.0, 15% ethylene glycol, 0.01% Tween 20], and [pH 9.0, 15% ethylene glycol, 0.01% Tween 20]. The buffer for preparing these solutions can be easily determined by those skilled in the art and depends largely on the desired pH of the final solution. For example, a low pH solution (<pH 5.5) can be prepared in citrate buffer, glycine-HCl buffer, or succinate buffer. High pH solutions can be prepared, for example, in Tris-HCl, phosphate buffer, or sodium bicarbonate buffer. For example, KD and the dissociation rate constant can be measured using many conditions for the purpose of determining the optimal pH and / or salt concentration.

[0193] In one embodiment, the ADBD is 0.1 to 10 -7 seconds -1 , 10 -2 ~10 -7 seconds -1 , or 0.5x10 -2 ~10 -7 seconds -1 In certain embodiments, the ADBD specifically binds to the target with a Koff in the range of 5x10 -2 seconds -1 , 10 -2 seconds -1 , 5x10 -3 seconds -1 , or 10 -3 seconds -1 In further embodiments, the ADBD binds to the target with a dissociation rate constant (Koff) of less than 5x10 -4 seconds -1 , 10 -4 seconds -1 , 5x10 -5 seconds -1 , or 10 -5 seconds -1 , 5x10 -6 seconds -1 , 10 -6 seconds -1 , 5x10 -7 seconds -1 , or 10 -7 seconds -1 It binds specifically with a dissociation rate constant (Koff) less than

[0194] In one embodiment, the ADBD is 10 3 ~10 7 M -1 seconds -1 , 10 3 ~10 6 M -1 seconds -1 , or 10 3 ~10 5 M -1 seconds -1 In another particular embodiment, the ADBD specifically binds to the target with a KOn in the range of 10 3 M -1 seconds -1 , 5x10 3 M -1 seconds -1 , 104 M -1 seconds -1 , or 5x10 4 M -1 seconds -1 In a further embodiment, the ADBD binds to the target with a rate (KOn) of greater than 10 5 M -1 seconds -1 , 5x10 5 M -1 seconds -1 , 10 6 M -1 seconds -1 , or 5x10 6 M -1 seconds -1 , or 10 7 M -1 seconds -1 Combine with the target with a greater KOn.

[0195] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) is an antibody or an antigen-binding fragment thereof. In some embodiments, the ADBD is an scFv. In some embodiments, the ADBD is an alternative scaffold binding domain. In some embodiments, the ADBD is a D domain.

[0196] IIIa. Antibody-derived antigenic determinant binding domains (ADBDs) In some embodiments, one or more ADBDs (e.g., of the adaptor and / or CAR) can be derived from an antibody molecule, e.g., a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, a single domain antibody, e.g., one or more of a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) from, e.g., human or camelid origin. In some embodiments, the ADBD is from the same species from which the adaptor or CAR will ultimately be used, e.g., for human applications. It is beneficial for the adaptor and / or CAR to comprise a human or humanized ADBD. Compositions and techniques for producing such ADBDs in a routine manner are known in the art.

[0197] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) comprises an antibody fragment that is sufficient to confer recognition and specific binding to a target antigen. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, scFv antibody fragments, linear antibodies, single domain antibodies such as sdAbs (VL or VH), camelid VHH domains, and multispecific antibodies formed from antibody fragments.

[0198] In some embodiments, the ADBD (e.g., of the adapter and / or CAR) is an "scFv," which can include a fusion protein comprising an antibody VL chain and a VH chain, where the VH and VL are linked, for example, via a flexible polypeptide linker, e.g., a linker described herein. scFvs can be made according to methods routine in the art (see, e.g., Bird et al., Science 242:423-426 (1988) and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883 (1988)).

[0199] In some embodiments, the ADBD (e.g., of the adaptor and / or CAR) is a single domain antigen binding (SDAB) molecule. SDAB molecules include molecules that contain a complementarity determining region that is part of a single domain polypeptide. Examples include, but are not limited to, heavy chain variable domains, binding molecules that naturally lack light chains, single domains from traditional four-chain antibodies, genetically modified domains other than those derived from antibodies, and single domain scaffolds. SDAB molecules can be from any species, including, but not limited to, mouse, human, camel, llama, fish, shark, goat, rabbit, and cow. The term also includes natural single domain antibody molecules from species other than camelids and sharks.

