Cell surface receptors that respond to loss of heterozygosity

Abstract

The present disclosure relates to a system of two engineered receptors, each with a ligand-binding domain, designed to collectively target cells identified by loss of heterozygosity and used to treat a disease or disorder, such as cancer. The present disclosure provides immune cells that express the two engineered receptors, methods for making them, and polynucleotides and vectors encoding them.

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of priority to U.S. Provisional Patent Application No. 62 / 885,093, filed August 9, 2019, and U.S. Provisional Patent Application No. 63 / 005,670, filed April 6, 2020, the entire contents of each of which are incorporated herein by reference.

[0002] INCORPORATION-BY-REFERENCE TO SEQUENCE LISTING This application is filed with an electronic Sequence Listing. The Sequence Listing is provided as a file entitled A2BI-00903WO_SeqList.txt, created on August 5, 2020, and is 404 kilobytes in size. The information in the electronic format of this Sequence Listing is incorporated by reference in its entirety. [Background technology]

[0003] Cell therapy is a powerful tool for the treatment of various diseases, especially cancer. In conventional adoptive cell therapy, immune cells are engineered to express specific receptors, such as chimeric antigen receptors (CARs) or T cell receptors (TCRs), which induce the activation of immune cells against cellular targets through the interaction of the receptor with a ligand expressed by the target cell. Identification of suitable target molecules remains challenging. There is a need in the art for compositions and methods useful for the treatment of diseases, especially cancer, by cell therapy. Summary of the Invention

[0004] The present disclosure generally relates to a two-receptor system expressed in engineered immune cells, e.g., immune cells used in adoptive cell therapy, that can be used to target these immune cells to tumor cells that exhibit loss of heterozygosity. In this two-receptor system, a first receptor acts to activate or promote the activation of the immune cell, while a second receptor acts to inhibit activation by the first receptor. Differential expression of ligands for the first and second receptors, e.g., due to loss of heterozygosity at a locus encoding an inhibitory ligand, mediates activation of the immune cell by target cells that express the first activator ligand but not the second inhibitory ligand. The present disclosure may provide the following: [Section 1] An immune cell, a. an engineered first receptor, the engineered first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to a first ligand; b. an engineered second receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to a second ligand; binding of the first ligand binding domain to the first ligand activates or promotes activation of the immune cell via the first receptor; The immune cell, wherein binding of the second ligand-binding domain to the second ligand inhibits activation of the immune cell by the first receptor. [Section 2] The immune cell of item 1, wherein the second ligand is not expressed in the target cell due to loss of heterozygosity of the gene encoding the second ligand. [Section 3] The immune cell of item 1 or 2, wherein the second ligand is an HLA class I allele or a minor histocompatibility antigen (MiHA). [Section 4] The immune cell of item 1, wherein the second ligand is not expressed in the target cell due to loss of a Y chromosome. [Section 5] The immune cell of item 3, wherein the MiHA is selected from the group of MiHAs in Tables 8 and 9. [Section 6] The immune cell according to item 3, wherein the MiHA is HA-1. [Section 7] The immune cell of item 3, wherein the HLA class I allele comprises HLA-A, HLA-B, or HLA-C. [Section 8] The immune cell according to Item 7, wherein the HLA class I allele is an HLA-A*02 allele. [Section 9] The immune cell of item 4, wherein the second ligand is encoded by a Y chromosome gene. [Section 10] Item 10. The immune cell according to any one of Items 1 to 9, wherein the first ligand and the second ligand are not the same. [Section 11] Item 10. The immune cell according to any one of Items 1 to 9, wherein the first ligand is expressed by a target cell. [Section 12] Item 12. The immune cell according to any one of Items 1 to 11, wherein the first ligand is expressed by a target cell and a plurality of non-target cells. [Section 13] Item 13. The immune cell of Item 12, wherein the plurality of non-target cells express both the first ligand and the second ligand. [Section 14] Item 14. The immune cell according to any one of Items 1 to 13, wherein the second ligand is not expressed by the target cell but is expressed by the plurality of non-target cells. [Section 15] Item 15. The immune cells according to any one of Items 12 to 14, wherein the target cells are cancer cells and the non-target cells are non-cancerous cells. [Section 16] Item 16. The immune cell according to any one of Items 1 to 15, wherein the first ligand is selected from the group consisting of a cell adhesion molecule, an intercellular signaling molecule, an extracellular domain, a molecule involved in chemotaxis, a glycoprotein, a G protein-coupled receptor, a transmembrane protein, a receptor for a neurotransmitter and a voltage-dependent ion channel, or a peptide antigen thereof. [Section 17] Item 16. The immune cell according to any one of Items 1 to 15, wherein the first ligand is a cancer antigen. [Section 18] Item 16. The immune cell according to any one of Items 1 to 15, wherein the first ligand is selected from the group of antigens in Table 5. [Section 19] The immune cell of paragraph 18, wherein the first ligand-binding domain is isolated or derived from the antigen-binding domain of an antibody of Table 5. [Section 20] Item 16. The immune cell according to any one of Items 1 to 15, wherein the first ligand is selected from the group consisting of transferrin receptor (TFRC), epidermal growth factor receptor (EGFR), CEA cell adhesion molecule 5 (CEA), CD19 molecule (CD19), erb-b2 receptor tyrosine kinase 2 (HER2), and mesothelin (MSLN), or peptide antigens thereof. [Section 21] Item 16. The immune cell according to any one of Items 1 to 15, wherein the first ligand is a pan-HLA ligand. [Section 22] Item 16. The immune cell according to any one of Items 1 to 15, wherein the first ligand comprises HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, or HLA-G. [Section 23] Item 23. The immune cell according to any one of Items 1 to 22, wherein the engineered first receptor is a T cell receptor (TCR) or a chimeric antigen receptor (CAR). [Section 24] Item 24. The immune cell according to any one of Items 1 to 23, wherein the engineered second receptor is a T cell receptor (TCR) or a chimeric antigen receptor (CAR). [Section 25] Item 25. The immune cell according to any one of Items 1 to 24, wherein the first ligand-binding domain comprises a single-chain Fv antibody fragment (ScFv) or a β-chain variable domain (Vβ). [Section 26] Item 25. The immune cell according to any one of Items 1 to 24, wherein the first ligand-binding domain comprises a TCR α chain variable domain and a TCR β chain variable domain. [Section 27] Item 25. The immune cell according to any one of Items 1 to 24, wherein the first ligand-binding domain comprises a variable heavy chain (VH) domain and a variable light chain (VL) domain. [Section 28] 26. The immune cell of claim 25, wherein the first ligand is EGFR or a peptide antigen thereof, and the first ligand-binding domain comprises the sequence of SEQ ID NO: 102, SEQ ID NO: 104, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, SEQ ID NO: 118, or SEQ ID NO: 391, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 29] 26. The immune cell of claim 25, wherein the first ligand is MSLN or a peptide antigen thereof, and the first ligand-binding domain comprises the sequence of SEQ ID NO: 86, SEQ ID NO: 88, SEQ ID NO: 90, or SEQ ID NO: 92, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 30] 26. The immune cell of claim 25, wherein the first ligand is CEA or a peptide antigen thereof, and the first ligand-binding domain comprises SEQ ID NO: 94, SEQ ID NO: 96, SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 282, SEQ ID NO: 284, or SEQ ID NO: 286, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 31] 26. The immune cell of clause 25, wherein the first ligand is CD19 or a peptide antigen thereof, and the first ligand-binding domain comprises SEQ ID NO: 275 or SEQ ID NO: 277, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 32] 26. The immune cell of clause 25, wherein the first ligand comprises a pan-HLA ligand and the first ligand binding domain comprises the sequence of SEQ ID NO: 167, SEQ ID NO: 169, SEQ ID NO: 171, SEQ ID NO: 173, SEQ ID NO: 175, or SEQ ID NO: 177, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 33] 28. The immune cell according to any one of items 25 to 27, wherein the first ligand comprises EGFR or a peptide antigen thereof, and the first ligand-binding domain comprises a CDR selected from SEQ ID NOs: 131 to 166. [Section 34] 28. The immune cell according to any one of items 25 to 27, wherein the first ligand comprises a CEA ligand or a peptide antigen thereof, and the first ligand-binding domain comprises a CDR selected from SEQ ID NOs: 294 to 302. [Section 35] Item 35. The immune cell according to any one of Items 1 to 34, wherein the second ligand-binding domain comprises an ScFv or Vβ domain. [Section 36] Item 35. The immune cell according to any one of Items 1 to 34, wherein the second ligand-binding domain comprises a TCR α chain variable domain and a TCR β chain variable domain. [Section 37] Item 35. The immune cell according to any one of Items 1 to 34, wherein the first ligand-binding domain comprises a variable heavy chain (VH) domain and a variable light chain (VL) domain. [Section 38] 37. The immune cell of clause 36, wherein the second ligand comprises HA-1 and the second ligand binding domain comprises a TCR alpha variable domain comprising SEQ ID NO: 199 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto, and a TCR beta variable domain comprising SEQ ID NO: 200 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 39] The immune cell of item 35, wherein the second ligand comprises an HLA-A*02 allele, and the second ligand-binding domain comprises any one of SEQ ID NOs: 53 to 64 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 40] Item 38. The immune cell according to any one of Items 35 to 37, wherein the second ligand comprises an HLA-A*02 allele, and the second ligand-binding domain comprises a CDR selected from SEQ ID NOs: 41 to 52. [Section 41] Item 41. The immune cell of any one of items 1 to 40, wherein the engineered second receptor comprises at least one immunoreceptor tyrosine-based inhibitory motif (ITIM). [Section 42] Item 42. The immune cell according to any one of Items 1 to 41, wherein the engineered second receptor comprises the LILRB1 intracellular domain or a functional variant thereof. [Section 43] 43. The immune cell of claim 42, wherein the LILRB1 intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 76. [Section 44] Item 44. The immune cell of any one of Items 1 to 43, wherein the engineered second receptor comprises a LILRB1 transmembrane domain or a functional variant thereof. [Section 45] The immune cell of paragraph 44, wherein the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 85. [Section 46] Item 46. The immune cell of any one of items 1 to 45, wherein the engineered second receptor comprises a LILRB1 hinge domain or a functional fragment or variant thereof. [Section 47] The immune cell of paragraph 46, wherein the LILRB1 hinge domain comprises a sequence at least 95% identical to SEQ ID NO:84, SEQ ID NO:77, or SEQ ID NO:78. [Section 48] Item 46. The immune cell according to any one of Items 1 to 45, wherein the engineered second receptor comprises a LILRB1 intracellular domain and a LILRB1 transmembrane domain, or a functional variant thereof. [Section 49] 49. The immune cell of paragraph 48, wherein the LILRB1 intracellular domain and the LILRB1 transmembrane domain comprise SEQ ID NO: 80 or a sequence at least 95% identical to SEQ ID NO: 80. [Section 50] 46. ​​The immune cell of any one of items 1 to 45, wherein the engineered second receptor comprises a first polypeptide comprising SEQ ID NO:80, or a sequence at least 95% identical thereto, fused to a TCR alpha variable domain, and a second polypeptide comprising SEQ ID NO:80, or a sequence at least 95% identical thereto, fused to a TCR beta variable domain. [Section 51] Item 51. The immune cell according to any one of Items 1 to 50, wherein the first receptor and the second receptor are expressed on the surface of the immune cell at a ratio of the first receptor to the second receptor of about 1:10 to 10:1. [Section 52] Item 51. The immune cell according to any one of Items 1 to 50, wherein the first receptor and the second receptor are expressed on the surface of the immune cell at a ratio of the first receptor to the second receptor of about 1:3 to 3:1. [Section 53] Item 53. The immune cell according to any one of Items 1 to 52, wherein the immune cell is selected from the group consisting of T cells, B cells, and natural killer (NK) cells. [Section 54] Item 10. The immune cell of any one of the preceding items, wherein the immune cell is non-naturally occurring. [Section 55] Item 10. The immune cell of any one of the preceding items, wherein the immune cell is isolated. [Section 56] Item 10. The immune cell of any one of the preceding items for use as a medicament. [Section 57] Item 57. The immune cell according to Item 56, wherein the medicament is intended to treat cancer in a subject. [Section 58] A pharmaceutical composition comprising a plurality of immune cells according to any one of items 1 to 57. [Section 59] Item 59. The pharmaceutical composition of item 58, comprising a pharmaceutically acceptable carrier, diluent or excipient. [Section 60] 60. The pharmaceutical composition of paragraph 58 or 59, comprising a therapeutically effective amount of the immune cells. [Section 61] A method for increasing the specificity of adoptive cell therapy in a subject, the method comprising administering to the subject a plurality of immune cells according to any one of items 1 to 57 or a pharmaceutical composition according to any one of items 58 to 60. [Section 62] A method for treating cancer using adoptive cell therapy, comprising administering to a subject a plurality of immune cells according to any one of items 1 to 57 or a pharmaceutical composition according to any one of items 58 to 60. [Section 63] 63. The method of paragraph 62, wherein cells of the cancer express the first ligand. [Section 64] 64. The method of any one of paragraphs 62 or 63, wherein cells of the cancer do not express the second ligand due to loss of heterozygosity or loss of the Y chromosome. [Section 65] Item 65. The method according to any one of Items 62 to 64, wherein the non-target cells express both the first ligand and the second ligand. [Section 66] A method for producing immune cells according to any one of items 1 to 57, a. providing a plurality of immune cells; b. transforming the immune cells with a vector encoding a first engineered receptor comprising a transmembrane region and an extracellular region comprising a first ligand binding domain capable of specifically binding a first ligand, and a vector encoding a second engineered receptor comprising a transmembrane region and an extracellular region comprising a second ligand binding domain capable of specifically binding a second ligand; binding of the first ligand-binding domain to the first ligand activates or promotes activation of the immune cell; The method, wherein binding of the second ligand binding domain to the second ligand inhibits activation of the immune cell by the first ligand. [Section 67] A kit comprising the immune cell according to any one of Items 1 to 57 or the pharmaceutical composition according to any one of Items 58 to 60. [Section 68] Item 68. The kit of Item 67, further comprising instructions for use. [Section 69] An inhibitory receptor comprising an extracellular ligand-binding domain capable of specifically binding to the HA-1 minor histocompatibility antigen (MiHA) and an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibition motif (ITIM). [Section 70] 70. The inhibitory receptor of paragraph 69, wherein the extracellular ligand-binding domain has a higher affinity for the HA-1(H) peptide of VLHDDLLEA (SEQ ID NO: 191) than for the HA-1(R) peptide of VLRDDLLEA (SEQ ID NO: 266). [Section 71] 70. The inhibitory receptor of paragraph 69, wherein the inhibitory receptor is activated by the HA-1(H) peptide of VLHDDLLEA (SEQ ID NO: 191) and is not activated, or is activated to a lesser extent, by the HA-1(R) peptide of VLRDDLLEA (SEQ ID NO: 266). [Section 72] 72. The inhibitory receptor of any one of paragraphs 69 to 71, wherein the extracellular ligand-binding domain comprises a TCR alpha variable domain comprising SEQ ID NO: 199 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto, and a TCR beta variable domain comprising SEQ ID NO: 200 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 73] 72. The inhibitory receptor of any one of items 69 to 71, wherein the extracellular ligand-binding domain comprises a TCR alpha variable domain comprising SEQ ID NO:199 and a TCR beta variable domain comprising SEQ ID NO:200. [Section 74] Item 72. The inhibitory receptor according to any one of Items 69 to 71, wherein the intracellular domain comprises a LILRB1 intracellular domain or a functional variant thereof. [Section 75] 75. The inhibitory receptor of paragraph 74, wherein the LILRB1 intracellular domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO:76. [Section 76] Item 76. The inhibitory receptor according to any one of Items 69 to 75, wherein the inhibitory receptor comprises a LILRB1 transmembrane domain or a functional variant thereof. [Section 77] 77. The inhibitory receptor of paragraph 76, wherein the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO:85. [Section 78] Item 78. The inhibitory receptor according to any one of Items 69 to 77, wherein the inhibitory receptor comprises a LILRB1 intracellular domain and a LILRB1 transmembrane domain, or a functional variant thereof. [Section 79] 79. The inhibitory receptor of paragraph 78, wherein the LILRB1 intracellular domain and the LILRB1 transmembrane domain comprise SEQ ID NO:80, or a sequence at least 95% identical to SEQ ID NO:80. [Section 80] 80. The inhibitory receptor of claim 79, wherein the inhibitory receptor comprises a first polypeptide comprising SEQ ID NO: 80 or a sequence at least 95% identical thereto fused to a TCR alpha variable domain, and a second polypeptide comprising SEQ ID NO: 80 or a sequence at least 95% identical thereto fused to a TCR beta variable domain. [Section 81] 81. The inhibitory receptor of any one of Items 69 to 80, comprising SEQ ID NO: 195 or a polypeptide at least 95% identical thereto and SEQ ID NO: 197 or a polypeptide at least 95% identical thereto. [Section 82] An immune cell, a. an engineered first receptor, the engineered first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand binding domain capable of specifically binding to a CD19 ligand; b. an engineered second receptor, comprising a transmembrane region and an extracellular region, wherein the extracellular region comprises a second ligand-binding domain capable of specifically binding to an HLA-A*02 allele; binding of the first ligand binding domain to the CD19 ligand activates or promotes activation of the immune cell by the first receptor; The immune cell, wherein binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor. [Section 83] 83. The immune cell of claim 82, wherein the second ligand-binding domain comprises any one of SEQ ID NOs: 53 to 64 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 84] 83. The immune cell of Item 82, wherein the second ligand-binding domain comprises a CDR selected from SEQ ID NOs: 41 to 52. [Section 85] 85. The immune cell of any one of items 82 to 84, wherein the first ligand-binding domain comprises SEQ ID NO: 275 or SEQ ID NO: 277, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 86] 86. The immune cell of any one of paragraphs 82 to 85, wherein the engineered second receptor comprises an intracellular domain isolated or derived from LILRB1. [Section 87] An immune cell, a. an engineered first receptor, the engineered first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to an EGFR ligand; b. an engineered second receptor, comprising a transmembrane region and an extracellular region, wherein the extracellular region comprises a second ligand-binding domain capable of specifically binding to an HLA-A*02 allele; binding of the first ligand-binding domain to the EGFR ligand activates or promotes activation of the immune cell by the first receptor; The immune cell, wherein binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor. [Section 88] 88. The immune cell of clause 87, wherein the first ligand binding domain comprises the sequence of SEQ ID NO: 102, SEQ ID NO: 104, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, SEQ ID NO: 118, or SEQ ID NO: 391, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 89] 88. The immune cell of Item 87, wherein the first ligand-binding domain comprises a CDR selected from SEQ ID NOs: 131 to 166. [Section 90] 89. The immune cell of any one of paragraphs 87 to 89, wherein the second ligand-binding domain comprises any one of SEQ ID NOs: 53 to 64 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 91] Item 89. The immune cell of any one of Items 87 to 89, wherein the second ligand-binding domain comprises a CDR selected from SEQ ID NOs: 41 to 52. [Section 92] 92. The immune cell of any one of paragraphs 87 to 91, wherein the engineered second receptor comprises an intracellular domain isolated or derived from LILRB1. [Section 93] An immune cell, a. an engineered first receptor, the engineered first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to a mesothelin (MSLN) ligand; b. an engineered second receptor, comprising a transmembrane region and an extracellular region, wherein the extracellular region comprises a second ligand-binding domain capable of specifically binding to an HLA-A*02 allele; binding of the first ligand-binding domain to the MSLN ligand activates or promotes activation of the immune cell via the first receptor; The immune cell, wherein binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor. [Section 94] 94. The immune cell of clause 93, wherein the first ligand-binding domain comprises the sequence of SEQ ID NO: 86, SEQ ID NO: 88, SEQ ID NO: 90, or SEQ ID NO: 92, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 95] 95. The immune cell of claim 93 or 94, wherein the second ligand-binding domain comprises any one of SEQ ID NOs: 53 to 64 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. [Section 96] 95. The immune cell of item 93 or 94, wherein the second ligand-binding domain comprises a CDR selected from SEQ ID NOs: 41 to 52. [Section 97] 97. The immune cell of any one of paragraphs 93 to 96, wherein the engineered second receptor comprises an intracellular domain isolated or derived from LILRB1. [Section 98] A pharmaceutical composition comprising a plurality of immune cells according to any one of Items 82 to 97. [Section 99] A method for treating cancer using adoptive cell therapy, comprising administering to a subject a plurality of immune cells according to any one of items 82 to 97 or the pharmaceutical composition according to item 98. [Section 100] 100. The method of paragraph 99, wherein cells of the cancer express the first ligand. [Section 101] 101. The method of paragraph 99 or 100, wherein cells of the cancer do not express the second ligand due to loss of heterozygosity or loss of the Y chromosome. [Section 102] Item 102. The method according to any one of Items 99 to 101, wherein non-target cells express both the first ligand and the second ligand.