[0200] In some embodiments, the ADBD (e.g., of the adaptor and / or the CAR) comprises a human antibody or fragment thereof. In some embodiments, the ADBD (e.g., of the adaptor and / or the CAR) comprises a humanized antibody or fragment thereof.

[0201] Antibody humanization is well known in the art and is essentially as described by Winter and co-workers (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988)) by replacing the corresponding sequences of a human antibody with rodent CDRs or CDR sequences, i.e., by CDR grafting (EP 239,400; WO 91 / 09967; and U.S. Pat. Nos. 4,816,567; 6,331,415; 5,225,539; 5,530,101; 5,585,089; and 6,548,640; the contents of which are incorporated herein by reference in their entireties). Humanization of antibodies can also be achieved by veneering or resurfacing (EP 592,106; EP 519,596; Padlan, 1991, Molecular Immunology, 28(4 / 5):489-498; Studnicka et al., Protein Engineering 7(6):805-814 (1994); and Roguska et al., PNAS 91:969-973 (1994)) or chain shuffling (U.S. Pat. No. 5,565,332), the contents of which are incorporated herein by reference in their entireties.

[0202] IIIb. Alternative Scaffold Binding Domains In some embodiments, the ADBD (e.g., of an adaptor and / or a CAR) is an alternative scaffold-binding domain. As used herein, an "alternative scaffold-binding domain" or "ASBD" is an antigenic determinant-binding domain derived from or corresponding to a non-antibody-based binding scaffold.

[0203] In some embodiments, the present disclosure provides a CAR comprising an ADBD that is an ASBD. In some embodiments, the present disclosure provides a cell comprising a CAR comprising an ADBD that is an ASBD. In further embodiments, an immune effector cell comprising a CAR comprising an ASBD is provided. In some embodiments, the present disclosure provides an adaptor comprising an ADBD that is an ASBD.

[0204] In a further embodiment, the present disclosure provides a composition comprising an adaptor and a CAR, each of which comprises an ASBD.

[0205] In some embodiments, the binding of the ASBD (e.g., of the adaptor and / or CAR) to the target AD is mediated by a secondary structure of the binding backbone, such as an alpha helix or a beta sheet. In some embodiments, the ASBD is a three helix bundle-based binding domain. In some embodiments, the ASBD is a D domain-based binding domain. In some embodiments, the ASBD is a Z domain (affibody)-based binding domain.

[0206] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a D-domain (novel binding domain) based AD binding domain. D-domain scaffold based binding domains typically consist of 70-75 amino acid residues, of which substitutions at up to 20 positions corresponding to constrained surface-exposed residues in a non-natural antiparallel three helical bundle reference scaffold (SEQ ID NO: 1) confer target recognition and binding specificity to a target of interest (AD). D-domain scaffold based binding domains are further disclosed in WO2016164308, the contents of which are incorporated herein by reference in their entirety. In one embodiment, the D-domain comprises an amino acid sequence that differs (e.g., by amino acid modification) from that of a reference scaffold having the sequence of SEQ ID NO: 1 by up to 20 substitutions. In some embodiments, the D-domain comprises a sequence selected from the group: SEQ ID NOs: 17, 18, and 19. In some embodiments, the D-domain comprises a sequence selected from the group: SEQ ID NOs: 20-26, and 27. In some embodiments, the D domain comprises a sequence selected from the group: SEQ ID NOs: 44-1078, and 1079.

[0207] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a Z domain scaffold (affibody) based AD binding domain. Z domain scaffold based binding domains typically consist of 58 amino acid residues, in which substitutions at up to 13 positions located in the first and second of three alpha helices confer target (AD) recognition and binding specificity to the target (AD) of interest. In further embodiments, the Z domain ASBD comprises a sequence selected from SEQ ID NOs: 28 and 29. Z domain (affibody) scaffold based binding domains are further described in U.S. Patent No. 5,831,012, the entire contents of which are incorporated herein by reference.

[0208] Additional examples of ASBDs that exhibit secondary structure-mediated target binding include DARPins, affilins, and armadillo repeat-based binding scaffolds.

[0209] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a DARPin-based AD binding domain. A DARPin-based binding domain typically comprises 2-3 repeats of the sequence of SEQ ID NO: 30 between the N- and C-terminal capping repeats (e.g., the sequences MRGSHHHHHHGSDLGKKLLEAARAGQDDEVRILMANGA DVNAX, respectively). 33 (SEQ ID NO: 31) and the sequence QDKFGKTAFDISIDNGNEDLAEILQ (SEQ ID NO: 32), the first Gln is at the consensus repeat position X 33 Each internal repeat contains 27 framework residues and up to six substituted non-framework residues, forming a β-turn followed by two antiparallel helices and a loop connecting the β-turn of the next repeat. The collective substitutions and structure of DARPins confer target (AD) recognition and binding specificity. [Table 1]

[0210] In some embodiments, the binding specificity of the ASBD (e.g., of the adaptor and / or CAR) to the target AD is mediated by amino acids in an exposed loop on the ASBD. Examples of scaffolds with these binding properties include adnectins, lipocalins, avimers, knottins, finomers, atrimers, Kunitz domain-based binders, and CTLA4-based binding scaffolds.

[0211] In some embodiments, the ASBD is an adnectin-based AD binding domain. The adnectin-based binding domain is derived from the 10th domain of fibronectin type III (10Fn3). This ADBD is a 94 amino acid binding domain that typically adopts a beta-sandwich fold with seven chains connected by six loops. Substitutions in three surface-exposed loops on one side of the adnectin domain generate target (AD)-specific binding moieties.

[0212] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a lipocalin-based, affilin-based, or anticalin-based AD-binding domain. The anticalin scaffold exhibits a conserved β-barrel structure composed of eight antiparallel β-strands and typically consists of 160-180 amino acids. The ligand-binding pocket of the anticalin-based binding scaffold is composed of four loops, each containing up to 24 substitutions, which collectively confer target (AD) recognition and binding specificity.

[0213] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is an avimer scaffold-based AD binding domain. Avimer scaffold-based binding domains are derived from the A domain of cell surface receptors and are typically 35 amino acids in length. The structure of the avimer-based binding domain is maintained by 12 conserved amino acids. Substitutions of all of the remaining 23 residues of the binding domain confer target (AD) recognition and binding specificity. In some embodiments, the avimer scaffold-based binding domain has the sequence EFX3CX5NGX8CIPX 12 X 13 WX 15 CDGX 19 DDCGDX 25 SDE, and X is any amino acid (SEQ ID NO: 33). Avimer scaffold-based binding domains are further described in U.S. Patent Application Publication Nos. 20040175756, 20050053973, 20050048512, and 20060008844, each of which is incorporated herein by reference in its entirety.

[0214] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a finomer scaffold-based AD binding domain. A finomer binding domain is typically 60-75 amino acids long and is composed of a pair of antiparallel beta sheets connected by two flexible loops. Substitutions / insertions in the loops confer AD target recognition and binding specificity. In some embodiments, the finomer-based AD binding domain has the sequence GVTLFV ALYDYX 12 X13 X 14 X 15 X 16 X 17 X 18 X 19 X 20 X 21 X 22 LSFHKGEKFQILSTHEYEX 41 X 42 X 43 X 44 X 45 X 46 X 47 X 48 WEARSLTTGETGX 61 X is any amino acid; 13 ~X 21 and X 42 ~X 46 may optionally be absent (SEQ ID NO: 34). In some embodiments, the finomer-based AD binding domain has the sequence GVTLFVALYDYX 12 X 13 X 14 X 15 X 16 X 17 X 18 X 19 X 20 X 21 X 22 X is any amino acid; 16 ~X 21 is optionally absent (SEQ ID NO:35).

[0215] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a knottin scaffold-based AD-binding domain. The knottin scaffold-based binding domain corresponds to a 30 amino acid protein fold composed of three antiparallel β-strands linked by loops of variable length and multiple disulfide bonds.

[0216] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a Kunitz domain-based AD binding domain. Kunitz domain-based binding domains are derived from the active motif of Kunitz-type protease inhibitors and are typically about 60 amino acids in length. The hydrophobic core of this ADBD is composed of a twisted two-stranded antiparallel β-sheet and two α-helices stabilized by three disulfide bond pairs. Substitutions and insertions in the three loops confer AD target recognition and binding specificity. In some embodiments, the Kunitz domain-based AD binding domain has the sequence MHSFCAFKADX 11 GX 13 CX 15 X 16 X 17 X 18 X 19 RFFFNIFTRQCEEFX 34 YGGCX 39 X 40 NQNRFESLEECKKMCTRDGA (SEQ ID NO:36), which is at least 85% identical to this sequence at positions other than X; 11 is one of: A, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; X 13 is one of: A, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; X 15 is one of: A, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; X 16 is one of: A, G, E, D, H, T; X 17 is one of: A, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; X 18 is one of: A, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, Y; X 19 is one of: A, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; X 34 is one of: A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; X 39is one of: A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y; and X 40 is one of: G, and A. Kunitz scaffold-based binding domains are further described in WO2004063337, which is incorporated herein by reference in its entirety.