[0005] The present disclosure provides immune cells comprising: (a) a first engineered receptor, the first engineered receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to a first ligand; and (b) a second engineered receptor, the second engineered receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to a second ligand, wherein binding of the first ligand-binding domain to the first ligand activates or promotes activation of the immune cell by the receptor, and binding of the second ligand-binding domain to the second ligand inhibits activation of the immune cell by the first receptor.

[0006] In some embodiments of the immune cells of the present disclosure, the second ligand is not expressed in the target cell due to loss of heterozygosity of the gene encoding the second ligand. In some embodiments, the second ligand is an HLA class I allele or a minor histocompatibility antigen (MiHA).

[0007] In some embodiments of the immune cells of the present disclosure, the second ligand is MiHA. In some embodiments, the MiHA is selected from the group of MiHAs in Tables 8 and 9. In some embodiments, the MiHA is HA-1.

[0008] In some embodiments of the immune cells of the present disclosure, the second ligand is an HLA class I allele. In some embodiments, the HLA class I allele comprises HLA-A, HLA-B, or HLA-C. In some embodiments, the HLA class I allele is an HLA-A*02 allele.

[0009] In some embodiments of the immune cells of the present disclosure, the second ligand is not expressed in the target cell due to loss of the Y chromosome. In some embodiments, the second ligand is encoded by a Y chromosome gene.

[0010] In some embodiments of the immune cells of the present disclosure, the first ligand and the second ligand are not the same. In some embodiments, the first ligand is expressed by the target cell. In some embodiments, the first ligand is expressed by the target cell and a non-target cell. In some embodiments, the second ligand is not expressed by the target cell but is expressed by a plurality of non-target cells. In some embodiments, a plurality of non-target cells express both the first and second ligands.

[0011] In some embodiments, the target cells are cancer cells and the non-target cells are non-cancerous cells.

[0012] In some embodiments of the immune cells of the present disclosure, the first ligand is selected from the group consisting of cell adhesion molecules, intercellular signaling molecules, extracellular domains, molecules involved in chemotaxis, glycoproteins, G protein-coupled receptors, transmembrane proteins, neurotransmitter receptors, and voltage-gated ion channels. In some embodiments, the first ligand is selected from the group of antigens in Table 5. In some embodiments, the first ligand is selected from the group consisting of transferrin receptor (TFRC), epidermal growth factor receptor (EGFR), CEA cell adhesion molecule 5 (CEA), CD19 molecule (CD19), erb-b2 receptor tyrosine kinase 2 (HER2), and mesothelin (MSLN) or peptide antigens thereof. In some embodiments, the first ligand comprises HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, or HLA-G. In some embodiments, the first ligand is a pan-HLA ligand.

[0013] In some embodiments of the immune cells of the present disclosure, the second ligand is selected from the group consisting of an HLA class I allele, a minor histocompatibility antigen (MiHA), and a Y chromosome gene. In some embodiments, expression of the second ligand is lost in the target cell due to loss of heterozygosity. In some embodiments, the MiHA is HA-1. In some embodiments, the HLA class I allele is an HLA-A*02 allele.

[0014] In some embodiments of the immune cells of the present disclosure, the engineered first receptor is a T cell receptor (TCR) or a chimeric antigen receptor (CAR). In some embodiments, the engineered second receptor is a T cell receptor (TCR) or a chimeric antigen receptor (CAR).

[0015] In some embodiments of the immune cells of the disclosure, the first ligand-binding domain comprises a single-chain Fv antibody fragment (ScFv), a beta chain variable domain (Vβ), a TCR alpha chain variable domain and a TCR beta chain variable domain, or a variable heavy chain (VH) domain and a variable light chain (VL) domain. In some embodiments, the second ligand-binding domain comprises an ScFv, a Vβ domain, a TCR alpha chain variable domain and a TCR beta chain variable domain, or a variable heavy chain (VH) domain and a variable light chain (VL) domain.

[0016] In some embodiments of the immune cells of the present disclosure, the first ligand is EGFR or a peptide antigen thereof. In some embodiments, the first ligand-binding domain comprises the sequence of SEQ ID NO: 102, SEQ ID NO: 104, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, SEQ ID NO: 118, or SEQ ID NO: 391, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the first ligand-binding domain comprises a CDR selected from SEQ ID NOs: 131-166.

[0017] In some embodiments of the immune cells of the present disclosure, the first ligand is MSLN or a peptide antigen thereof. In some embodiments, the first ligand-binding domain comprises the sequence of SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, or SEQ ID NO:92, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

[0018] In some embodiments of the immune cells of the present disclosure, the first ligand is CEA or a peptide antigen thereof. In some embodiments, the first ligand-binding domain comprises SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:282, SEQ ID NO:284, or SEQ ID NO:286, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the first ligand-binding domain comprises a CDR selected from SEQ ID NOs:294-302.

[0019] In some embodiments of the immune cells of the present disclosure, the first ligand is CD19 or a peptide antigen thereof, and the first ligand binding domain comprises SEQ ID NO:275 or SEQ ID NO:277, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

[0020] In some embodiments of the immune cells of the present disclosure, the first ligand is a pan-HLA ligand. In some embodiments, the first ligand-binding domain comprises the sequence of SEQ ID NO: 167, SEQ ID NO: 169, SEQ ID NO: 171, SEQ ID NO: 173, SEQ ID NO: 175, or SEQ ID NO: 177, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

[0021] In some embodiments of the immune cells of the disclosure, the second ligand comprises HA-1. In some embodiments, the second ligand binding domain comprises a TCR alpha variable domain comprising SEQ ID NO:199, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto, and a TCR beta variable domain comprising SEQ ID NO:200, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the second ligand binding domain comprises a TCR alpha variable domain comprising SEQ ID NO:199, and a TCR beta variable domain comprising SEQ ID NO:200.

[0022] In some embodiments of the immune cells of the present disclosure, the second ligand comprises an HLA-A*02 allele. In some embodiments, the second ligand-binding domain comprises any one of SEQ ID NOs: 53-64 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the second ligand-binding domain comprises a CDR selected from SEQ ID NOs: 41-52.

[0023] In some embodiments of the immune cells of the present disclosure, the engineered second receptor comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM).

[0024] In some embodiments of the immune cells of the present disclosure, the engineered second receptor comprises a LILRB1 intracellular domain or a functional variant thereof. In some embodiments, the LILRB1 intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:76. In some embodiments, the engineered second receptor comprises a LILRB1 transmembrane domain or a functional variant thereof. In some embodiments, the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO:85. In some embodiments, the engineered second receptor comprises a LILRB1 hinge domain or a functional fragment or variant thereof. In some embodiments, the LILRB1 hinge domain comprises a sequence at least 95% identical to SEQ ID NO:84, SEQ ID NO:77, or SEQ ID NO:78. In some embodiments, the engineered second receptor comprises a LILRB1 intracellular domain and a LILRB1 transmembrane domain, or a functional variant thereof. In some embodiments, the LILRB1 intracellular domain and a LILRB1 transmembrane domain comprise SEQ ID NO:80 or a sequence at least 95% identical to SEQ ID NO:80. In some embodiments, the second engineered receptor comprises a first polypeptide comprising SEQ ID NO:80, or a sequence at least 95% identical thereto, fused to a TCR alpha variable domain, and a second polypeptide comprising SEQ ID NO:80, or a sequence at least 95% identical thereto, fused to a TCR beta variable domain.

[0025] In some embodiments of the immune cells of the present disclosure, the first and second receptors are expressed on the surface of the immune cell at a ratio of about 1:10 to 10:1 of the first receptor to the second receptor. In some embodiments, the first and second receptors are expressed on the surface of the immune cell at a ratio of about 1:3 to 3:1 of the first receptor to the second receptor. In some embodiments, the first and second receptors are expressed on the surface of the immune cell at a ratio of about 1:1.

[0026] In some embodiments of the immune cells of the present disclosure, the immune cells are selected from the group consisting of T cells, B cells, and natural killer (NK) cells. In some embodiments, the immune cells are non-naturally occurring. In some embodiments, the immune cells are isolated.

[0027] The present disclosure provides immune cells expressing the two-receptor system of the present disclosure for use as a medicament. In some embodiments, the medicament is for use in the treatment of cancer.

[0028] The present disclosure provides pharmaceutical compositions comprising the immune cells of the present disclosure. In some embodiments, the pharmaceutical compositions comprise a pharmaceutically acceptable carrier, diluent, or excipient. In some embodiments, the pharmaceutical compositions comprise a therapeutically effective amount of the immune cells.

[0029] The present disclosure provides a method of increasing the specificity of adoptive cell therapy in a subject, the method comprising administering to the subject a plurality of immune cells or pharmaceutical compositions of the present disclosure.

[0030] The present disclosure provides a method of treating cancer in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of an immune cell or pharmaceutical composition of the disclosure.

[0031] In some embodiments of the disclosed methods, the subject has cancer. In some embodiments, the cells of the cancer express the first ligand. In some embodiments, the cells of the cancer do not express the second ligand due to loss of heterozygosity or loss of the Y chromosome.

[0032] The present disclosure provides a method of producing an immune cell of the present disclosure, the method comprising: (a) providing a plurality of immune cells; and (b) transforming the immune cells with a vector encoding an engineered first receptor, the first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to a first ligand, and a vector encoding an engineered second receptor, the second receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to a second ligand, wherein binding of the first ligand-binding domain to the first ligand activates or promotes activation of the immune cell, and binding of the second ligand to the second ligand inhibits activation of the immune cell by the first ligand.

[0033] The present disclosure provides kits comprising the immune cells or pharmaceutical compositions of the present disclosure.

[0034] The present disclosure provides inhibitory receptors comprising an extracellular ligand-binding domain capable of specifically binding to the HA-1 minor histocompatibility antigen (MiHA) and an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibitory motif (ITIM).

[0035] In some embodiments of the inhibitory receptor of the present disclosure, the extracellular ligand-binding domain has a higher affinity for the HA-1(H) peptide of VLHDDLLEA (SEQ ID NO: 191) than for the HA-1(R) peptide of VLRDDLLEA (SEQ ID NO: 266). In some embodiments, the inhibitory receptor is activated by the HA-1(H) peptide of VLHDDLLEA (SEQ ID NO: 191) and is not activated, or activated to a lesser extent, by the HA-1(R) peptide of VLRDDLLEA (SEQ ID NO: 266). In some embodiments, the extracellular ligand-binding domain comprises a TCR alpha variable domain comprising SEQ ID NO: 199, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto, and a TCR beta variable domain comprising SEQ ID NO: 200, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the extracellular ligand binding domain comprises a TCR alpha variable domain comprising SEQ ID NO:199 and a TCR beta variable domain comprising SEQ ID NO:200.

[0036] In some embodiments of the inhibitory receptor of the present disclosure, the intracellular domain comprises a LILRB1 intracellular domain or a functional variant thereof. In some embodiments, the LILRB1 intracellular domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 76. In some embodiments, the inhibitory receptor comprises a LILRB1 transmembrane domain or a functional variant thereof. In some embodiments, the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 85. In some embodiments, the inhibitory receptor comprises a LILRB1 intracellular domain and a LILRB1 transmembrane domain, or a functional variant thereof. In some embodiments, the LILRB1 intracellular domain and the LILRB1 transmembrane domain comprise SEQ ID NO: 80, or a sequence at least 95% identical to SEQ ID NO: 80. In some embodiments, the inhibitory receptor comprises a first polypeptide comprising SEQ ID NO: 80, or a sequence at least 95% identical thereto, fused to a TCR alpha variable domain, and a second polypeptide comprising SEQ ID NO: 80, or a sequence at least 95% identical thereto, fused to a TCR beta variable domain. In some embodiments, the inhibitory receptor comprises SEQ ID NO:195, or a polypeptide at least 95% identical thereto, and SEQ ID NO:197, or a polypeptide at least 95% identical thereto.

[0037] The present disclosure provides immune cells comprising: (a) an engineered first receptor, the first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to a CD19 ligand; and (b) an engineered second receptor, the second receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to an HLA-A*02 allele, wherein binding of the first ligand-binding domain to the CD19 ligand activates or promotes activation of the immune cell by the first receptor, and binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor.

[0038] The present disclosure provides immune cells comprising: (a) an engineered first receptor, the first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to an EGFR ligand; and (b) an engineered second receptor, the second receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to an HLA-A*02 allele, wherein binding of the first ligand-binding domain to the EGFR ligand activates or promotes activation of the immune cell by the first receptor, and binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor.

[0039] The present disclosure provides immune cells comprising: (a) an engineered first receptor, the engineered first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to a mesothelin (MSLN) ligand; and (b) an engineered second receptor, the engineered second receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to an HLA-A*02 allele, wherein binding of the first ligand-binding domain to the MSLN ligand activates or promotes activation of the immune cell by the first receptor, and binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor.