[0217] In some embodiments, the ASBD (e.g., of the adaptor and / or CAR) is a WW domain-based AD binding domain. The WW domain-based binding scaffold is typically 30-35 amino acids in length. In some embodiments, the WW domain-based AD binding domain has the sequence KLPPGWX7KX9WSX 12 X 13 X 14 GRVX 18 YX 20 NX 22 ITX 25 AX 27 QWERP (SEQ ID NO: 37), 12 , X 13 , X 14 , X 18 , X 20 , X 22 , X 25 , and X 27 is any amino acid, and X 14 is optional and may not be present.

[0218] In some embodiments, the WW domain-based AD binding scaffold has the sequence KLPPGWX7KX9WSX 12 X 13 GRVX 17 YX 19 NX 21 ITX 24 AX 26 QWERP (SEQ ID NO: 38), 12 , X 13 , X 17 , X 19 , X 21 , X 24 , and X 26 is any amino acid, and X 14 is optional and may not be present. [Table 2]

[0219] IV. Linker Linker refers to a peptide or other chemical linking material that connects domains that would otherwise be separate functional domains of an adaptor or CAR.

[0220] Suitable linkers that operably link two or more functional domains of an adaptor in a single amino acid sequence include, but are not limited to, polypeptide linkers such as glycine linkers, serine linkers, mixed glycine / serine linkers, glycine and serine rich linkers, or linkers composed of mostly polar polypeptide fragments.

[0221] In one embodiment, the linker is composed mostly of amino acids selected from glycine, alanine, proline, asparagine, glutamine, and lysine. In one embodiment, the linker or linkers of the adaptor or CAR are composed mostly of amino acids selected from glycine, alanine, proline, asparagine, aspartic acid, threonine, glutamine, and lysine. In one embodiment, the linker or linkers of the adaptor or CAR are composed mostly of amino acids selected from glycine, alanine, proline, asparagine, aspartic acid, threonine, glutamine, and lysine. In another embodiment, the linker or linkers of the adaptor or CAR are composed mostly of amino acids that are sterically unhindered. In another embodiment, the linker is composed mostly of amino acids that are glycine, serine, and / or alanine. In some embodiments, one or more linkers of an adaptor or CAR linker comprises polyglycine (e.g., (Gly)5 (SEQ ID NO: 1099)), and (Gly)8 (SEQ ID NO: 1100), poly(Gly-Ala), and polyalanine. In some embodiments, the peptide linker comprises the sequence Gly-Gly-Gly-Gly-Thr-Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 39). In some embodiments, one or more linkers of an adaptor or CAR comprises the sequence Gly-Gly-Gly-Gly-Asp-Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 40).

[0222] In one embodiment, the adaptor or CAR comprises an ADBD directly attached (i.e., without a linker) to another component of the adaptor or CAR, respectively. In one embodiment, the adaptor or CAR comprises at least two, at least three, at least four, or at least five ADBDs directly attached to another component of the adaptor or CAR, respectively.

[0223] In another embodiment, the ADBD can be operably linked to another component of the adaptor or CAR via a linker. The adaptor or CAR can include a single linker, multiple linkers, or no linker. In one embodiment, the adaptor or CAR comprises an ADBD operably linked to another component of the adaptor or CAR, respectively, via a linker peptide. In one embodiment, the adaptor or CAR comprises at least two, at least three, at least four, or at least five ADBDs operably linked to another domain of the adaptor or CAR, respectively, via the same or different linkers.

[0224] The linker can be of any size or composition so long as it operably links the functional domains of the adaptor or CAR such that the functional domains function (e.g., function in their ability to bind the binding domain to the target). In some embodiments, the linker is about 1 to about 100 amino acids, about 1 to about 50 amino acids, about 1 to about 20 amino acids, about 1 to about 15 amino acids, about 1 to about 10 amino acids, about 1 to about 5 amino acids, about 2 to about 20 amino acids, about 2 to about 15 amino acids, about 2 to about 10 amino acids, or about 2 to about 5 amino acids. It should be clear that the length, degree of flexibility, and / or other properties of the linker may have some effect on the properties of the final polypeptide of the invention, including, but not limited to, affinity, specificity, or avidity for the target or for one or more other target proteins of interest. When more than one linker is used in the adaptor or CAR, these linkers may be the same or different. In the context and disclosure provided herein, a person skilled in the art would be able to routinely determine the optimal linker composition and length for operably linking the functional domains of the adaptor or CAR.

[0225] The linker may also be a non-peptide linker, such as an alkyl linker or a PEG linker. For example, an alkyl linker such as -NH-(CH2)sC(0)- (s=2-20) may be used. These alkyl linkers may be further substituted with non-sterically hindering groups such as lower alkyl (e.g., C1-C6), lower acyl, halogen (e.g., CI, Br), CN, NH2, phenyl, etc. A representative non-peptide linker is a PEG linker. In certain embodiments, the PEG linker has a molecular weight of about 100-5000 kDa, or about 100-500 kDa.

[0226] Suitable linkers for attaching adaptors or CAR functional domains by chemical cross-linking include, but are not limited to, homobifunctional chemical cross-linking compounds such as glutaraldehyde, imidoesters such as dimethyl adipimidate (DMA), dimethyl suberimidate (DMS) and dimethyl pimelimidate (DMP) or N-hydroxysuccinimide (NHS) esters such as dithiobis(succinimidyl propionate) (DSP) and dithiobis(sulfosuccinimidyl propionate) (DTSSP). Examples of suitable linkers for attaching adaptors or CAR functional domains include, but are not limited to, cross-linkers with one amine reactive end and a sulfhydryl reactive moiety at the other end, or cross-linkers with an NHS ester and an SH-reactive group (e.g., maleimide or pyridyl) at one end.

[0227] In further embodiments, one or more linkers of the adaptor or CAR are cleavable. Examples of cleavable linkers include, but are not limited to, various types of peptide sequences recognized by proteases (in vitro or in vivo), such as Tev, thrombin, factor Xa, plasmin (blood protease), metalloproteases, cathepsins (e.g., GFLG, etc.), and proteases found in other body compartments.

[0228] In some embodiments, the linker is a "cleavable linker" that facilitates the release of the adaptor's functional domain or the cytotoxic agent in or on the cell surface. For example, an acid-labile linker (e.g., hydrazone), a protease-sensitive (e.g., peptidase-sensitive) linker, a photolabile linker, a dimethyl linker, or a disulfide-containing linker (see, e.g., Chari, Can. Res. 52:127-131 (1992); U.S. Patent No. 5,208,020; and U.S. Patent Publication No. 20090110753; the contents of which are incorporated herein by reference in their entirety) can be used, and it is desirable for the covalent bond between the adaptor and the cytotoxic agent to be cleaved intracellularly upon internalization of the composition into the cell. The terms "cleaved intracellularly" and "intracellular cleavage" refer to a metabolic process or intracellular reaction on an adapter-drug conjugate whereby the covalent bond, i.e., the bond via the linker, between the adapter and the cytotoxic agent is broken, resulting in free adapter and / or cytotoxic agent separated intracellularly.

[0229] In further embodiments, one or more linkers in the CAR are cleavable. Examples of cleavable linkers include, but are not limited to, various types of peptide sequences recognized by proteases (in vitro or in vivo), such as Tev, thrombin, factor Xa, plasmin (blood protease), metalloproteases, cathepsins (e.g., GFLG, etc.), and proteases found in other body compartments.

[0230] In some embodiments, either domain of the CAR is linked together using a short oligo- or polypeptide linker of about 1-100 amino acids in length. The linker can be composed of flexible residues such as glycine and serine (or any other amino acid) to allow adjacent protein domains to move freely relative to each other. The amino acid sequence composition of the linker can be selected to minimize the possibility of immunogenicity of the CAR. Longer linkers can be used if it is desirable to ensure that two adjacent domains do not sterically interfere with each other.

[0231] In some embodiments, a linker between the transmembrane domain and the cytoplasmic signaling domain of the CAR is preferably 2-10 amino acids in length. In further embodiments, the linker is 10-15 amino acids in length, or 15-20 amino acids in length, or 20-30 amino acids in length, or 30-60 amino acids in length, or 60-100 amino acids in length (or any range in between the lengths listed). In further embodiments, the linker is a glycine-serine doublet sequence. In some embodiments, the ESD corresponds to the human cell surface glycoprotein CD8 alpha chain ESD region (e.g., amino acid residues 138-182 CD8 alpha chain: SwissProt Accession Number P01732). In some embodiments, the ESD corresponds to a CD8 ESD region that has been further modified by amino acid substitution to improve expression function or immunogenicity. In further embodiments, the ESD corresponds to the CD28 ESD or a sequence that includes modifications of the CD28 ESD to confer improved expression function or immunogenicity.