[0040] A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings in which: [Brief explanation of the drawings]

[0041] [Figure 1]A schematic diagram showing hemizygous tumor cells forming tumors against a background of heterozygous cells that make up normal tissue. Hemizygous tumor cells express only target A and have lost target B by loss of heterozygosity (LOH), while normal cells express both targets A and B. This genetic difference can be exploited to create tumor-selective cytotoxic therapeutics that are blocked by target B and activated by target A, thereby selectively killing tumors. [Figure 2A] 1 is a schematic diagram showing an exemplary architecture of LOH-based dual-target therapy in tumors, where there is cell-based integration of activator and blocker signals. [Figure 2B] 1 is a series of diagrams showing various activator and receptor formats and combinations. [Figure 3A] 1 is a pair of schematic diagrams showing an exemplary dual receptor construct of the present disclosure in a TCR format, in which the activator and inhibitor (blocker) LBDs are each separately fused to the CD3 gamma subunit of the TCR. [Figure 3B] 1 is a diagram and table showing exemplary dual receptor constructs of the present disclosure in a CAR format. Exemplary ITIM and inhibitor domains of inhibitor CARs are shown in the table on the right. [Figure 4A] Plot showing RNA-Seq expression of transferrin receptor (TFRC) in human tissues from the GTEx database. Transferrin receptor (TFRC) is a candidate target A (activator). Expression of TFRC at the RNA level is ubiquitous and relatively uniform. TRFC is an essential gene, and homozygous loss-of-function mutations are embryonic lethal in mice. [Figure 4B] 1 is a plot showing RNA-Seq expression profiles of HLA-A and HLA-B. [Figure 5A] Figure 1 shows that LIR-1 blockers are modular and mediate large EC50 shifts. Schematic of T2-Jurkat experiments for evaluating blocker constructs. [Figure 5B]Figure 1 shows that LIR-1 blockers are modular and mediate large EC50 shifts. Figure 1 shows the effect of various NY-ESO-1 scFv LBD blocker modules (PD-1, CTLA-4, LIR-1) on the EC50 of MAGE-A3 CAR activator (MP1-CAR) when loaded with NY-ESO-1 blocker peptide. Error bars represent ±SD (n=2). [Figure 5C] Figure 1 shows that LIR-1 blockers are modular and mediate large EC50 shifts. Figure 1 shows the effect of LIR-1 blocker modules with various scFv LBDs (ESO, MP1 LBD1, MP1 LBD2, HPV E6 LBD1, HPV E6 LBD2, HPV E7) on the EC50 of MAGE-A3 CAR activator (MP1-CAR) when loaded with the corresponding peptide. Error bars indicate ±SD (n=2). [Figure 5D] Figure 1 shows that LIR-1 blockers are modular and mediate large EC50 shifts. Figure 1 shows the effect of the LIR-1 blocker module with NY-ESO-1 scFv LBD on the EC50 of different MAGE-A3 CAR activators (MP1-CAR or MP2-CAR) when loaded with NY-ESO-1 blocker peptide. Error bars indicate ±SD (n=2). [Figure 5E] This shows that LIR-1 blockers are modular and mediate large EC50 shifts. The effect of the LIR-1 blocker module with the NY-ESO-1 scFv LBD on the EC50 of different TCR activators (MP1-TCR, MP2-TCR, HPV E6-TCR) when loaded with the NY-ESO-1 blocker peptide is shown. Error bars represent ±SD (n=2). Three different TCR activators are blocked by NY-ESO-LIR-1 with the ESO scFv, LIR-1 hinge, LIR-1 TM, and LIR-1 ICD. [Figure 5F]This shows that the LIR-1 blocker has a modular structure and mediates a large EC50 shift. The effect of the LIR-1 blocker module with the NY-ESO-1 Ftcr LBD on the EC50 of MAGE-A3 CAR and TCR activators (MP1-CAR, MP1-TCR) is shown. Error bars indicate ±SD (n=2). Both third-generation CAR activators and conventional TCR activators can be blocked by NY-ESO-1 Ftcr-LIR-1, which has the TCRa ECD, LIR-1 TM, LIR-1 ICD, and TCRb ECD, LIR-1 TM, and LIR-1 ICD. [Figure 5G] We show that the LIR-1 blocker is modular and mediates a large EC50 shift. Co-incubation of Jurkat cells transfected with either HPV E7-CAR or HPV E7-CAR and A2-LIR-1 with beads displaying various ratios of activator (HPV E7) and blocker (NY-ESO-1) antigens shows blocking in cis but not in trans. [Figure 5H] Figure 1 shows that the LIR-1 blocker is modular and mediates a large EC50 shift. Figure 2 shows that the A2-LIR-1 blocker module blocks CD19-CAR activators at various activator to blocker ratios. E:T ratio: effector:target ratio. [Figure 6A] We show that primary T cells expressing LIR-1 blockers selectively kill tumor cells containing pMHC and non-pMHC proof-of-concept targets. We show that primary T cells transduced with HPV E7-TCR activators and ESO-LIR-1 blockers shift the EC50 by approximately 100-fold in a primary T cell killing assay. Error bars represent + / - SD (n=2). [Figure 6B] 1 shows that HLA-A*02-LIR-1 blocks NY-ESO-1 CAR activator at various activator:blocker DNA ratios in Jurkat cells. [Figure 6C]We demonstrate that primary T cells expressing LIR-1 blockers selectively kill tumor cells, including pMHC and non-pMHC proof-of-concept targets. We demonstrate that primary T cells transduced with a CD19 CAR activator and an HLA-A*02 blocker distinguish "tumor" from "normal" cells in an in vitro cytotoxicity assay and demonstrate selective killing of "tumor" cells with an E:T ratio of 3:1 in a mixed target cell assay. LIR-1-based receptor with A2-LIR-1:HLA-A2*02 LBD. [Figure 6D] We show that primary T cells expressing LIR-1 blockers selectively kill tumor cells, including pMHC and non-pMHC proof-of-concept targets. We show that primary T cells transduced with a CD19 CAR activator and an HLA-A*02 blocker demonstrate reversible blocking after three rounds of antigen exposure (AB-A-AB and A-AB-A) at a 3:1 E:T ratio in an in vitro cytotoxicity assay. The primary T cell cytotoxicity assay was replicated in three HLA-A*02-negative donors. [Figure 6E] We show that primary T cells expressing LIR-1 blockers selectively kill tumor cells, including pMHC and non-pMHC proof-of-concept targets. We show that primary T cells transduced with a CD19 CAR activator and an HLA-A*02 blocker demonstrate reversible activation after three rounds of antigen exposure (AB-A-AB and A-AB-A) at a 3:1 E:T ratio in an in vitro cytotoxicity assay. The primary T cell cytotoxicity assay was replicated in three HLA-A*02-negative donors. [Figure 7A] We show that modified CAR-T cells (i.e., CAR-T cells expressing both activator and blocker receptors) selectively kill tumors in xenograft models. We show that primary T cells transduced with a CD19 CAR activator and an HLA-A*02 blocker demonstrate approximately 20-fold expansion with CD3 / 28 stimulation over 10 days. [Figure 7B]We demonstrate that engineered CAR-T cells (i.e., CAR-T cells expressing both activator and blocker receptors) selectively kill tumors in xenograft models. A schematic diagram of the in vivo study design is shown below: HLA-A*02 NSG mice were subcutaneously injected with either tumor cells (A2-negative Raji cells) or normal cells (A2-positive Raji cells), and when Raji xenografts averaged approximately 70 mm3, primary T cells (human, HLA-A*02-negative donor) were injected via the tail vein. [Figure 7C] Figure 1 shows that modified CAR-T cells (i.e., CAR-T cells expressing both activator and blocker receptors) selectively kill tumors in xenograft models. Tumor size readings by caliper measurement are shown. Error bars are standard error of the mean (sem). UTD: untransduced. [Figure 7D] Figure 1 shows that modified CAR-T cells (i.e., CAR-T cells expressing both activator and blocker receptors) selectively kill tumors in xenograft models. Flow cytometric readings of human blood T cell counts are shown. Error bars are standard error of the mean (sem). UTD: untransduced. [Figure 7E] Figure 1 shows that modified CAR-T cells (i.e., CAR-T cells expressing both activator and blocker receptors) selectively kill tumors in xenograft models. Engraftment readouts are shown. Error bars are standard error of the mean (sem). UTD: untransduced. [Figure 8] The peptide loading shift in activation EC50 is typically less than about 10-fold. The effect of blocker peptide loading (50 uM each of NY-ESO-1, MAGE-A3, HPV E6, and HPV E7) on activated MAGE-A3 CAR (MP2 CAR) is shown. [Figure 9]Figure 1 shows that the LIR-1 blocker module is ligand dependent. The effect of NY-ESO-1-LIR-1 blocker on the EC50 of activated MAGE-A3 CAR (MP1-CAR) when loaded with various concentrations of NY-ESO-1 blocker peptide is shown. [Figure 10] Shown is the effect of modified LIR-1 blocker modules with NY-ESO-1 scFv LBDs containing no ICD (blue) or mutated ICDs (purple) on the EC50 of MAGE-A3 CAR activator (MP2-CAR) when loaded with 10 uM NY-ESO-1 blocker peptide, demonstrating that blockers with no ICD or mutated, non-functional ICDs do not block activation. [Figure 11] We show that CD19 activates Jurkat cells and A2-LIR-1 blocks Jurkat activation in HLA-A*02+ (A2+) Raji cells. Jurkat cells transfected with either CD19 or CD19 and A2-LIR-1 were cocultured with either WT (A2-) Raji cells or A2+ Raji cells at various cell ratios. [Figure 12]

[0023] Figure 1 shows four panels showing the correlation between hCD3+ T cells in mouse blood and tumor growth. Graphs of hCD3+ T cells compared to tumor volume 10 and 17 days after T cell injection using A2- and A2+ Raji cells are shown. [Figure 13] We show that Jurkat cells expressing an EGFR CAR activator and an HLA-A*02 LIR-1 blocker are activated by EGFR+ / HLA-A*02- HeLa target cells, but not by EGFR+ / HLA-A*02+ HeLa target cells. [Figure 14A]Expression of HLA-A*02 on HeLa cells transduced with HLA-A*02 and HCT116 cells. HeLa and HCT116 cells were labeled with the anti-HLA-A2 antibody BB7.2 and then sorted by FACS. Green: unlabeled HeLa; Orange: unlabeled HCT116; Blue: wild-type HCT116 labeled with BB7.2; Red: HeLa cells transduced with HLA-A*02 and labeled with BB7.2. [Figure 14B] EGFR expression on HeLa and HCT116 cells. HeLa and HCT116 cells were labeled with anti-EGFR antibody and then FACS-sorted. Green: unlabeled HeLa; Orange: unlabeled HCT116; Blue: wild-type HCT116 labeled with anti-EGFR; Red: HeLa cells transduced with HLA-A*02 and labeled with anti-EGFR. [Figure 15A] EGFR CAR activation of Jurkat cells expressing EGFR CAR and HCT116 target cells is shown. [Figure 15B] We show that EGFR CAR activation in Jurkat cells can be blocked by the HLA-A*02 LIR-1 inhibitory receptor. Co-expression of an EGFR CAR and an HLA-A*02 LIR-1 inhibitory receptor by Jurkat cells results in a CAR EMAX shift of approximately 1.8-fold when Jurkat cells are presented with HCT116 target cells expressing EGFR and HLA-A*02. [Figure 16A] 1 shows the titration of activator antigen in a bead-based assay to determine the optimal ratio of activator antigen to blocker antigen. [Figure 16B] FIG. 1 shows the titration of blocker (inhibitory) antigen in the presence of a fixed amount of activator antigen in a bead-based assay to determine the optimal ratio of activator antigen to blocker antigen. [Figure 17] Schematic (left) and plot (right) showing that NY-ESO-1 ScFv LIR-1-based inhibitory receptor can inhibit activation of Jurkat cells by MP1 MAGE-A3 TCR using the solid tumor cell line A375 as target cells. [Figure 18]Schematic (left) and plot (right) showing that pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptor can inhibit activation of Jurkat cells by CD19 ScFv CAR using the B cell leukemia line NALM6 as target cells. [Figure 19] Schematic (left) and plot (right) showing that pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors can inhibit Jurkat cell activation by NY-ESO-1 ScFv CAR activator in a dose-dependent manner. [Figure 20] We show that a pan-HLA (pan-class I) ScFv CAR is blocked by expression of the HAL-A*02 LIR-1 blocker with tunable potency when assayed in Jurkat cells using T2 target cells and a luciferase assay. [Figure 21A] We show that pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors can inhibit Jurkat cell activation in cis in a cell-free bead-based assay. [Figure 21B] We show that pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptor can inhibit the activation of Jurkat cells by MSLN ScFv CAR using the leukemia cell line K562 as target cells. [Figure 22] Schematic (left) and chart (right) showing that pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors can inhibit the activation of Jurkat cells by MSLN ScFv CARs, as measured by fold induction of IFNγ, using pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors and HLA-A*02+ HeLa and SiHa cells as target cells. [Figure 23] We show that pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors inhibit killing by MSLN CAR activators using HLA-A*02+ SiHa cells, but not HLA-A*02- SiHa cells. [Figure 24]We show that activation of Jurkat cells expressing an EGFR ScFv CAR using a bead-based assay can be blocked by a pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptor when the activator and inhibitor antigens are present on the beads in cis, but not when the activator and inhibitor antigens are present on the beads in trans. [Figure 25A] We show that activation of Jurkat cells by EGFR ScFv CAR can be blocked by pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors using SiHa target cells expressing HLA-A*02 (SiHa A02), but not by SiHa cells not expressing HLA-A*02 (SiHa WT). [Figure 25B] We show that activation of Jurkat cells by EGFR ScFv CAR can be blocked by pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors using HeLa target cells expressing HLA-A*02 (HeLa A02), but not HeLa cells not expressing HLA-A*02 (HeLa WT). [Figure 26] This shows that additional ScFvs fused to the LIR-1 inhibitory domain inhibit constitutive CAR activators in a dose-dependent manner. Jurkat-NFAT luciferase reporter cells were transfected with an activating CAR construct that exhibits long-lasting signaling and inhibitory constructs that recognize various pMHC. The effect on NFAT-luciferase activation was measured by co-culturing transfected Jurkat cells with T2 cells loaded with various amounts of inhibitory peptides. [Figure 27] Schematic (left) and plot (right) showing that an inhibitory receptor containing the MiHA-b surrogate ScFv ligand-binding domain (KRAS G12V ScFv blocker) inhibits Jurkat effector cell activation by an activator TCR (KRAS G12D TCR, C-891) targeting the MiHA-a surrogate using T2 target cells. [Figure 28]Schematic (left) and plot (right) showing that an inhibitory receptor containing the MiHA-b surrogate ScFv ligand binding domain (KRAS G12D ScFv blocker) fused to the LIR-1 hinge, TM, and ICD inhibits Jurkat effector cell activation by a TCR targeting the MiHA-a surrogate (KRAS G12V TCR, C-913) using T2 target cells. [Figure 29] Schematic (left) and plot (right) showing that an inhibitory receptor containing the MiHA-b surrogate Ftcr binding domain (KRAS G12V Ftcr blocker) fused to the LIR1 TM and ICD inhibits Jurkat effector cell activation by a TCR targeting the MiHA-a surrogate (KRAS G12D TCR) using T2 target cells. [Figure 30] Schematic (left) and plot (right) showing that an inhibitory receptor containing the MiHA-b surrogate Ftcr binding domain (KRAS G12D Ftcr blocker) fused to the LIR-1 TM and ICD inhibits Jurkat effector cell activation by a TCR targeting the MiHA-a surrogate (KRAS G12V TCR) using T2 target cells. [Figure 31A] Figure 1 shows plots showing inhibition of Jurkat cell activation by MiHA-a TCR using an inhibitory receptor containing the MiHA-b ScFv ligand binding domain that binds one mutant KRAS peptide [KRAS G12D] and the LIR-1 hinge, transmembrane domain, and intracellular domain (ICD) that binds another mutant KRAS peptide (KRAS G12V). Black: C-891 activator; Blue: C-891 activator, C-1761 inhibitor; Red: C-891 activator, C-2371, and C2369 inhibitors. [Figure 31B]Figure 1 shows plots showing inhibition of Jurkat cell activation by MiHA-a TCR using inhibitory receptors containing the MiHA-b Ftcr ligand binding domain and the LIR-1 transmembrane and intracellular domains (ICD). Black: C-913 activator; Blue: C-913 activator, C-1761 inhibitor; Red: C-913 activator, C2365 and C2367 inhibitors. [Figure 32] 1 is a plot showing that mouse MiHA-Y TCR can activate Jurkat effector cells. [Figure 33A] 1 is a plot and table showing that HA-1 Ftcr can specifically block NY-ESO-1 TCR in the presence of HA-1(H) peptide. [Figure 33B] 10 is a plot and table showing that in the presence of non-specific allelic variant HA-1(R) peptide, there is essentially no blockade of NY-ESO-1 TCR by HA-1 Ftcr. [Figure 34A] 1 is a plot and table showing that HA-1 Ftcr can specifically block KRAS TCR in the presence of HA-1(H) blocker peptide. [Figure 34B] 10 is a plot and table showing that in the presence of non-specific allelic variant HA-1(R) peptide, there is essentially no blockade of KRAS TCR by HA-1 Ftcr. [Figure 35] 1 is a plot comparing peptide loading of HA-1(R), HA-1(H), and NY-ESO-1 peptides in T2 cells by flow cytometry. [Figure 36A] 10 is a plot and table showing activation dose response using MAGE-A3 MP1 ScFv CAR and NY-ESO-1 ScFv LIR1 blockers. [Figure 36B] 10 is a plot and table showing the inhibitory dose response using MAGE-A3 MP1 ScFv CAR and NY-ESO-1 ScFv LIR1 blockers. [Figure 36C]36B shows the x-value blocker NY-ESO-1 peptide concentrations from FIG. 36B plotted on the x-axis, normalized to the constant activator MAGE peptide concentration used for each curve. B: NY-ESO-1 LIR1 blocker; A: MAGE-A3 peptide 2 ScFv CAR. [Figure 37] 1 is a series of plots and tables showing that different degrees of blockage are observed when HLA-A*02 ScFv LIR1 inhibitor is used with different EGFR ScFv CAR activators. [Figure 38A] 1 is a series of fluorescence-activated cell sorting (FACS) plots showing expression of EGFR ScFv CAR activator receptors by T cells after incubating T cells expressing different EGFR ScFv CARs and an HLA-A*02 ScFv LIR1 inhibitor with HeLa cells expressing EGFR activator only (target A), inhibitor target only (target B), or activator and inhibitor targets (target AB). [Figure 38B] 1 is a plot showing quantified activator receptor expression before exposure to target cells and after 120 hours of co-culture with target cells expressing only the activator ligand (target A) or target cells expressing both the activator and blocker ligands (target AB). [Figure 39A] 10 is a plot showing cell surface expression of activator receptors on T cells expressing EGFR ScFv CAR (CT-482) activator and HLA-A*02 ScFv LIR1 inhibitor (C1765) after co-culture with a population of HeLa cells expressing EGFR (target A), HLA-A*02 (target B), a combination of EGFR and HLA-A*02 (target AB) on the same cells, a mixed population of HeLa cells expressing target A and target AB on different cells, or a mixed population of HeLa cells expressing target B and target AB on different cells. [Figure 39B]10 is a plot showing cell surface expression of inhibitor receptors on T cells expressing EGFR ScFv CAR (CT-482) activator and HLA-A*02 ScFv LIR1 inhibitor (C1765) after co-culture with a population of HeLa cells expressing EGFR (target A), HLA-A*02 (target B), a combination of EGFR and HLA-A*02 (target AB) on the same cells, a mixed population of HeLa cells expressing target A and target AB on different cells, or a mixed population of HeLa cells expressing target B and target AB on different cells. [Figure 40] 1 is a schematic representation of an experiment to determine whether loss of activator receptor expression by T cells was reversible. [Figure 41A]

[0023] Figure 1 is a series of plots showing that loss of surface expression of activators is reversible and corresponds to T cell cytotoxicity. Top: Percent killing of target HeLa cells by T cells is shown. Bottom: Expression of activator and inhibitor receptors as assayed by FACS. [Figure 41B]

[0023] Figure 1 is a series of plots showing that loss of surface expression of activators is reversible and corresponds to T cell cytotoxicity. Top: Percent killing of target HeLa cells by T cells is shown. Bottom: Expression of activator and inhibitor receptors as assayed by FACS. DETAILED DESCRIPTION OF THE INVENTION

[0042] The present inventors have developed a solution to the problem of identifying suitable markers and achieving cell selectivity in the treatment of diseases, particularly cancer, using cell therapy. The primary goal of this invention is to target cells based on loss of heterozygosity (Figure 1). Using a two-receptor system in which activating and inhibitory signals are integrated at the cellular level (Figures 2A, 2B, 3A, and 3B), selective targeting of tumor cells over non-tumor cells is achieved. Differential expression of surface proteins absent or lost in target cells but present in normal cells is thereby translated into targeted anti-tumor cell therapy. These differences improve cell therapy targeting and protect normal cells from the cytotoxic effects of effector cells using adoptive cell therapy.