[0232] Linker optimization can be assessed using techniques described herein and / or using other techniques known in the art. In some embodiments, the linker does not interfere with the ability of the adaptor or CAR to bind to a target antigenic determinant and / or the ability of a functional domain of another adaptor or CAR to function properly (e.g., the ability of an effector function domain of the adaptor to trigger an effector function, or the ability of an FcRn binding domain of the adaptor to bind to FcRn).

[0233] V. Adaptor - Soluble Proteins Provided herein are multi-domain soluble adaptor proteins. The adaptor comprises an antigenic determinant (AD) (e.g., as described in Sections II and XI) and an antigenic determinant binding domain (ADBD) (e.g., as described in Sections III and XI). The adaptor can further comprise additional ADs, additional ADBDs, and / or other additional domains.

[0234] In the adaptors provided herein, the AD can be N-terminal to the ADBD. Alternatively, the ADBD can be N-terminal to the AD. In some embodiments, the AD and the ADBD are directly fused. In some embodiments, the AD and the ADBD are fused via a linker (protein linker or chemical linker) or via another protein domain (e.g., a functional domain).

[0235] In some embodiments, the adaptor comprises a linker located between the ADBD and another functional domain of the adaptor. In some embodiments, the linker is located between the two ADBDs of the adaptor. In some embodiments, the linker is located between the AD and the ADBD of the adaptor. Suitable linkers for linking two or more functional domains of the adaptor will be apparent to those of skill in the art and may generally be any linker used in the art for linking peptides, proteins or other organic molecules. Exemplary linkers are provided in Section IV. In certain embodiments, the linker is suitable for constructing proteins or polypeptides intended for pharmaceutical use.

[0236] In addition to an AD (or ADs) and an ADBD (or ADBDs), the adapters provided herein can further comprise an additional domain or additional domains, e.g., a domain that confers extended half-life.

[0237] In some embodiments, the adaptor, or the ADBD in the adaptor, is deimmunized.

[0238] The adapters provided herein have uses including, but not limited to, diagnostic, analytical, and therapeutic uses. In certain embodiments, the adapters are used in combination with a chimeric antigen receptor (CAR) (e.g., as described in Sections VI and XI) expressed on the surface of a cell (e.g., as described in Sections VII and XI) to kill a target cell, for example.

[0239] Va. Antigenic determinant (AD) The adapters provided herein comprise at least one antigenic determinant (AD). In some embodiments, the adapter comprises a single AD. In some embodiments, the adapter comprises two or more ADs. When the adapter comprises two or more ADs, the ADs can be the same or different.

[0240] In the adapters provided herein, the AD can be any AD or combination of multiple ADs (eg, as described in Sections II and XI).

[0241] In some embodiments, the adaptor comprises the extracellular domain of BCMA (e.g., a polypeptide comprising the sequence of SEQ ID NO: 5). In some embodiments, the adaptor comprises between 5 and 25, between 5 and 50, between 5 and 75, between 5 and 100, between 5 and 125, or between 5 and 150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 5.

[0242] In some embodiments, the adaptor comprises an extracellular domain of CD123 (e.g., a polypeptide comprising the sequence of SEQ ID NO: 11). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 11.

[0243] In some embodiments, the adaptor comprises an extracellular domain of CD19 (e.g., a polypeptide comprising the sequence of SEQ ID NO: 2 or 3). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 2 or 3.

[0244] In some embodiments, the adaptor comprises the extracellular domain of CD 20. In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NOs: 6-9, or 10.

[0245] In some embodiments, the adaptor comprises an extracellular domain of CD22 (e.g., a polypeptide comprising the sequence of SEQ ID NO: 41). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 41.

[0246] In some embodiments, the adaptor comprises an extracellular domain of CD37 (e.g., a polypeptide comprising the sequence of SEQ ID NO: 12 or 13). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 12 or 13.

[0247] In some embodiments, the adaptor comprises an extracellular domain of CS1 (e.g., a polypeptide comprising the sequence of SEQ ID NO: 1138). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:1138.

[0248] In some embodiments, the adaptor comprises an extracellular domain of HER2 (e.g., a polypeptide comprising the sequence of SEQ ID NO: 42). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 42.