[0043] This approach disclosed herein, in some embodiments, uses two engineered receptors: a first receptor containing a ligand-binding domain for an activator ligand and a second receptor containing a ligand-binding domain for an inhibitor ligand, which are selectively activated in target cells using "AND NOT" Boolean logic (Figures 2A, 2B, 3A, and 3B). Although normal cells express both the activator and inhibitor ligands, activation of effector cells by the first receptor is blocked by binding of the inhibitor ligand to the second receptor containing an inhibitor LBD, which exerts a protective effect and dominates the activity of the first activator receptor. In contrast, in target cells that express the activator ligand but not the inhibitor ligand, binding of the activator ligand by the activator LBD results in cell activation. Advantages of the disclosed dual activator / inhibitor receptor strategy include the ability to tailor activator and inhibitor combinations to create potent yet specific tumor-targeted adoptive cell therapies. Furthermore, this approach overcomes the challenges of varying effector cell to target cell ratios (E:T ratios) in the body and the large excess of normal cells to tumor cells (e.g., 10 13 Normal cells vs. 10 9Furthermore, the inventors have identified activators and inhibitors that cover a wide range of potential patient combinations, making this a commercially viable approach.

[0044] Specificity of adoptive cell therapy for a particular cell type can be achieved by the differential activity of the first and second receptors and the differential expression of the first and second ligands. Binding of the first ligand to the first receptor provides an activating signal, while binding of the second ligand to the second receptor prevents or reduces effector cell activation even in the presence of the first ligand. The first ligand may be more widely expressed than the second ligand, for example, in both cells targeted by adoptive cell therapy and in healthy cells that are not target cells of adoptive cell therapy (non-target cells). In contrast, the second ligand is expressed in non-target cells, but not in target cells. By expressing the first ligand and not the second ligand, only target cells, but not non-target cells, activate effector cells containing the dual receptors of the present disclosure in the presence of these cells.

[0045] The present disclosure provides compositions and methods for targeting cells (e.g., tumor cells) based on loss of heterozygosity through the use of two engineered receptors. The two engineered receptors, one inhibitor and one activator receptor, each contain different ligand-binding domains that recognize different ligands. Differential expression of the first and second ligands is used to selectively activate effector cells expressing the two receptors in the presence of only the first activator ligand. Thus, in some embodiments, the first and second ligand-binding domains are present on different receptor molecules, i.e., separate receptors that are not part of a single genetic construct, fusion protein, or protein complex. In some embodiments, one of the receptors activates the cell when each receptor binds to its cognate ligand, while the other receptor inhibits the cell. In some embodiments, the receptor containing the second inhibitor ligand-binding domain dominates signaling, resulting in inhibition of the effector cell when the target cell expresses both targets. The first activator ligand induces activation of the effector cell by the receptor containing the first activator ligand-binding domain only if the inhibitory target is not present in the cell.

[0046] Any widely expressed cell surface molecule can be used as the first ligand, such as a cell adhesion molecule, an intercellular signaling molecule, an extracellular domain, a molecule involved in chemotaxis, a glycoprotein, a G protein-coupled receptor, a transmembrane, a neurotransmitter receptor, or a voltage-gated ion channel, or a peptide antigen of any of these. As a further example, the first ligand can be the transferrin receptor (TFRC). Any cell surface molecule not expressed on the surface of the target cell can be used as the second ligand. In those embodiments in which the engineered receptor is used in adoptive cell therapy to treat cancer and the target cell is a cancer cell, the second ligand can be selected based on loss of heterozygosity of the second ligand in the cancer cell. Exemplary genes whose expression is frequently lost in cancer cells, for example, by mutations resulting in loss of heterozygosity, include HLA class I alleles, minor histocompatibility antigens (MiHA), and Y chromosome genes.

[0047] The present disclosure further provides vectors and polynucleotides encoding the engineered receptors described herein.

[0048] The present disclosure further provides methods of producing immune cell populations comprising the engineered receptors described herein, and methods of using same to treat disorders.

[0049] definition Before describing this disclosure in more detail, it may be helpful to an understanding thereof to provide definitions of certain terms used herein.

[0050] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of particular embodiments, preferred embodiments of the compositions, methods, and materials are described herein. For purposes of this disclosure, the following terms are defined below. Additional definitions are set forth throughout this disclosure.

[0051] The articles "a," "an," and "the" are used herein to refer to one or to more than one (i.e., to at least one or to more than one) of the grammatical object of the article. By way of example, "an element" means one element or one or more elements.

[0052] The use of the alternative (eg, "or") should be understood to mean either one, both, or any combination thereof of the alternatives.

[0053] The term "and / or" should be understood to mean either one or both of the alternatives.

[0054] Throughout this specification, unless the context requires otherwise, the words "comprise," "comprises," and "comprising" will be understood to imply the inclusion of the stated step or element or group of steps or elements, but not the exclusion of any other step or element or group of steps or elements. "Consisting of" means including and is limited to whatever follows the phrase "consisting of." Thus, the phrase "consisting of" indicates that the recited elements are necessary or mandatory, and that no other elements may be present. "Consisting essentially of" means including any elements listed after the phrase, and is limited to other elements that do not interfere with or contribute to the activity or action specified in this disclosure for the recited elements. Thus, the phrase "consisting essentially of" indicates that the recited elements are necessary or mandatory, but that there are no other elements that materially affect the activity or action of the recited elements.

[0055] References throughout this specification to "one embodiment," "an embodiment," "a particular embodiment," "a related embodiment," "a particular embodiment," "an additional embodiment," or "a further embodiment," or combinations thereof, mean that the particular feature, structure, or characteristic described in connection with the embodiment is included in at least one embodiment. Thus, the appearances of these phrases in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments. It is also understood that the positive recitation of a feature in an embodiment serves as a basis for excluding the feature in certain embodiments.

[0056] As used herein, the term "about" or "approximately" refers to an amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length that varies by as much as 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% of a reference amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length. In one embodiment, the term "about" or "approximately" refers to a range of ±15%, ±10%, ±9%, ±8%, ±7%, ±6%, ±5%, ±4%, ±3%, ±2%, or ±1% of a reference amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length.

[0057] As used herein, the term "isolated" means material that is substantially or essentially free from components that normally accompany it in its native state. In certain embodiments, the terms "obtained" or "derived" are used synonymously with isolated.

[0058] The terms "subject," "patient," and "individual" are used interchangeably herein and refer to a vertebrate, preferably a mammal, more preferably a human. Also encompassed are tissues, cells, and their progeny of biological entities obtained in vivo or cultured in vitro. A "subject," "patient," or "individual," as used herein, includes any animal that exhibits pain that can be treated using the vectors, compositions, and methods contemplated herein. Suitable subjects (e.g., patients) include laboratory animals (such as mice, rats, rabbits, or guinea pigs), livestock animals, and domestic animals or pets (such as cats or dogs). Non-human primates and preferably human patients are included.

[0059] As used herein, "treatment" or "treating" includes any beneficial or desired effect, and may include even minimal amelioration of symptoms. "Treatment" does not necessarily indicate a complete eradication or cure of a disease or condition, or its associated symptoms.

[0060] As used herein, "prevent" and similar words such as "prevented," "preventing," and the like refer to an approach for preventing, inhibiting, or reducing the likelihood of disease symptoms. It also refers to delaying the onset or recurrence of a disease or condition, or delaying the onset or recurrence of disease symptoms. As used herein, "prevention" and similar words also include reducing the intensity, effects, symptoms, and / or burden of a disease before onset or recurrence.

[0061] As used herein, the term "amount" refers to an "effective amount" or "effective dose" of a virus to achieve a beneficial or desired prophylactic or therapeutic result, including a clinical result.

[0062] A "prophylactically effective amount" refers to an amount of a virus effective to achieve the desired prophylactic result. Typically, although not necessarily, a prophylactically effective amount will be less than a therapeutically effective amount, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease.

[0063] A "therapeutically effective amount" of a virus or cells may vary depending on factors such as the disease state, age, sex, and weight of the individual, and the ability of the virus or cells to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the virus or cells are outweighed by the therapeutically beneficial effects. The term "therapeutically effective amount" includes an amount effective to "treat" a subject (e.g., a patient).

[0064] An "increase" or "augmentation" of a physiological response, e.g., electrophysiological activity or cellular activity, is typically a "statistically significant" amount and may include an increase of 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30-fold or more (e.g., 500, 1000-fold) (including all integers and decimal points greater than 1 therebetween, e.g., 1.5, 1.6, 1.7, 1.8, etc.) over the activity level in untreated cells.

[0065] The amount of "reduction" or "decrease" in a physiological response, e.g., electrophysiological activity or cellular activity, is typically a "statistically significant" amount and may include a reduction of 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30-fold or more (e.g., 500, 1000-fold) (including all integers and decimal points greater than 1 therebetween, e.g., 1.5, 1.6, 1.7, 1.8, etc.) of the activity level in untreated cells.

[0066] "Maintain," or "preserve," or "maintain," or "no change," or "substantially no change," or "no substantial reduction" generally refers to a physiological response that is equivalent to the response elicited by either a vehicle or a control molecule / composition. An equivalent response is not appreciably or measurably different from the reference response.

[0067] Generally, "sequence identity" or "sequence homology" refers to the exact correspondence between the respective nucleotides or amino acids of two polynucleotide or polypeptide sequences. Typically, techniques for determining sequence identity involve determining the nucleotide sequence of a polynucleotide and / or the amino acid sequence encoded thereby and comparing those sequences to a second nucleotide or amino acid sequence. Two or more sequences (polynucleotide or amino acid) can be compared by determining their "percent identity." The percent identity of two sequences, whether nucleic acid or amino acid, is calculated by dividing the number of exact matches between the two aligned sequences by the length of the shorter sequence and multiplying by 100. Percent identity can also be determined by comparing sequence information using, for example, an advanced BLAST computer program, including version 2.2.9 available from the National Institutes of Health. The BLAST program is based on the alignment method of Karlin and Altschul, Proc. Natl. Acad. Sci. USA 87:2264-2268 (1990), and is described in Altschul, et al., J. Mol. Biol. 215:403-410 (1990), Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5877 (1993), and Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997). Briefly, the BLAST program defines identity as the number of identical aligned symbols (generally nucleotides or amino acids) divided by the total number of symbols in the shorter of the two sequences. The program may be used to determine percent identity over the entire length of the proteins being compared. With short query sequences, for example, default parameters are provided to optimize searches in the blastp program.The program also allows the use of a SEG filter to mask off segments of the query sequence as determined by the SEG program of Wootton and Federhen, Computers and Chemistry 17:149-163 (1993). The desired degree of sequence identity ranges from approximately 80% to 100% and integer values ​​therebetween. Typically, the percent identity between the disclosed and claimed sequences is at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%.

[0068] The term "exogenous" is used herein to refer to any molecule, including nucleic acids, proteins or peptides, small molecule compounds, etc., that originates outside of an organism. In contrast, the term "endogenous" refers to any molecule that originates within an organism (i.e., is naturally produced by the organism).

[0069] The term "MOI" is used herein to refer to the multiplicity of infection, which is the ratio of agent (e.g., virus particles) to infected target (e.g., cell).

[0070] All publications and patents mentioned herein are incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control. However, mention of any references, articles, publications, patents, patent publications, and patent applications cited herein is not, and should not be construed as, any form of admission or suggestion that they constitute valid prior art or form part of the common general knowledge in any country in the world.

[0071] In this description, any concentration range, percentage range, ratio range, or integer range should be understood to include any integer value within the recited range, and, where appropriate, fractions thereof (such as tenths and hundredths of integers), unless otherwise indicated. The term "about," when immediately preceding a number or numeral, means that the number or numeral is within a range of plus or minus 10%.

[0072] As used herein, "target cell" refers to a cell targeted by adoptive cell therapy. For example, the target cell may be a cancer cell, which can be killed by the transferred T cells of adoptive cell therapy. The target cell of the present disclosure expresses an activator ligand as described herein, but does not express an inhibitor ligand.

[0073] activator The present disclosure provides an engineered first receptor that includes an activator that is a first ligand, and a first ligand binding domain that binds to the first activator ligand.

[0074] The present disclosure provides an engineered first receptor comprising an extracellular region comprising a first ligand-binding domain capable of specifically binding to a first ligand that activates or promotes activation of the receptor and promotes activation of an effector cell expressing the receptor. The present disclosure further provides an engineered second receptor comprising a second ligand-binding domain capable of binding to a second ligand, wherein binding of the second ligand by the second ligand-binding domain inhibits or reduces activation of the effector cell even in the presence of the first receptor bound to the first ligand.

[0075] As used herein, "activator" or "activator ligand" refers to a first ligand that binds to a first activator ligand-binding domain (LBD) of an engineered receptor of the present disclosure, such as a CAR or TCR, thereby mediating activation of a T cell expressing the engineered receptor. Activators are expressed by target cells, e.g., cancer cells, and may also be expressed more broadly than just target cells. For example, activators may be expressed on some or all types of normal, non-target cells.

[0076] In some embodiments, the first ligand is a peptide ligand of any of the activator targets disclosed herein. In some embodiments, the first ligand is a major histocompatibility (MHC) class I complex (peptide-MHC, or pMHC) containing a peptide antigen, e.g., the human leukocyte antigen A*02 allele (HLA-A*02), complexed with an MHC complex.

[0077] Target cell-specific first activator ligands comprising a peptide antigen complexed with pMHC comprising any of the human leukocyte antigens (HLA) HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, and HLA-G are contemplated within the scope of the present disclosure. In some embodiments, the first ligand comprises pMHC comprising HLA-A. HLA-A receptors are heterodimers comprising a heavy α chain and a small β chain. The α chain is encoded by a variant of HLA-A, while the β chain (β2-microglobulin) is invariant. Thousands of HLA-A gene variants exist, all of which are within the scope of the present disclosure. In some embodiments, the MHC-I comprises the human leukocyte antigen A*02 allele (HLA-A*02).

[0078] In some embodiments, the first activator ligand comprises a pMHC that includes HLA-B. Hundreds of variations (alleles) of the HLA-B gene are known, each with a specific number (e.g., HLA-B*27).

[0079] In some embodiments, the first activator ligand comprises a pMHC that includes HLA-C. HLA-C belongs to the HLA class I heavy chain paralogs. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). More than 100 HLA-C alleles are known in the art.

[0080] In some embodiments, the first activator ligand comprises pMHC comprising HLA-A. In some embodiments, the first activator ligand comprises pMHC comprising HLA-B. In some embodiments, the first activator ligand comprises pMHC comprising HLA-C. In some embodiments, the first activator ligand comprises pMHC comprising HLA-E. In some embodiments, the first activator ligand comprises pMHC comprising HLA-F. In some embodiments, the first activator ligand comprises pMHC comprising HLA-G.

[0081] In some embodiments, the first activator ligand comprises HLA-A. In some embodiments, the first activator ligand comprises HLA-B. In some embodiments, the first activator ligand comprises HLA-C. In some embodiments, the first activator ligand comprises HLA-E. In some embodiments, the first activator ligand comprises HLA-F. In some embodiments, the first activator ligand comprises HLA-G. In some embodiments, the first activator ligand comprises HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, or HLA-G.

[0082] In some embodiments, the first activator ligand binding domain comprises an ScFv domain.

[0083] In some embodiments, the first activator ligand binding domain comprises a Vβ-only ligand binding domain.

[0084] In some embodiments, the first activator ligand binding domain comprises an antigen binding domain isolated or derived from a T cell receptor (TCR), e.g., the first activator ligand binding domain comprises TCR α and β chain variable domains.

[0085] In some embodiments, the first activator ligand and the second inhibitor ligand are not the same.

[0086] In some embodiments, the first activator ligand is expressed by target cells and not expressed by non-target cells (i.e., normal cells not targeted by adoptive cell therapy). In some embodiments, the target cells are cancer cells and the non-target cells are non-cancerous cells.

[0087] In some embodiments, the activator ligand has high cell surface expression on target cells. This high cell surface expression confers the ability to deliver a large activation signal. Methods for measuring cell surface expression will be known to those skilled in the art and include, but are not limited to, immunohistochemistry using an appropriate antibody against the activator ligand, followed by microscopy or fluorescence-activated cell sorting (FACS).

[0088] In some embodiments, the activator ligand is encoded by a gene with an essential cellular function. Essential cellular functions are functions necessary for cell survival, including protein and lipid synthesis, cell division, replication, respiration, metabolism, ion transport, and providing structural support for tissues. Selecting an activator ligand encoded by a gene with an essential cellular function prevents loss of the activator ligand due to aneuploidy in cancer cells and makes the gene encoding the activator ligand less likely to undergo mutagenesis during cancer progression. In some embodiments, the activator ligand is encoded by a gene that is haploinsufficient, i.e., loss of a copy of the gene encoding the activator ligand is not tolerated by the cell, resulting in cell death or an adverse mutant phenotype.

[0089] In some embodiments, the activator ligand is present on all target cells, hi some embodiments, the target cells are cancer cells.

[0090] In some embodiments, the activator ligand is present on a plurality of target cells. In some embodiments, the target cells are cancer cells. In some embodiments, the activator ligand is present on at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, or at least 99.9% of the target cells. In some embodiments, the activator ligand is present on at least 95% of the target cells. In some embodiments, the activator ligand is present on at least 99% of the target cells.

[0091] In some embodiments, the activator ligand is present on all cells (ubiquitous activator ligand). An activator ligand can be expressed on all cells, for example, if a second inhibitor ligand is also expressed on all cells except the target cells.

[0092] In some embodiments, the first activator ligand is expressed by a plurality of target cells and a plurality of non-target cells, hi some embodiments, the plurality of non-target cells express both the first activator ligand and the second inhibitor ligand.

[0093] In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells at a ratio of about 1:100 to about 100:1 of the first ligand to the second ligand. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells at a ratio of about 1:50 to about 50:1 of the first ligand to the second ligand. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells at a ratio of about 1:25 to about 25:1 of the first ligand to the second ligand. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells at a ratio of about 1:10 to about 10:1 of the first ligand to the second ligand. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells at a ratio of about 1:5 to about 5:1 of the first ligand to the second ligand. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells in a ratio of the first ligand to the second ligand of about 1:3 to about 3:1. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells in a ratio of the first ligand to the second ligand of about 1:2 to about 2:1. In some embodiments, the first activator ligand and the second inhibitor ligand are present on the plurality of non-target cells in a ratio of about 1:1.

[0094] The first activator ligand is recognized by the first ligand binding domain (sometimes referred to herein as the activator LBD).

[0095] Exemplary activator ligands include ligands selected from the group consisting of cell adhesion molecules, intercellular signaling molecules, extracellular domains, molecules involved in chemotaxis, glycoproteins, G protein-coupled receptors, transmembrane proteins, receptors for neurotransmitters, and voltage-gated ion channels. In some embodiments, the first activator ligand is the transferrin receptor (TFRC) or a peptide antigen thereof. The human transferrin receptor is described in NCBI accession number AAA61153.1, the contents of which are incorporated herein by reference. In some embodiments, the TFRC is [ka] It is encoded by the sequence

[0096] In some embodiments, the activator ligand is a tumor-specific antigen (TSA). In some embodiments, the tumor-specific antigen is mesothelin (MSLN), CEA cell adhesion molecule 5 (CEACAM5, or CEA), epidermal growth factor receptor (EGFR), or a peptide antigen thereof. In some embodiments, the TSA is MSLN, CEA, EGFR, delta-like canonical Notch ligand 4 (DLL4), mucin 16, cell surface-associated (MUC16, also known as CA125), ganglioside GD2 (GD2), receptor tyrosine kinase-like orphan receptor 1 (ROR1), erb-b2 receptor tyrosine kinase 2 (HER2 / NEU), or a peptide antigen thereof. Exemplary murine and humanized ScFv antigen-binding domains targeting TSAs are shown in Table 1 below:

[0097] [Table 1-1] [Table 1-2] [Table 1-3] [Table 1-4]

[0098] In some embodiments, the activator ligand is MSLN or a peptide antigen thereof, and the activator ligand-binding domain comprises an MSLN-binding domain. In some embodiments, the MSLN ligand-binding domain comprises an ScFv domain. In some embodiments, the MSLN ligand-binding domain comprises the sequence of SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, or SEQ ID NO:92. In some embodiments, the MSLN ligand-binding domain comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:86, SEQ ID NO:88, SEQ ID NO:90, or SEQ ID NO:92. In some embodiments, the MSLN ligand-binding domain is encoded by a sequence comprising SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, or SEQ ID NO:93. In some embodiments, the MSLN ligand-binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:91, or SEQ ID NO:93.

[0099] In some embodiments, the activator ligand is CEA or a peptide antigen thereof, and the activator ligand binding domain comprises a CEA binding domain. In some embodiments, the CEA ligand binding domain comprises an ScFv domain. In some embodiments, the CEA ligand binding domain comprises the sequence of SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:282, SEQ ID NO:284, or SEQ ID NO:286. In some embodiments, the CEA ligand binding domain comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:94, SEQ ID NO:96, SEQ ID NO:98, SEQ ID NO:100, SEQ ID NO:282, SEQ ID NO:284, or SEQ ID NO:286. In some embodiments, the CEA ligand binding domain is encoded by a sequence comprising SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:283, SEQ ID NO:285, or SEQ ID NO:287. In some embodiments, the CEA ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of SEQ ID NO:95, SEQ ID NO:97, SEQ ID NO:99, SEQ ID NO:101, SEQ ID NO:283, SEQ ID NO:285, or SEQ ID NO:287.

[0100] In some embodiments, the activator ligand is CEA or a peptide antigen thereof, and the activator ligand binding domain comprises a CEA-binding domain. In some embodiments, the CEA ligand binding domain comprises CDR-H1 of EFGMN (SEQ ID NO: 294), CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296) or WDFAHYFQTMDY (SEQ ID NO: 297), CDR-L1 of KASQNVGTNVA (SEQ ID NO: 298) or KASAAVGTYVA (SEQ ID NO: 299), CDR-L2 of SASYRYS (SEQ ID NO: 300) or SASYRKR (SEQ ID NO: 301), and CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302), or a sequence having at least 85% or at least 95% identity thereto. In some embodiments, the CEA ScFv comprises CDR-H1 of EFGMN (SEQ ID NO: 294), CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296) or WDFAHYFQTMDY (SEQ ID NO: 297), CDR-L1 of KASQNVGTNVA (SEQ ID NO: 298) or KASAAVGTYVA (SEQ ID NO: 299), CDR-L2 of SASYRYS (SEQ ID NO: 300) or SASYRKR (SEQ ID NO: 301), and CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302). In some embodiments, the CEA binding domain comprises CDR-H1 of EFGMN (SEQ ID NO: 294), CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296), CDR-L1 of KASQNVGTNVA (SEQ ID NO: 298), CDR-L2 of SASYRYS (SEQ ID NO: 300), and CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302).In some embodiments, the CEA ScFv comprises CDR-H1 of EFGMN (SEQ ID NO: 294), CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296), CDR-L1 of KASAAVGTYVA (SEQ ID NO: 299), CDR-L2 of SASYRKR, and CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302). In some embodiments, the CEA-binding domain comprises CDR-H1 of EFGMN (SEQ ID NO: 294), CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), CDR-H3 of WDFAHYFQTMDY (SEQ ID NO: 297), CDR-L1 of KASAAVGTYVA (SEQ ID NO: 299), CDR-L2 of SASYRKR, and CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302).

[0101] In some embodiments, the activator ligand is CEA or a peptide antigen thereof, and the activator receptor is a CEA CAR. In some embodiments, the CEA CAR comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:288, SEQ ID NO:290, or SEQ ID NO:292. In some embodiments, the CEA CAR comprises or consists essentially of SEQ ID NO:288, SEQ ID NO:290, or SEQ ID NO:292. In some embodiments, the CEA CAR is encoded by a sequence comprising or consisting essentially of SEQ ID NO:289, SEQ ID NO:291, or SEQ ID NO:293. In some embodiments, the CEA CAR is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to SEQ ID NO:289, SEQ ID NO:291, or SEQ ID NO:293.

[0102] In some embodiments, the activator ligand is EGFR or a peptide antigen thereof, and the activator ligand binding domain comprises an EGFR binding domain. In some embodiments, the EGFR ligand binding domain comprises an ScFv domain. In some embodiments, the EGFR ligand binding domain comprises the sequence of SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108, SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, or SEQ ID NO:391. In some embodiments, the EGFR ligand binding domain comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:102, SEQ ID NO:104, SEQ ID NO:106, SEQ ID NO:108, SEQ ID NO:110, SEQ ID NO:112, SEQ ID NO:114, SEQ ID NO:116, SEQ ID NO:118, or SEQ ID NO:391. In some embodiments, the EGFR ligand binding domain is encoded by a sequence comprising SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, SEQ ID NO: 117, or SEQ ID NO: 119. In some embodiments, the EGFR ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, SEQ ID NO: 117, or SEQ ID NO: 119.

[0103] In some embodiments, the activator ligand is EGFR or a peptide antigen thereof, and the activator ligand binding domain comprises an EGFR ligand binding domain. In some embodiments, the EGFR binding domain comprises a VH and / or VL domain selected from the group disclosed in Table 2, or a sequence having at least 90% identity thereto. In some embodiments, the EGFR ligand binding domain comprises a VH domain selected from the group consisting of SEQ ID NO: 120, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, SEQ ID NO: 128, and SEQ ID NO: 130. In some embodiments, the EGFR ligand binding domain comprises a VH selected from the group consisting of SEQ ID NO: 120, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, SEQ ID NO: 128, and SEQ ID NO: 130, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the EGFR ligand binding domain comprises a VL domain selected from the group consisting of SEQ ID NO: 121, SEQ ID NO: 123, SEQ ID NO: 125, SEQ ID NO: 127, SEQ ID NO: 129, and SEQ ID NO: 131. In some embodiments, the EGFR ligand binding domain comprises a VH selected from the group consisting of SEQ ID NO: 121, SEQ ID NO: 123, SEQ ID NO: 125, SEQ ID NO: 127, SEQ ID NO: 129, and SEQ ID NO: 131, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

[0104] [Table 2]

[0105] In some embodiments, the activator ligand is EGFR or a peptide antigen thereof, and the activator ligand binding domain is an EGFR ligand binding domain. In some embodiments, the EGFR binding domain comprises a CDR selected from the group of complementarity determining regions (CDRs) disclosed in Table 3. In some embodiments, the EGFR ligand binding domain comprises a CDR having at least 95% sequence identity to a CDR disclosed in Table 3. In some embodiments, the EGFR ligand binding domain comprises a CDR selected from SEQ ID NOs: 131-166. In some embodiments, the EGFR ligand binding domain comprises a heavy chain CDR1 (CDR H1) selected from the group consisting of SEQ ID NOs: 132-137. In some embodiments, the EGFR ligand binding domain comprises a heavy chain CDR2 (CDR H2) selected from the group consisting of SEQ ID NOs: 138-143. In some embodiments, the EGFR ligand binding domain comprises a heavy chain CDR3 (CDR H3) selected from the group consisting of SEQ ID NOs: 144-149. In some embodiments, the EGFR ligand-binding domain comprises a light chain CDR1 (CDR L1) selected from the group consisting of SEQ ID NOs: 150-155. In some embodiments, the EGFR ligand-binding domain comprises a light chain CDR2 (CDR L2) selected from the group consisting of SEQ ID NOs: 156-160. In some embodiments, the EGFR ligand-binding domain comprises a light chain CDR3 (CDR L3) selected from the group consisting of SEQ ID NOs: 161-166. In some embodiments, the EGFR ligand-binding domain comprises a CDR H1 selected from SEQ ID NOs: 132-137, a CDR H2 selected from SEQ ID NOs: 138-143, a CDR H3 selected from SEQ ID NOs: 144-149, a CDR L1 selected from SEQ ID NOs: 150-155, a CDR L2 selected from SEQ ID NOs: 156-160, and a CDR L3 selected from SEQ ID NOs: 156-160.

[0106] [Table 3]

[0107] In some embodiments, the activator ligand is a pan-HLA ligand and the activator binding domain is a pan-HLA binding domain, i.e., a binding domain that binds to and recognizes an antigenic determinant shared among products of the HLA A, B, and C loci. Various single variable domains known in the art or disclosed herein are suitable for use in the embodiments. Such scFvs include, but are not limited to, the following murine and humanized pan-HLA scFv antibodies: An exemplary pan-HLA ligand is W6 / 32, which recognizes a conformational epitope and reacts with the alpha3 and alpha2 domains of HLA class I.

[0108] [Table 4]

[0109] In some embodiments, the activator ligand is a pan-HLA ligand and the activator ligand binding domain comprises a pan-HLA ligand binding domain. In some embodiments, the pan-HLA ligand binding domain comprises an ScFv domain. In some embodiments, the pan-HLA ligand binding domain comprises the sequence of SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171, SEQ ID NO:173, SEQ ID NO:175, or SEQ ID NO:177. In some embodiments, the pan-HLA ligand binding domain comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:167, SEQ ID NO:169, SEQ ID NO:171, SEQ ID NO:173, SEQ ID NO:175, or SEQ ID NO:177. In some embodiments, the pan-HLA ligand binding domain is encoded by a sequence comprising SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, SEQ ID NO:174, SEQ ID NO:176, or SEQ ID NO:178. In some embodiments, the pan-HLA ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of SEQ ID NO:168, SEQ ID NO:170, SEQ ID NO:172, SEQ ID NO:174, SEQ ID NO:176, or SEQ ID NO:178.

[0110] In some embodiments, the activator ligand is a CD19 molecule (CD19) or a peptide antigen thereof, and the activator ligand binding domain comprises a CD19 ligand binding domain. In some embodiments, the CD19 ligand binding domain comprises an ScFv domain. In some embodiments, the CD19 ligand binding domain comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:275 or SEQ ID NO:277. In some embodiments, the CD19 ligand binding domain comprises the sequence of SEQ ID NO:275 or SEQ ID NO:277. In some embodiments, the CD19 ligand binding domain is encoded by a sequence comprising SEQ ID NO:276 or SEQ ID NO:278. In some embodiments, the CD19 ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of SEQ ID NO:276 or SEQ ID NO:278.

[0111] In some embodiments, the activator ligand is a CD19 molecule (CD19) or a peptide antigen thereof, and the activator receptor is a CAR. In some embodiments, the CD19 CAR comprises a sequence at least 90%, at least 95%, or at least 99% identical to SEQ ID NO:279 or SEQ ID NO:281. In some embodiments, the CD19 CAR comprises or consists essentially of SEQ ID NO:279 or SEQ ID NO:281. In some embodiments, the CD19 CAR is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of SEQ ID NO:280 or SEQ ID NO:390. In some embodiments, the CD19 CAR is encoded by a sequence comprising or consisting essentially of SEQ ID NO:280 or SEQ ID NO:390. It will be appreciated by those of skill in the art that the first activator receptor ligand-binding domain may be isolated or derived from any source known in the art, including, but not limited to, art-recognized T cell receptors, chimeric antigen receptors, and antibody binding domains. For example, the first ligand-binding domain may be derived from any of the antibodies disclosed in Table 5 and bind to a first ligand selected from the antigens listed in Table 5. Thus, immune cells comprising the described two-receptor system may be used to treat any of the diseases or disorders listed in Table 5. The selection of an appropriate first activator receptor ligand-binding domain for treating any of the cancers described herein will be apparent to one of skill in the art. [Table 5-1] [Table 5-2] [Table 5-3] [Table 5-4] [Table 5-5] [Table 5-6]

[0112] inhibitor The present disclosure provides a second ligand, an inhibitor, and an engineered second receptor that includes a second ligand binding domain that binds to the inhibitor ligand.

[0113] The present disclosure provides an engineered second receptor comprising an extracellular region comprising a second ligand-binding domain capable of specifically binding to a second ligand that inhibits activation of an effector cell expressing the first and second receptors, the effector cell being activated by binding of the first ligand to the engineered first receptor.

[0114] As used herein, "inhibitor" or "inhibitor ligand," sometimes referred to as a "blocker," refers to a second ligand that binds to the second ligand-binding domain (inhibitor LBD) of an engineered receptor disclosed herein but inhibits activation of immune cells expressing the engineered receptor. Inhibitors are not expressed by target cells. Inhibitor ligands are also expressed on multiple normal non-target cells, including normal non-target cells that express the activator ligand, thereby protecting these cells from the cytotoxic effects of adoptive cell therapy. Without wishing to be bound by theory, inhibitor ligands may block effector cell activation through various mechanisms. For example, binding of an inhibitor ligand to an inhibitor LBD may block transmission of a signal generated upon binding of an activator ligand to an activator LBD that, in the absence of the inhibitor, would result in activation of immune cells expressing the engineered receptor described herein.

[0115] Alternatively, or in addition, binding of the inhibitor ligand to the engineered second receptor may cause loss of cell surface expression of the first activator receptor from immune cells comprising the two-receptor system described herein. Without wishing to be bound by theory, it is believed that immune cell binding of the activator and inhibitor ligands on normal cells causes the inhibitor receptor to trigger the removal of nearby activator receptor molecules from the immune cell surface. This process locally desensitizes the immune cell and reversibly raises its activation threshold. Immune cells that bind only the activator ligand on target cells trigger a local activation signal that is not blocked by signals from the second inhibitory receptor. This local activation increases until the release of cytotoxic granules results in selective cell death of the target cells. However, modulation of surface receptor expression levels may not be the only mechanism by which blocker receptors inhibit immune cell activation by the first activator receptor. Without wishing to be bound by theory, other mechanisms may be at play, including, but not limited to, crosstalk between the activator and blocker receptor signaling pathways.

[0116] In some embodiments, the second ligand is not expressed by the target cell but is expressed by a non-target cell, hi some embodiments, the target cell is a cancer cell and the non-target cell is a non-cancerous cell.

[0117] In some embodiments, the second inhibitor ligand binding domain comprises an ScFv domain.

[0118] In some embodiments, the second inhibitor ligand binding domain comprises a Vβ-only ligand binding domain.

[0119] In some embodiments, the second inhibitor ligand-binding domain comprises an antigen-binding domain isolated or derived from a T cell receptor (TCR), e.g., the second inhibitor ligand-binding domain comprises TCR α and β chain variable domains.

[0120] Inhibitor Target In some embodiments, the inhibitor ligand comprises a gene or its peptide antigen that has high and uniform surface expression throughout a tissue. Without wishing to be bound by theory, high and uniform surface expression throughout a tissue allows the inhibitor ligand to deliver a large, uniform inhibitory signal. Alternatively, or in addition, the expression of the activator and inhibitor target may be correlated, i.e., the two are expressed at similar levels on non-target cells.

[0121] In some embodiments, the second inhibitor ligand is a peptide ligand. In some embodiments, the second inhibitor ligand is a peptide antigen complexed with a major histocompatibility (MHC) class I complex (peptide-MHC, or pMHC). Inhibitor ligands comprising a peptide antigen complexed with pMHC comprising either HLA-A, HLA-B, or HLA-C are contemplated within the scope of the present disclosure.

[0122] In some embodiments, the inhibitor ligand is encoded by a gene that is absent or polymorphic in many tumors.