[0249] In some embodiments, the adaptor comprises an extracellular domain of CD45 (e.g., a polypeptide comprising the sequence of residues 29-766 of SEQ ID NO:1106). In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all of residues 29-766 of SEQ ID NO:1106.

[0250] In some embodiments, the adaptor comprises an extracellular domain of CD26, CD30, CD33, or CD38. In some embodiments, the adaptor comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of the extracellular domain of CD26, CD30, CD33, or CD38.

[0251] In some embodiments, the AD is an epitope of AFP. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO:15.

[0252] In some embodiments, the AD is an epitope of AFP p26. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 16. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of SEQ ID NO: 1117. In further embodiments, the AD comprises amino acid residues of SEQ ID NO: 16, 1117, 1118, 1119, 1120, 1121, 1122, or 1123.

[0253] In some embodiments, the adapter comprises a p26 protein (e.g., a polypeptide comprising the sequence of SEQ ID NO: 16, 1117, 1118, 1119, 1120, 1121, 1122, or 1123). Fusion proteins comprising such p26 sequences have surprisingly been discovered herein to have long serum half-lives. In some embodiments, the adapter has an in vivo plasma half-life of at least 1 hour, at least 2 hours, at least 4 hours, at least 8 hours, at least 16 hours, at least 32 hours, at least 64 hours, or more than 2 hours. In some embodiments, the adapter has an in vivo plasma half-life in mice of at least 1 hour, at least 2 hours, at least 4 hours, at least 8 hours, at least 16 hours, at least 32 hours, at least 64 hours, or more than 65 hours, 1-10 hours, 2-10 hours, 4-10 hours, 6-10 hours, or 6-9 hours. In some embodiments, the adapter has an in vivo plasma half-life in humans of at least 1 hour, at least 2 hours, at least 4 hours, at least 8 hours, at least 16 hours, at least 32 hours, at least 64 hours, or greater than 65 hours, 1-10 hours, 2-10 hours, 4-10 hours, 6-10 hours, or 6-9 hours.

[0254] In some embodiments, the disclosure provides a method of improving the in vivo half-life (e.g., mouse or human) of an adapter comprising a p26 protein (e.g., having a sequence of SEQ ID NO: 16, 1117, 1118, 1119, 1120, 1121, 1122, or 1123). In some embodiments, the adapter comprises one or more target-binding DDpp. In some embodiments, the half-life of the adapter is increased or decreased by substituting or deleting one or more amino acid residues normally found in human p26 protein, or by inserting one or more amino acid residues not normally found in human p26 protein. In another embodiment, the p26 sequence of the adapter is modified by making 1, 2, 3, 5, 5, 10, or 1-20, 1-10, 3-10, or 3-5 amino acid substitutions (conservative and / or non-conservative substitutions), deletions, and / or insertions to increase or decrease the in vivo half-life of the adapter. In a particular embodiment, the amino acid residue corresponding to glutamine (Gln, Q) at position 217 of p26 (SEQ ID NO: 16) is substituted with another amino acid residue. In a further embodiment, the substitution is Gln217Pro. In another embodiment, the p26 sequence of the adapter is modified by deleting 1-150, 1-100, 1-50, 1-25, or 1-10 amino acid residues to increase or decrease the in vivo half-life of the adapter. In a further embodiment, the p26 sequence of the adapter is modified by 1, 2, 3, 5, 5, 10, or 1-20, 1-10, 3-10, or 3-5 amino acid substitutions (conservative and / or non-conservative substitutions), deletions, and / or insertions to increase or decrease the interaction of the adapter with FcRn.

[0255] In some embodiments, the AD (e.g., in the adaptor and / or on the target cell) is an AD present in a naturally occurring protein or other molecule. In some embodiments, the AD is an AD that is endogenous to humans.

[0256] In some embodiments, the AD is an epitope of a human intracellular protein. In further embodiments, the AD is an epitope of a human intracellular protein selected from elastin Tyk2, Jak1, Jak2, Jak3, LCK, ZAP-70, and GRB2. In further embodiments, the AD comprises 5-25, 5-50, 5-75, 5-100, 5-125, or 5-150 amino acid residues, more than 150 amino acid residues, or all amino acid residues of the intracellular protein.

[0257] In some embodiments, the target specifically bound by the ADBD of an adaptor is itself the AD of another adaptor having a different sequence.