[0123] Methods for distinguishing between differential expression of an inhibitor ligand between target and non-target cells will be readily apparent to those skilled in the art. For example, the presence or absence of an inhibitor ligand in non-target and target cells can be assayed by immunohistochemistry using an antibody that binds to the inhibitor ligand, followed by microscopy or FACS, RNA expression profiling of target and non-target cells, or DNA sequencing of non-target and target cells to determine whether the genomic locus of the inhibitor ligand contains a mutation in either the target or non-target cells.

[0124] Alleles lost due to loss of heterozygosity (LOH) Homozygous deletions in primary tumors are rare and small, making target B candidates unlikely. For example, in an analysis of 2,218 primary tumors across 21 human cancer types, the top four candidates were cyclin-dependent kinase inhibitor 2A (CDKN2A), RB transcriptional corepressor 1 (RB1), phosphatase and tensin homolog (PTEN), and N3PB2. However, CDKN2A (P16) was deleted in only 5% of homozygous deletions across all cancers. Homozygous HLA-A deletions were found in less than 0.2% of cancers (Cheng et al., Nature Comm. 8:1221 (2017)). In contrast, single-copy deletion of genes in cancer cells due to hemizygous loss occurs much more frequently.

[0125] In some embodiments, the second inhibitor ligand comprises an allele of a gene that is missing in the target cell due to loss of heterozygosity. In some embodiments, the target cell comprises a cancer cell. Cancer cells frequently undergo genomic rearrangements, including duplications and deletions. These deletions can result in the loss of one copy of one or more genes in the cancer cell.

[0126] As used herein, "loss of heterozygosity (LOH)" refers to a genetic alteration that occurs frequently in cancer, whereby one of the two alleles is deleted, leaving a single monoallelic (hemizygous) locus.

[0127] HLA class I alleles In some embodiments, the second inhibitor ligand comprises an HLA class I allele. Major histocompatibility complex (MHC) class I is a protein complex that presents antigens to cells of the immune system and triggers an immune response. Human leukocyte antigens (HLA) corresponding to MHC class I are HLA-A, HLA-B, and HLA-C.

[0128] In some embodiments, the second inhibitor ligand comprises an HLA class I allele. In some embodiments, the second inhibitor ligand comprises an HLA class I allele that has been lost in the target cell by loss of heterozygosity. HLA-A is a group of human leukocyte antigens (HLA) of the major histocompatibility complex (MHC) encoded by the HLA-A locus. HLA-A is one of the three major types of human MHC class I cell surface receptors. The receptor is a heterodimer comprising a heavy α chain and a small β chain. The α chain is encoded by a variant of HLA-A, while the β chain (β2-microglobulin) is invariant. Thousands of HLA-A variants exist, all of which are within the scope of this disclosure.

[0129] In some embodiments, the second inhibitor ligand comprises an HLA-B allele. The HLA-B gene has many possible variations (alleles). Hundreds of variations (alleles) of the HLA-B gene are known, each with a specific number (e.g., HLA-B27).

[0130] In some embodiments, the second inhibitor ligand comprises an HLA-C allele. HLA-C belongs to the HLA class I heavy chain paralogs. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). Over 100 HLA-C alleles have been described.

[0131] In some embodiments, the HLA class I allele has widespread or ubiquitous RNA expression.

[0132] In some embodiments, the HLA class I allele has a known or generally high minor allele frequency.

[0133] In some embodiments, HLA class I alleles do not require peptide MHC antigens, for example, when the HLA class I allele is recognized by a pan-HLA ligand binding domain.

[0134] In some embodiments, the second inhibitor ligand comprises an HLA-A allele. In some embodiments, the HLA-A allele comprises HLA-A*02. Various single variable domains known in the art or disclosed herein that bind to and recognize HLA-A*02 are suitable for use in the embodiments. Such scFvs include, but are not limited to, the following murine and humanized scFv antibodies that bind to HLA-A*02 in a peptide-independent manner as shown in Table 6 below (complementarity-determining regions are underlined):

[0135] [Table 6-1] [Table 6-2] [Table 6-3]

[0136] Exemplary heavy and light chain CDRs (CDR-H1, CDR-H2 and CDR-H3, or CDR-L1, CDR-L2 and CDR-L3, respectively) of the HLA-A*02 ligand binding domain are shown in Table 7 below. [Table 7]

[0137] In some embodiments, the scFv comprises the complementarity determining regions (CDRs) of any one of SEQ ID NOs: 41-52. In some embodiments, the scFv comprises a sequence at least 95% identical to any one of SEQ ID NOs: 41-52. In some embodiments, the scFv comprises a sequence identical to any one of SEQ ID NOs: 41-52. In some embodiments, the antibody heavy chain comprises a heavy chain CDR of any one of SEQ ID NOs: 53-64, and the antibody light chain comprises a light chain CDR of any one of SEQ ID NOs: 53-64. In some embodiments, the antibody heavy chain comprises a sequence at least 95% identical to the heavy chain portion of any one of SEQ ID NOs: 53-64, and the antibody light chain comprises a sequence at least 95% identical to the light chain portion of any one of SEQ ID NOs: 53-64.

[0138] In some embodiments, the heavy chain of the antibody comprises a sequence identical to the heavy chain portion of any one of SEQ ID NOs: 53-64, and the light chain of the antibody comprises a sequence identical to the light chain portion of any one of SEQ ID NOs: 53-64.

[0139] In some embodiments, the ScFv comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical or identical to any one of SEQ ID NOs: 53-64.

[0140] In some embodiments, the second inhibitor ligand is HLA-A*02, and the inhibitory ligand binding domain comprises an HLA-A*02 ligand binding domain. In some embodiments, the second ligand binding domain binds to HLA-A*02 independently of the peptide in a pMHC complex containing HLA-A*02. In some embodiments, the HLA-A*02 ligand binding domain comprises an ScFv domain. In some embodiments, the HLA-A*02 ligand binding domain comprises the sequence of any one of SEQ ID NOs: 53-64. In some embodiments, the HLA-A*02 ligand binding domain comprises a sequence at least 90%, at least 95%, or at least 99% identical to the sequence of any one of SEQ ID NOs: 53-64. In some embodiments, the HLA-A*02 ligand binding domain is encoded by a sequence comprising any one of SEQ ID NOs: 179-190. In some embodiments, the HLA-A*02 ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, or at least 99% identity to any one of SEQ ID NOs: 179-190.

[0141] Minor histocompatibility antigens In some embodiments, the second inhibitor ligand comprises a minor histocompatibility antigen (MiHA). In some embodiments, the second inhibitor ligand comprises an allele of MiHA that is lost in the target cell by LOH.

[0142] MiHAs are peptides derived from proteins containing nonsynonymous differences between alleles and are presented by common HLA alleles. Nonsynonymous differences can arise from SNPs, deletions, frameshift mutations, or insertions in the coding sequence of the gene encoding MiHA. Exemplary MiHAs can be approximately 9-12 amino acids in length and can bind to MHC class I and MHC class II proteins. Binding of a TCR to an MHC complex presenting MiHA can activate T cells. The genetic and immunological properties of MiHAs are known to those skilled in the art. Candidate MiHAs are known peptides presented by known HLA class I alleles, known to induce T cell responses in clinical settings (e.g., in graft-versus-host disease or graft rejection), and allow for patient selection by simple SNP genotyping.

[0143] In some embodiments, MiHA has widespread or ubiquitous RNA expression.

[0144] In some embodiments, the MiHA has a high minor allele frequency.

[0145] In some embodiments, MiHA comprises a peptide derived from a Y chromosome gene.

[0146] In some embodiments, the second inhibitor ligand comprises a MiHA selected from the group of MiHAs disclosed in Tables 8 and 9.

[0147] Illustrative, but non-limiting, examples of MiHAs contemplated within the scope of the present invention are disclosed below in Table 8. The columns of Table 8 show, from left to right, the name of the MiHA, the gene from which it is derived, the MHC class I variant and peptide variant sequence that can present the MiHA (A / B variants are shown in brackets).

[0148] [Table 8-1] [Table 8-2] [Table 8-3] [Table 8-4] [Table 8-5] [Table 8-6]

[0149] Illustrative, but non-limiting, examples of MiHAs contemplated within the scope of the present invention are disclosed below in Table 9. The columns of Table 9, from left to right, show the name of the MiHA, the gene from which it is derived, the MHC class I variant and peptide variant sequence that can present the MiHA (A / B variants are shown in brackets).

[0150] [Table 9]

[0151] In some embodiments, MiHA comprises HA-1, a peptide antigen having the sequence VL[H / R]DDLLEA (SEQ ID NO: 273) and derived from the Rho GTPase-activating protein 45 (HA-1) gene.

[0152] An exemplary ligand binding domain that selectively binds the HA-1 variant H peptide (VLHDDLLEA (SEQ ID NO: 191)) is shown below in Table 10. The TCR alpha and TCR beta sequences of SEQ ID NO: 193 are separated by a P2A self-cleaving polypeptide of sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO: 192) with an N-terminal GSG linker.

[0153] [Table 10-1] [Table 10-2]

[0154] In some embodiments, the second inhibitory ligand comprises HA-1(H). In some embodiments, the second inhibitory ligand binding domain is isolated or derived from a TCR. In some embodiments, the second inhibitory ligand binding domain comprises TCR alpha and TCR beta variable domains. In some embodiments, the TCR alpha and TCR beta variable domains are separated by a self-cleaving polypeptide sequence. In some embodiments, the TCR alpha and TCR beta variable domains separated by a self-cleaving polypeptide sequence comprise SEQ ID NO: 193. In some embodiments, the TCR alpha and TCR beta variable domains separated by a self-cleaving polypeptide sequence comprise SEQ ID NO: 193, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the TCR alpha and TCR beta variable domains are encoded by the sequence of SEQ ID NO: 194, or a sequence having at least 80%, at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the TCR alpha variable domain comprises SEQ ID NO: 199 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the TCR beta variable domain comprises SEQ ID NO: 200 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

[0155] Loss of Y chromosome antigens In some embodiments, the second inhibitor ligand comprises a peptide encoded by a Y chromosome gene, i.e., a gene on the Y chromosome. In some embodiments, the second inhibitor ligand comprises a peptide encoded by a Y chromosome gene that has been lost in the target cell due to loss of the Y chromosome (LoY). For example, approximately one-third of the characterized MiHAs are derived from the Y chromosome. The Y chromosome contains over 200 protein-coding genes, all of which are contemplated within the scope of the present disclosure.

[0156] As used herein, "loss of Y," or "LoY," refers to a genetic alteration that occurs frequently in tumors, whereby one copy of part or all of the Y chromosome is deleted, resulting in the loss of a Y chromosome-encoded gene(s).

[0157] Y chromosome loss is known to occur in certain cancers. For example, somatic Y chromosome loss has been reported to occur in 40% of renal clear cell carcinomas (Arseneault et al., Sci. Rep. 7:44876 (2017)). Similarly, clonal Y chromosome loss was reported in 5 of 31 male breast cancer patients (Wong et al., Oncotarget 6(42):44927-40 (2015)). Y chromosome loss in tumors from male patients has been described as a "consistent feature" of head and neck cancer patients (el-Naggar et al., Am J Clin Pathol 105(1):102-8 (1996)). Furthermore, Y chromosome loss was associated with X chromosome disomy in 4 of 7 male patients with gastric cancer (Saal et al., Virchows Arch B Cell Pathol (1993)). Thus, Y chromosome genes can be lost in various cancers and used as inhibitor ligands for the engineered receptors of the present disclosure to target cancer cells.

[0158] antigen-binding domain The present disclosure provides a first ligand binding domain that activates a first engineered receptor, thereby activating an immune cell expressing the first engineered receptor, and a second ligand binding domain that activates a second engineered receptor that inhibits activation of an immune cell expressing the second engineered receptor, even in the presence of the first engineered receptor bound to the first ligand.

[0159] Any type of ligand-binding domain capable of modulating receptor activity in a ligand-dependent manner is contemplated within the scope of the present disclosure. In some embodiments, the ligand-binding domain is an antigen-binding domain. Exemplary antigen-binding domains include ScFv, SdAb, Vβ-only domains, and TCR antigen-binding domains derived from TCR α and β chain variable domains, among others.

[0160] In some embodiments, the first activator LBD comprises an antigen-binding domain. In some embodiments, the second inhibitor LBD comprises an antigen-binding domain. Any type of antigen-binding domain is contemplated within the scope of this disclosure.

[0161] For example, the first activator LBD and / or the second inhibitor LBD can comprise an antigen-binding domain that can be expressed as part of a contiguous polypeptide chain, including, for example, a single-domain antibody fragment (sdAb) or a heavy-chain antibody HCAb, or a single-chain antibody (scFv) derived from a mouse, humanized, or human antibody (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, NY; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426). In some embodiments, the first activator LBD and / or the second inhibitor LBD comprise an antigen-binding domain that comprises an antibody fragment. In a further embodiment, the activator LBD comprises an antibody fragment comprising an scFv or sdAb. In a further embodiment, the inhibitor LBD comprises an antibody fragment comprising an scFv or sdAb.

[0162] The term "antibody," as used herein, refers to a protein or polypeptide sequence derived from an immunoglobulin molecule that specifically binds to an antigen. Antibodies can be intact immunoglobulins, or fragments thereof, of polyclonal or monoclonal origin, and can be derived naturally or from recombinant sources.

[0163] The term "antibody fragment" or "antibody binding domain" refers to at least a portion of an antibody, or a recombinant variant thereof, containing the antigen-binding domain, i.e., the antigenic determining variable region of an intact antibody, sufficient for the antibody fragment to recognize and specifically bind to a target, e.g., an antigen and a defined epitope thereof. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab'), and Fv fragments, single-chain (sc)Fv ("scFv") antibody fragments, linear antibodies, single-domain antibodies (abbreviated "sdAb") (either VL or VH), camelid VHH domains, and multispecific antibodies formed from antibody fragments.

[0164] The term "scFv" refers to a fusion protein comprising at least one antibody fragment comprising a light chain variable region and at least one antibody fragment comprising a heavy chain variable region, wherein the light and heavy chain variable regions are contiguously linked by a short, flexible polypeptide linker, enabling expression as a single polypeptide chain, and wherein the scFv retains the specificity of the intact antibody from which it is derived.

[0165] "Heavy chain variable region" or "VH" (or in the case of single domain antibodies, e.g., nanobodies, "VHH"), with respect to antibodies, refers to the fragment of a heavy chain containing the three CDRs interposed between adjacent stretches known as framework regions, which are generally more highly conserved than the CDRs and form a scaffold to support the CDRs.

[0166] Unless specified, as used herein, an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminus and C-terminus of the polypeptide, and may comprise a VL-linker-VH or a VH-linker-VL.

[0167] The term "antibody light chain" refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa ("K") and lambda ("λ") light chains refer to the two major antibody light chain isotypes.

[0168] The term "recombinant antibody" refers to an antibody produced using recombinant DNA technology, such as an antibody expressed in a bacteriophage or yeast expression system. The term should also be taken to mean an antibody produced by synthesis of a DNA molecule encoding the antibody and an antibody where the DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, where the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology available and well known in the art.

[0169] The terms "Vβ domain," "Vβ-only domain," "β-chain variable domain," or "single variable domain TCR (svd-TCR)" refer to an antigen-binding domain consisting essentially of a single T cell receptor (TCR) beta variable domain that specifically binds to antigen in the absence of a second TCR variable domain. In some embodiments, the first activator LBD comprises or consists essentially of a Vβ-only domain. In some embodiments, the second inhibitor LBD comprises or consists essentially of a Vβ-only domain.

[0170] In some embodiments, a Vβ-only domain may comprise additional elements beyond the TCR variable domain, including additional amino acid sequences, additional protein domains (covalently, non-covalently, or covalently and non-covalently associated with the TCR variable domain), fusion or non-covalent association of the TCR variable domain with other types of macromolecules (e.g., polynucleotides, polysaccharides, lipids, or combinations thereof), fusion or non-covalent association of the TCR variable domain with one or more small molecules, compounds, or ligands, or combinations thereof. Any of the additional elements described may be combined, provided that the TCR variable domain is configured to specifically bind the epitope even in the absence of a second TCR variable domain.

[0171] In other embodiments, a Vβ-only domain as described herein functions independently of an α chain that lacks a Vα segment. For example, in some embodiments, one or more Vβ-only domains are fused to transmembrane domain proteins (e.g., CD3ζ and CD28) and intracellular domain proteins (e.g., CD3ζ, CD28, and / or 4-1BB) that can activate T cells in response to antigen.

[0172] In some embodiments, the Vβ-only domains bind to antigen using complementarity-determining regions (CDRs). Each Vβ-only domain contains three complementarity-determining regions (CDR1, CDR2, and CDR3).

[0173] In some embodiments, the first Vβ-only domain comprises a TCR Vβ domain or an antigen-binding fragment thereof.

[0174] In humans, the α and γ TCR variable regions are encoded by V and J segments, respectively, while the β and δ chain variable regions are further encoded by D segments. Multiple variable (V), diversity (D), and joining (J) gene segments (e.g., 52 Vβ gene segments, 2 Dβ gene segments, and 13 Jβ gene segments) exist (Janeway et al. (eds.), 2001, Immunobiology: The Immune System in Health and Disease. 5th Edition, New York, Figure 4.13), which can recombine into various V(D)J configurations using the enzymes RAG-1 and RAG-2, which recognize recombination signal sequences (RSSs) flanking the coding sequences of the V, D, and J gene segments. The RSSs consist of conserved heptamer and nonamer structures separated by 12-bp or 23-bp spacers. An RSS is found 3' to each V segment, both 5' and 3' to each D segment, and 5' to each J segment. During recombination, RAG-1 and RAG-2 cause DNA hairpin formation at the coding end of the junction (coding joint) and removal of the RSS and intervening sequences (signal joint). The variable region is further diversified at the junction by deletion of varying numbers of coding terminal nucleotides, random addition of nucleotides by terminal deoxynucleotidyl transferase (TdT), and palindromic nucleotides generated by template-mediated fill-in of asymmetrically cleaved coding hairpins.

[0175] Patent application WO2009 / 129247 (incorporated herein by reference in its entirety) discloses an in vitro system, referred to as the HuTarg system, that utilizes V(D)J recombination to generate novel antibodies in vitro. This same system was used to generate variable regions of Vβ-only domains as in patent application WO2017 / 091905 (incorporated herein by reference in its entirety) by using TCR-specific V, D, and J elements. In natural in vivo systems, nucleic acid sequences encoding CDR1 and CDR2 are contained within V (α, β, γ, or δ) gene segments, and the sequence encoding CDR3 is composed of a portion of the V and J segments (Vα or Vγ) or a portion of the V segment, the entire D segment, and a portion of the J segment (Vβ or Vδ), with random insertion and deletion of nucleotides at the VJ and VDJ recombination junctions due to the action of TdT and other recombinases and DNA repair enzymes. Recombined T cell receptor genes comprise alternating framework (FR) and CDR sequences, as do the resulting T cell receptors expressed therefrom (i.e., FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4). Using in vitro V(D)J recombination (i.e., VJ or VDJ recombination), randomized insertions and deletions can be added within or adjacent to CDR1, CDR2, and / or CDR3 (i.e., not just CDR3), additional insertions can be added using flanking sequences in the recombination substrate before and / or after CDR1, CDR2, and / or CDR3, and additional deletions can be made by deleting sequences in the recombination substrate within or adjacent to CDR1, CDR2, and / or CDR3.

[0176] In some embodiments, TCR Vβ chains that specifically bind to an epitope in the absence of a TCR Vα chain have been identified. Exemplary CDR3 amino acid sequences that bind to an epitope in the absence of a TCR Vα chain are listed in Table 11 below.

[0177] [Table 11]

[0178] In some embodiments, a Vβ-only domain specifically binds an epitope in the absence of a second TCR variable domain and consists of any N- and / or C-terminal amino acid sequence (of any length or sequence) adjacent to the variable domain defined by the FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 region, where FR1, FR2, FR3, and FR4 are derived from naturally occurring Vα, Vβ, Vγ, or Vδ domains or encoded by naturally occurring Vα, Vβ, Vγ, or Vδ gene segments, but optionally include a deletion or insertion of amino acids (e.g., 0, 1, 2, 3, 4, 5, or more than 5 amino acids) in one or more of the C-terminus of FR1, the N-terminus of FR2, the C-terminus of FR2, the N-terminus of FR3, the C-terminus of FR3, and the N-terminus of FR4, independently. CDR1, CDR2, and CDR3 may be derived from naturally occurring Vα, Vβ, Vγ, or Vδ domains or encoded by naturally occurring Vα, Vβ, Vγ, or Vδ gene segments, but one or more of CDR1, CDR2, and CDR3 independently contain insertions (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more than 10 amino acids) and / or deletions (e.g., 0, 1, 2, 3, 4, 5, or more than 5 amino acids) at the C-terminus, N-terminus, or anywhere within the CDR sequence. In some embodiments, CDR1 contains amino acid insertions or deletions at the N-terminus, C-terminus, or internally, wherein at least 50% (or optionally 60%, 70%, or 80%) of the naturally occurring CDR amino acid residues are retained. In some embodiments, CDR2 contains N-terminal, C-terminal, or internal amino acid insertions or deletions such that at least 50% (or optionally 60%, 70%, or 80%) of the native CDR amino acid residues are retained. In some embodiments, CDR3 contains N-terminal, C-terminal, or internal amino acid insertions or deletions such that at least 50% (or optionally 60%, 70%, or 80%) of the native CDR amino acid residues are retained.Insertions and / or deletions may be generated as a result of in vitro V(D)J recombination methods or from the in vitro action of TdT with recombinases and DNA repair enzymes (e.g., one or more of Artemis nuclease, DNA-dependent protein kinase (DNA-PK), X-ray repair cross-complementing protein 4 (XRCC4), DNA ligase IV, non-homologous end joining factor 1 (NHEJ1), PAXX, and DNA polymerases λ and μ). Insertions and / or deletions (including substitutions) may further result from insertions and / or deletions into the CDR nucleic acid sequences of in vitro V(D)J recombination substrates. The Vβ-only domain may further comprise a TCR constant region or a portion thereof. The Vβ-only domain may be fused to and / or complexed with additional protein domains. A double-strand break in DNA may be introduced prior to in vitro use of the recombinases and DNA repair enzymes. The Vβ-only domain may be (or may be incorporated into) a fusion protein. As used herein, the term "fusion protein" means a protein encoded by at least one nucleic acid coding sequence that is comprised of a fusion of two or more coding sequences derived from separate genes, whether the genes are from the same or different biological sources.

[0179] In some embodiments, the first activator LBD comprises an ScFv domain and the second inhibitor LBD comprises a Vβ-only domain. In some embodiments, the first activator LBD comprises a Vβ-only domain and the second inhibitor LBD comprises an ScFv domain. In some embodiments, both the first activator LBD and the second inhibitor LBD are ScFv domains. In some embodiments, both the first activator LBD and the second inhibitor LBD are Vβ-only domains.

[0180] Additional antigen binding domains for use with the activators and / or inhibitor receptors of the present disclosure are set forth below in Table 12. In Table 12, the names of the constructs are listed as ScFv inhibitor name [B] / ScFv activator name [A]. In some embodiments, the first or second ligand binding domain comprises any one of SEQ ID NO:210, SEQ ID NO:212, SEQ ID NO:214, SEQ ID NO:216, SEQ ID NO:218, SEQ ID NO:220, SEQ ID NO:222, or SEQ ID NO:224, or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

[0181] [Table 12-1] [Table 12-2]

[0182] Engineered receptors The present disclosure provides a first engineered receptor comprising a first activator ligand binding domain and a second engineered receptor comprising a second inhibitor ligand binding domain as described herein.

[0183] Chimeric antigen receptor (CAR) In some embodiments, either the first or second engineered receptor is a chimeric antigen receptor (CAR). In some embodiments, the first and second engineered receptors are chimeric antigen receptors. All CAR structures are contemplated within the scope of the present disclosure.

[0184] Extracellular domain In some embodiments, the first or second ligand binding domain is fused to the extracellular domain of the CAR.

[0185] Hinge Area In some embodiments, the CARs of the present disclosure comprise an extracellular hinge region. Incorporation of the hinge region can affect cytokine production from CAR-T cells and improve CAR-T cell proliferation in vivo. Exemplary hinges can be isolated or derived from IgD and CD8 domains, e.g., IgG1.

[0186] In some embodiments, the hinge is isolated or derived from CD8α or CD28. In some embodiments, the CD8α hinge comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 1). In some embodiments, the CD8α hinge comprises SEQ ID NO: 1. In some embodiments, the CD8α hinge consists essentially of SEQ ID NO: 1. In some embodiments, the CD8α hinge is Encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT (SEQ ID NO: 2).

[0187] In some embodiments, the CD8α hinge is encoded by SEQ ID NO:2.

[0188] In some embodiments, the CD28 hinge comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of CTIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 3). In some embodiments, the CD28 hinge comprises or consists essentially of SEQ ID NO: 3. In some embodiments, the CD28 hinge is encoded by or is identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of TGTACCATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCC (SEQ ID NO: 4).

[0189] In some embodiments, the CD28 hinge is encoded by SEQ ID NO:4.

[0190] Transmembrane domain The CAR of the present disclosure can be designed to include a transmembrane domain fused to the extracellular domain of the CAR. In some embodiments, a transmembrane domain that is naturally associated with one of the domains of the CAR is used. For example, a CAR that includes a CD28 costimulatory domain may also use a CD28 transmembrane domain. In some cases, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding with the transmembrane domain of the same or different surface membrane protein as such domain, in order to minimize interaction with other members of the receptor complex.

[0191] The transmembrane domain may be derived from either a natural or synthetic source. If the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. The transmembrane region may be isolated or derived from (i.e., may comprise at least the transmembrane region(s) thereof) the alpha, beta, or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, or from an immunoglobulin such as IgG4. Alternatively, the transmembrane domain may be synthetic, in which case it will primarily comprise hydrophobic residues such as leucine and valine. In some embodiments, triplets of phenylalanine, tryptophan, and valine will be found at each end of a synthetic transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably 2-10 amino acids in length, may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker.

[0192] In some embodiments of the CAR of the present disclosure, the CAR comprises a CD28 transmembrane domain. In some embodiments, the CD28 transmembrane domain comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 5). In some embodiments, the CD28 transmembrane domain comprises or consists essentially of SEQ ID NO: 5. In some embodiments, the CD28 transmembrane domain is TTCTGGGTGCTGGTCGTTGTGGGCGGCGTGCTGGCCTGCTACAGCCTGCTGGTGACAGTGGCCTTCATCATCTTTTGGGTG (SEQ ID NO: 6) or is encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0193] In some embodiments, the CD28 transmembrane domain is encoded by SEQ ID NO:6.

[0194] In some embodiments of a CAR of the present disclosure, the CAR comprises an IL-2R beta transmembrane domain. In some embodiments, the IL-2R beta transmembrane domain comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of IPWLGHLLVGLSGAFGFIILVYLLI (SEQ ID NO: 7). In some embodiments, the IL-2R beta transmembrane domain comprises or consists essentially of SEQ ID NO: 7. In some embodiments, the IL-2R beta transmembrane domain comprises ATTCCGTGGC TCGGCCACCT CCTCGTGGGC CTCAGCGGGG CTTTTGGCTT CATCATCTTA GTGTACTTGC TGATC (SEQ ID NO: 8) or is encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0195] In some embodiments, the IL-2R beta transmembrane domain is encoded by SEQ ID NO:8.

[0196] Cytoplasmic domain The cytoplasmic domain or other intracellular signaling domain of the CAR of the present invention is involved in activating at least one of the normal effector functions of the immune cell in which the CAR is placed. The term "effector function" refers to the specialized function of a cell. The effector function of regulatory T cells includes, for example, the suppression or downregulation of the induction or proliferation of effector T cells. Thus, the term "intracellular signaling domain" refers to a portion of a protein that transmits an effector function signal and causes the cell to perform a specialized function. Typically, the entire intracellular signaling domain can be used, but in many cases, it is not necessary to use the entire domain. To the extent that a truncated portion of an intracellular signaling domain is used, such a truncated portion may be used instead of the intact chain, as long as it transmits the effector function signal. In some cases, multiple intracellular domains may be combined to perform the desired function for the CAR-T cells of the present disclosure. Thus, the term intracellular signaling domain is meant to include any truncated portion of one or more intracellular signaling domains sufficient to transmit an effector function signal.

[0197] Examples of intracellular signaling domains for use in the CARs of the present disclosure include the cytoplasmic sequences of T cell receptors (TCRs) and co-receptors that act in concert to initiate signal transduction after antigen receptor binding, as well as any derivatives or variants of those sequences and any synthetic sequences that have the same functional capabilities. Thus, the intracellular domains of the CARs of the present disclosure comprise at least one cytoplasmic activation domain. In some embodiments, the intracellular activation domain ensures the presence of T cell receptor (TCR) signaling necessary to activate the effector function of the CAR T cell. In some embodiments, the at least one cytoplasmic activation domain is a CD247 molecule (CD3ζ) activation domain, a stimulatory killer immunoglobulin-like receptor (KIR) KIR2DS2 activation domain, or a 12 kDa DNAX activation protein (DAP12) activation domain. In some embodiments, the CD3ζ activation domain comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 9).

[0198] In some embodiments, the CD3 zeta activation domain comprises or consists essentially of SEQ ID NO: 9. In some embodiments, the CD3 zeta activation domain comprises AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGCGTAGAGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCC TGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGACTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC (SEQ ID NO: 10) or is encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0199] In some embodiments, the CD3 zeta activation domain is encoded by SEQ ID NO:10.

[0200] It is known that signals generated by the TCR alone are often insufficient for full activation of T cells, and that secondary or costimulatory signals are also required. Thus, T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequences: sequences that initiate antigen-dependent primary activation by the TCR (primary cytoplasmic signaling sequences) and sequences that act in an antigen-independent manner to provide secondary or costimulatory signals (secondary cytoplasmic signaling sequences).

[0201] Primary cytoplasmic signaling sequences regulate the primary activation of the TCR complex in either a stimulatory or inhibitory manner. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain a signaling motif known as an immunoreceptor tyrosine-based activation motif, or ITAM. In some embodiments, the ITAM contains a tyrosine separated from a leucine or isoleucine by any two other amino acids (YxxL) (SEQ ID NO: 21).

[0202] In some embodiments, the cytoplasmic domain contains 1, 2, or 3 ITAMs. In some embodiments, the cytoplasmic domain contains 1 ITAM. In some embodiments, the cytoplasmic domain contains 2 ITAMs. In some embodiments, the cytoplasmic domain contains 3 ITAMs. In some embodiments, the cytoplasmic domain contains 4 ITAMs. In some embodiments, the cytoplasmic domain contains 5 ITAMs.

[0203] In some embodiments, the cytoplasmic domain is a CD3ζ activation domain. In some embodiments, the CD3ζ activation domain comprises a single ITAM. In some embodiments, the CD3ζ activation domain comprises two ITAMs. In some embodiments, the CD3ζ activation domain comprises three ITAMs.

[0204] In some embodiments, the CD3 zeta activation domain comprising a single ITAM comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLHMQALPPR (SEQ ID NO: 11). In some embodiments, the CD3 zeta activation domain comprises SEQ ID NO: 11. In some embodiments, the CD3 zeta activation domain comprising a single ITAM consists essentially of the amino acid sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLHMQALPPR (SEQ ID NO: 11). In some embodiments, the CD3 zeta activation domain comprising a single ITAM comprises AGAGTGAAGT TCAGCAGGAG CGCAGACGCC CCCGCGTACC AGCAGGGCCA GAACCAGCTC TATAACGAGC TCAATCTAGG ACGAAGAGAG GAGTACGATG TTTTGCACAT GCAGGCCCTG CCCCCTCGC (SEQ ID NO: 12) or is encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0205] In some embodiments, the CD3 zeta activation domain is encoded by SEQ ID NO:12.

[0206] Further examples of ITAM-containing primary cytoplasmic signaling sequences that can be used in the CARs of the present disclosure include those derived from TCRζ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD3ζ, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that the cytoplasmic signaling molecule in the CAR of the present invention comprises a cytoplasmic signaling sequence derived from CD3ζ.

[0207] Costimulatory domain In some embodiments, the cytoplasmic domain of a CAR can be designed to include a CD3ζ signaling domain alone or in combination with any other desired cytoplasmic domain(s) useful in the context of the CARs of the present disclosure. For example, the cytoplasmic domain of a CAR can include a CD3ζ chain portion and a costimulatory domain. A costimulatory domain refers to a portion of a CAR that includes the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligand that is necessary for an efficient response of lymphocytes to antigens. Examples of such molecules include IL-2Rβ, Fc receptor gamma (FcRγ), Fc receptor beta (FcRβ), CD3g molecule gamma (CD3γ), CD3δ, CD3ε, CD5 molecule (CD5), CD22 molecule (CD22), CD79a molecule (CD79a), CD79b molecule (CD79b), carcinoembryonic antigen-related cell adhesion molecule 3 (CD66d), CD27 molecule (CD27), CD28 molecule (CD28), TNF receptor superfamily member 9 (4-1BB), TNF receptor superfamily member 4 ( OX40), TNF receptor superfamily member 8 (CD30), CD40 molecule (CD40), programmed cell death 1 (PD-1), inducible T cell costimulation (ICOS), lymphocyte function-associated antigen-1 (LFA-1), CD2 molecule (CD2), CD7 molecule (CD7), TNF superfamily member 14 (LIGHT), killer cell lectin-like receptor C2 (NKG2C), and CD276 molecule (B7-H3) costimulatory domains, or functional fragments thereof.

[0208] The cytoplasmic domains within the cytoplasmic signaling moiety of a CAR of the present disclosure may be linked to each other in a random or specific order. In some cases, a short oligo- or polypeptide linker, e.g., 2-10 amino acids in length, may form the linkage. A glycine-serine doublet provides an example of a suitable linker.

[0209] In some embodiments, the intracellular domain of a CAR of the present disclosure comprises at least one costimulatory domain. In some embodiments, the costimulatory domain is isolated or derived from CD28. In some embodiments, the CD28 costimulatory domain is RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 13) or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0210] In some embodiments, the CD28 costimulatory domain comprises or consists essentially of SEQ ID NO: 13. In some embodiments, the CD28 costimulatory domain comprises or consists essentially of SEQ ID NO: 13. AGGAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCCCGGAGGCCTGGCCCCACCCGGAAGCACTACCAGCCTACGCCCCTCCCAGGGATTTCGCCGCCTACCGGAGC (SEQ ID NO: 14) or is encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0211] In some embodiments, the CD28 costimulatory domain is encoded by SEQ ID NO:14.

[0212] In some embodiments, the intracellular domain of a CAR of the present disclosure comprises an interleukin-2 receptor beta chain (IL-2R beta or IL-2R-beta) cytoplasmic domain. In some embodiments, the IL-2R beta domain is truncated. In some embodiments, the IL-2R beta cytoplasmic domain comprises one or more STAT5 recruitment motifs. In some embodiments, the CAR comprises one or more STAT5 recruitment motifs outside the IL-2R beta cytoplasmic domain.

[0213] In some embodiments, the IL-2-R beta intracellular domain is NCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLPLNTDAYLSLQELQGQDPTHLV (SEQ ID NO: 15) or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0214] In some embodiments, the IL2R-beta intracellular domain comprises or consists essentially of SEQ ID NO: 15. In some embodiments, the IL-2R-beta intracellular domain comprises or consists essentially of SEQ ID NO: 15. Encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of TIFF0007739261000031.tif37164.

[0215] In some embodiments, the IL-2R-beta intracellular domain is encoded by SEQ ID NO:16.

[0216] In one embodiment, the IL-2R-beta cytoplasmic domain comprises one or more STAT5 recruitment motifs. Exemplary STAT5 recruitment motifs are provided by Passerini et al. (2008) STAT5-signaling cytokines regulate the expression of FOXP3 in CD4+CD25+ regulatory T cells and CD4+CD25+ effector T cells. International Immunology, Vol. 20, No. 3, pp. 421-431 and by Kagoya et al. (2018) A novel chimeric antigen receptor containing a JAK-STAT signaling domain mediates superior antitumor effects. Nature Medicine doi:10.1038 / nm.4478.