[0258] Vb. Antigenic determinant binding domain (ADBD) The adapters provided herein comprise at least one antigenic determinant binding domain (ADBD). In some embodiments, the adapter comprises one ADBD. In some embodiments, the adapter comprises at least 2, 3, 4, or 5, or more than 5 ADBDs. In some embodiments, the adapter comprises 1-3, 1-4, 1-5, or more than 5 different ADBDs. In some embodiments, the adapter comprises at least 2, 3, 4, or 5, or more than 5 different ADBDs. Thus, the adapter may comprise a monomeric ADBD (i.e., comprising one antigenic determinant binding domain) or a multimeric ADBD (i.e., two or more antigenic determinant binding domains operably linked in tandem, optionally with a linker). In some embodiments, the use of a multimeric adapter results in enhanced (e.g., synergistic) target binding. In further embodiments, the use of a multimeric adapter allows for targeting of two or more targets using a single adapter construct (e.g., bispecific, trispecific, etc.).

[0259] Multimeric adaptors are homomultimeric (i.e., comprising two or more of the same ADBDs, optionally linked by a linker) adaptors (e.g., homodimers, homotrimers, homotetramers, etc.) or heteromultimeric (i.e., comprising two or more antigenic determinant binding domains, where at least two distinct antigenic determinant binding domains are present). The number of ADBDs included in any particular adaptor may vary depending on the embodiment and is dictated, at least in part...

Claims

1. A protein comprising a D domain that specifically binds to an AFP p26 polypeptide, wherein the AFP p26 polypeptide consists of the amino acid sequence of SEQ ID NO: 16, 1117, 1118, 1119, 1120, 1121, 1122, or 1123, and the D domain comprises the amino acid sequence of SEQ ID NO: 841-983 or 984.

2. A chimeric antigen receptor (CAR) comprising a target binding domain comprising the protein according to claim 1.

3. The CAR according to claim 2, further comprising a transmembrane domain and an intracellular signaling domain.

4. The CAR according to claim 3, wherein the transmembrane domain comprises a CD8, 41BB, or CD28 transmembrane domain.

5. The CAR according to claim 3, wherein the intracellular signaling domain is selected from the group consisting of domains of the human T cell receptor alpha, beta, or zeta chain, the human 41BB domain, the human CD28 domain, and any combination thereof.

6. The CAR according to claim 3, wherein the intracellular signaling domain is selected from the group consisting of CD27, CD28, 41BB, OX40, CD30, CD40, PD1, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, NKG2D, B7-H3, a ligand that specifically binds to CD83, and any combination thereof.

7. The CAR according to claim 3, wherein the transmembrane domain comprises a CD8 transmembrane domain, and the intracellular signaling domain comprises a human 41BB domain and a human CD3 zeta domain.

8. The CAR according to claim 3, wherein the transmembrane domain and the intracellular signaling domain comprise the amino acid sequence of residues 121-343 of SEQ ID NO: 1136.

9. An isolated nucleic acid encoding the protein according to claim 1.

10. A vector comprising the nucleic acid according to claim 9.

11. The vector according to claim 10, wherein the vector is a lentiviral vector.

12. A host cell comprising the nucleic acid according to claim 9.

13. The cell according to claim 12, wherein the cell is an immune effector cell.

14. The cell according to claim 13, wherein the immune effector cell is a T cell or an NK cell.

15. The protein according to claim 1, wherein the D domain comprises SEQ ID NO: 850, the chimeric antigen receptor according to any one of claims 2 to 8, the isolated nucleic acid according to claim 9, the vector according to claim 10 or 11, and the host cell according to any one of claims 12 to 14.

16. In a patient, target cell death, redirection of target cell death, delivery of an immune response to a target cell, direction of an immune response to a target cell, treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection, redirection of treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection, direction of treatment of a proliferative disorder, cancer, autoimmune disease, infectious disease, or allograft rejection, treatment of hematological cancer, redirection of treatment of hematological cancer, or direction of treatment of hematological cancer for use in an immune effector cell, wherein the immune effector cell is a chimeric antigen receptor (CAR) comprising a D domain that specifically binds to an AFP p26 polypeptide consisting of the amino acid sequence of SEQ ID NO: 16, 1117, 1118, 1119, 1120, 1121, 1122, or 1123, and the D domain comprises the amino acid sequence of SEQ ID NOs: 841 to 983 or 984, and expresses the CAR. immune effector cell.

17. The immune effector cell according to claim 14, wherein the D domain comprises the amino acid sequence of SEQ ID NO: 850.

Images