[0217] In some embodiments, the STAT5 recruitment motif(s) consist of the sequence Tyr-Leu-Ser-Leu (SEQ ID NO: 17).

[0218] Inhibitory domain In some embodiments, for example, in the engineered second receptor of the present disclosure that provides an inhibitory signal, the inhibitory signal is transmitted by the intracellular domain of the receptor. In some embodiments, the engineered receptor comprises an inhibitory intracellular domain. In some embodiments, the engineered second receptor is a CAR (inhibitory CAR) that comprises an inhibitory intracellular domain.

[0219] In some embodiments, the inhibitory intracellular domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, the inhibitory intracellular domain comprising an ITIM can be isolated or derived from immune checkpoint inhibitors such as CTLA-4 and PD-1. CTLA-4 and PD-1 are immune inhibitory receptors expressed on the surface of T cells and play a central role in attenuating or terminating T cell responses.

[0220] Inhibitory domains can be isolated from the human tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor and CD200 receptor 1.

[0221] In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane domain, or a combination thereof. In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane domain, a hinge region, or a combination thereof. In some embodiments, the inhibitory domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, ITIM-containing inhibitory domains can be isolated or derived from immune checkpoint inhibitors such as CTLA-4 and PD-1.

[0222] The inhibitory domain can be isolated from the human tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor and CD200 receptor 1. In some embodiments, the inhibitory domain is isolated or derived from a human protein, such as a human TRAIL receptor, CTLA-4, or PD-1 protein. In some embodiments, the TRAIL receptor comprises TR10A, TR10B, or TR10D.

[0223] Endogenous TRAIL is expressed as a 281-amino acid type II transmembrane protein that is anchored to the plasma membrane and displayed on the cell surface. TRAIL is expressed by natural killer cells, which can induce TRAIL-dependent apoptosis in target cells after the establishment of cell-to-cell contact. Physiologically, the TRAIL signaling system has been shown to be essential for immune surveillance, for the construction of the immune system by regulating T helper cell 1 in addition to T helper cell 2 to "helpless" CD8+ T cell numbers, and for the suppression of spontaneous tumor formation.

[0224] In some embodiments, the inhibitory domain comprises an intracellular domain isolated or derived from the CD200 receptor. The cell surface glycoprotein CD200 receptor 1 (Uniprot ref: Q8TD46) represents another example of an inhibitory intracellular domain of the present invention. This inhibitory receptor of the CD200 / OX2 cell surface glycoprotein limits inflammation by inhibiting the expression of proinflammatory molecules, including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS), in response to selected stimuli.

[0225] In some embodiments, the engineered receptor comprises killer cell immunoglobulin-like receptor, three Ig domains and a long cytoplasmic tail 2 (KIR3DL2), killer cell immunoglobulin-like receptor, three Ig domains and a long cytoplasmic tail 3 (KIR3DL3), leukocyte immunoglobulin-like receptor B1 (LIR1, also known as LIR-1 and LILRB1), programmed death 1 (PD-1), Fc gamma receptor IIB (FcgRIIB), killer cell lectin-like receptor K1 (NKG2D), CTLA-4, a domain containing a synthetic consensus ITIM, a ZAP70 SH2 domain (e.g., one or both of the N-terminal and C-terminal SH2 domains), or an inhibitory domain isolated or derived from ZAP70 KI_K369A (kinase-inactive ZAP70).

[0226] In some embodiments, the inhibitory domain is isolated or derived from a human protein.

[0227] In some embodiments, the second inhibitory receptor comprises a cytoplasmic domain and a transmembrane domain isolated or derived from the same protein, e.g., an ITIM-containing protein. In some embodiments, the second inhibitory receptor comprises a cytoplasmic domain, a transmembrane domain, and an extracellular domain, or portions thereof, isolated or derived from the same protein, e.g., an ITIM-containing protein. In some embodiments, the second inhibitory receptor comprises an intracellular domain and / or a transmembrane domain and a hinge region isolated or derived from the same protein, e.g., an ITIM-containing protein.

[0228] In some embodiments, the engineered second inhibitory receptor comprises an inhibitory domain. In some embodiments, the engineered second inhibitory receptor comprises an inhibitory intracellular domain and / or an inhibitory transmembrane domain. In some embodiments, the engineered second receptor is a CAR (inhibitory CAR) comprising an inhibitory domain. In some embodiments, the inhibitory intracellular domain is fused to the intracellular domain of the CAR. In some embodiments, the inhibitory intracellular domain is fused to the transmembrane domain of the CAR.

[0229] T cell receptor (TCR) In some embodiments, the first or second engineered receptor is a T cell receptor (TCR). In some embodiments, the first and second engineered receptors are T cell receptors (TCR).

[0230] As used herein, "TCR," sometimes referred to as "TCR complex" or "TCR / CD3 complex," refers to a protein complex comprising a TCR alpha chain, a TCR beta chain, and one or more invariant CD3 chains (zeta, gamma, delta, and epsilon), sometimes referred to as subunits. The TCR alpha and beta chains are disulfide-bonded and can function as a heterodimer that binds to a peptide-MHC complex. Binding of the TCR alpha / beta heterodimer to peptide-MHC induces a conformational change in the associated invariant CD3 subunit of the TCR complex, resulting in their phosphorylation and association with downstream proteins, thereby transmitting a primary stimulatory signal. In an exemplary TCR complex, TCR alpha and TCR beta polypeptides form a heterodimer, CD3 epsilon and CD3 delta form a heterodimer, CD3 epsilon and CD3 gamma form a heterodimer, and two CD3 zetas form homodimers.

[0231] Extracellular domain The present disclosure provides a first engineered receptor comprising a first extracellular ligand-binding domain and a second engineered receptor comprising a second extracellular ligand-binding domain. Either the first engineered receptor, the second engineered receptor, or both may be a TCR. Any suitable ligand-binding domain may be fused to the extracellular domain, hinge domain, or transmembrane of the engineered TCRs described herein.

[0232] In some embodiments, the first and / or second ligand binding domains are fused to the extracellular domain of a TCR subunit. The TCR subunit can be TCR alpha, TCR beta, CD3 delta, CD3 epsilon, or CD3 gamma. In some embodiments, both the first and second ligand binding domains are fused to the same TCR subunit of different TCR receptors. In some embodiments, the first and second ligand binding domains are fused to different TCR subunits of different TCR receptors. In some embodiments, the first activator ligand binding domain is fused to a first TCR subunit of a first engineered receptor, and the second inhibitor ligand binding domain is fused to a second TCR subunit of a second engineered receptor. In some embodiments, the first and second TCR subunits are not the same subunit. In some embodiments, the first and second TCR subunits are the same subunit. For example, the first ligand binding domain can be fused to TCR alpha, and the second ligand binding domain can be fused to TCR beta. As a further example, a first ligand binding domain may be fused to TCR beta and a second ligand binding domain may be fused to TCR alpha.

[0233] In some embodiments, the first activator LBD comprises an ScFv domain and the second inhibitor LBD comprises a Vβ-only domain. In some embodiments, the first activator LBD comprises a Vβ-only domain and the second inhibitor LBD comprises an ScFv domain. In some embodiments, both the first activator LBD and the second inhibitor LBD are ScFv domains. In some embodiments, both the first activator LBD and the second inhibitor LBD are Vβ-only domains.

[0234] In some embodiments, the first engineered TCR of the present disclosure comprises an extracellular domain comprising a Vβ-only domain, a transmembrane domain, and an intracellular domain, hi some embodiments, the intracellular domain comprises one or more exogenous domains.

[0235] In some embodiments, the first engineered TCR of the present disclosure comprises an extracellular domain comprising an ScFv domain, a transmembrane domain, and an intracellular domain, hi some embodiments, the intracellular domain comprises one or more exogenous domains.

[0236] In some embodiments, the engineered second TCR of the present disclosure comprises an extracellular domain comprising a Vβ-only domain, a transmembrane domain, and an inhibitory intracellular domain.

[0237] In some embodiments, the second engineered TCR of the present disclosure comprises an extracellular domain comprising an ScFv domain, a transmembrane domain, and an inhibitory intracellular domain.

[0238] TCR subunits include TCR alpha, TCR beta, CD3 zeta, CD3 delta, CD3 gamma, and CD3 epsilon. Any one or more of the TCR alpha, TCR beta chain, CD3 gamma, CD3 delta, or CD3 epsilon, or fragments or derivatives thereof, may be fused to one or more domains capable of providing a stimulatory signal of the present disclosure, thereby enhancing TCR function and activity. Any one or more of the TCR alpha, TCR beta chain, CD3 gamma, CD3 delta, or CD3 epsilon, or fragments or derivatives thereof, may be fused to an inhibitory intracellular domain of the present disclosure.

[0239] In some embodiments, e.g., those embodiments in which the first engineered receptor or the second engineered receptor comprises a first and a second polypeptide, the antigen binding domain is isolated or derived from a T cell receptor (TCR) extracellular domain or an antibody.

[0240] In some embodiments, the first engineered receptor and the second engineered receptor comprise a first antigen-binding domain and a second antigen-binding domain, and one or more antigen-binding domains of the engineered receptor may be provided on the same or a different polypeptide as the intracellular domain.

[0241] In some embodiments, the antigen binding domain of the first and / or second engineered receptor comprises a single chain variable fragment (scFv).

[0242] In some embodiments, the engineered first and / or second receptor comprises a second polypeptide. The present disclosure provides receptors having two polypeptides, each having a portion of a ligand-binding domain (e.g., a heterodimeric LDB, e.g., a cognate, such as a TCR α / β or Fab-based LBD). The present disclosure further provides receptors having two polypeptides, each having a portion of a ligand-binding domain (e.g., a heterodimeric LDB, e.g., a cognate, such as a TCR α / β or Fab-based LBD), where a portion of the ligand-binding domain is fused to a hinge or transmembrane domain, while the other portion of the ligand-binding domain does not have an intracellular domain. Additional types include receptors in which each polypeptide has a hinge domain, and each polypeptide has a hinge and a transmembrane domain. In some embodiments, the hinge domain is absent. In other embodiments, the hinge domain is a membrane-proximal extracellular region (MPER), such as the LILRB1 D3D4 domain.

[0243] In some embodiments, e.g., those embodiments in which the engineered first and / or second receptor comprises at least two polypeptides, the first polypeptide comprises a first chain of an antibody and the second polypeptide comprises a second chain of the antibody.

[0244] In some embodiments, the receptor comprises a Fab fragment of an antibody. In embodiments, the first polypeptide comprises an antigen-binding fragment and an intracellular domain of an antibody heavy chain, and the second polypeptide comprises an antigen-binding fragment of an antibody light chain. In some embodiments, the first polypeptide comprises an antigen-binding fragment and an intracellular domain of an antibody light chain, and the second polypeptide comprises an antigen-binding fragment of an antibody heavy chain.

[0245] In some embodiments, the first and / or second engineered receptor comprises an extracellular fragment of a T cell receptor (TCR). In some embodiments, the first polypeptide comprises an antigen-binding fragment and an intracellular domain of the alpha chain of the TCR, and the second polypeptide comprises an antigen-binding fragment of the beta chain of the TCR. In some embodiments, the first polypeptide comprises an antigen-binding fragment and an intracellular domain of the beta chain of the TCR, and the second polypeptide comprises an antigen-binding fragment of the alpha chain of the TCR.

[0246] TCRs containing only Vβ domains Certain embodiments of the present disclosure relate to engineered TCRs comprising a TCR variable domain that specifically binds to an antigen in the absence of a second TCR variable domain (a Vβ-only domain).

[0247] In some embodiments, the engineered TCR comprises additional elements other than the TCR variable domain, including additional amino acid sequences, additional protein domains (covalently, non-covalently, or covalently and non-covalently associated with the TCR variable domain), fusion or non-covalent association of the TCR variable domain with other types of macromolecules (e.g., polynucleotides, polysaccharides, lipids, or combinations thereof), fusion or non-covalent association of the TCR variable domain with one or more small molecules, compounds, or ligands, or combinations thereof. Any of the additional elements described may be combined, provided that the TCR variable domain is configured to specifically bind the epitope even in the absence of the second TCR variable domain.

[0248] An engineered TCR comprising a Vβ-only domain as described herein may comprise a single TCR chain (e.g., an α, β, γ, or δ chain), or the TCR may comprise a single TCR variable domain (e.g., of an α, β, γ, or δ chain). When the engineered TCR is a single TCR chain, the TCR chain comprises a transmembrane domain, a constant (or C domain), and a variable (or V domain), and does not comprise a second TCR variable domain. Thus, the engineered TCR may comprise or consist of a TCR α chain, a TCR β chain, a TCR γ chain, or a TCR δ chain. The engineered TCR may be a membrane-bound protein. Alternatively, the engineered TCR may be a membrane-associated protein.

[0249] In some embodiments, an engineered TCR as described herein utilizes an alternative alpha chain lacking a Valpha segment, which forms an activation-competent TCR complexed with six CD3 subunits.

[0250] In other embodiments, engineered TCRs as described herein function independently of an alternative α chain lacking a Vα segment. For example, in some embodiments, one or more engineered TCRs are fused to transmembrane domain proteins (e.g., CD3ζ and CD28) and intracellular domain proteins (e.g., CD3ζ, CD28, and / or 4-1BB) that can activate T cells in response to antigen.

[0251] In some embodiments, the engineered TCR comprises one or more single TCR chains fused to a Vβ-only domain as described herein. For example, the engineered TCR may comprise or consist essentially of a single αTCR chain, a single βTCR chain, a single γTCR chain, or a single δTCR chain fused to one or more Vβ-only domains.

[0252] In some embodiments, the engineered TCR binds to the antigen using complementarity determining regions (CDRs). Each engineered TCR contains three complementarity determining regions (CDR1, CDR2, and CDR3).

[0253] The first and / or second ligand-binding Vβ-only domain may be a human TCR variable domain. Alternatively, the first and / or second Vβ-only domain may be a non-human TCR variable domain. The first and / or second Vβ-only domain may be a mammalian TCR variable domain. The first and / or second Vβ-only domain may be a vertebrate TCR variable domain.

[0254] In embodiments where the Vβ-only domain is incorporated into a fusion protein, e.g., a fusion protein comprising a TCR subunit and, optionally, an additional stimulatory intracellular domain, the fusion protein may comprise the Vβ-only domain and any other protein domain(s).

[0255] Transmembrane domain The present disclosure provides a first fusion protein comprising a first activator LBD and a second fusion protein comprising a second inhibitor LBD and an inhibitory intracellular domain, in some embodiments, the first and second fusion proteins comprise transmembrane domains.

[0256] The present disclosure provides polypeptides comprising a transmembrane domain and an intracellular domain capable of providing a stimulatory or inhibitory signal, hi some embodiments, the engineered TCR comprises multiple intracellular domains capable of providing a stimulatory signal.

[0257] "Transmembrane domain," as used herein, refers to a domain of a protein that spans the membrane of a cell. Transmembrane domains typically consist primarily of nonpolar amino acids and may span the lipid bilayer once or several times. Transmembrane domains typically contain alpha helices arranged to maximize internal hydrogen bonding.

[0258] Transmembrane domains isolated or derived from any source are contemplated within the scope of the fusion proteins of the present disclosure.

[0259] In some embodiments, the transmembrane domain is combined with one of the other domains of the fusion protein or is isolated or derived from the same protein as one of the other domains of the fusion protein. In some embodiments, the transmembrane domain and the second intracellular domain are derived from the same protein, e.g., a TCR complex subunit, such as TCR alpha, TCR beta, CD3 delta, CD3 epsilon, or CD3 gamma. In some embodiments, the extracellular domain (svd-TCR), transmembrane domain, and second intracellular domain are derived from the same protein, e.g., a TCR complex subunit, such as TCR alpha, TCR beta, CD3 delta, CD3 epsilon, or CD3 gamma. In other embodiments, the extracellular domain (including one or more ligand binding domains, such as a Vβ-only domain and an ScFv domain), transmembrane domain, and intracellular domain(s) are derived from different proteins. For example, in some embodiments, an engineered svd-TCR comprises a CD28 transmembrane domain with CD28, 4-1BB, and CD3ζ intracellular domains.

[0260] The transmembrane domain may be derived from either natural or recombinant sources. If the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.

[0261] In some embodiments, the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the TCR complex is bound to a target. Transmembrane domains of particular use in the present invention may include at least the transmembrane region(s) of, for example, the alpha, beta, or zeta chain of the TCR, CD3 delta, CD3 epsilon, or CD3 gamma, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.

[0262] In some embodiments, the transmembrane domain can be connected to the extracellular region of the fusion protein, e.g., the antigen-binding domain of the TCR alpha or beta chain, by a hinge, e.g., a hinge derived from a human protein. For example, in one embodiment, the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, or a CD8a hinge.

[0263] In some embodiments, the hinge is isolated or derived from CD8α or CD28. In some embodiments, the CD8α hinge comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 1). In some embodiments, the CD8α hinge comprises SEQ ID NO: 1. In some embodiments, the CD8α hinge consists essentially of SEQ ID NO: 1. In some embodiments, the CD8α hinge is Encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT (SEQ ID NO: 2).

[0264] In some embodiments, the CD8α hinge is encoded by SEQ ID NO:2.

[0265] In some embodiments, the CD28 hinge comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of CTIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 3). In some embodiments, the CD28 hinge comprises or consists essentially of SEQ ID NO: 3. In some embodiments, the CD28 hinge is TGTACCATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCC (SEQ ID NO: 4) or is encoded by or identical to a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity to the sequence of

[0266] In some embodiments, the CD28 hinge is encoded by SEQ ID NO:4.

[0267] In some embodiments, the transmembrane domain comprises a TCR alpha transmembrane domain. In some embodiments, the TCR alpha transmembrane domain comprises or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence VIGFRILLLKVAGFNLLMTLRLW (SEQ ID NO: 26). In some embodiments, the TCR alpha transmembrane domain comprises or consists essentially of SEQ ID NO: 26. In some embodiments, the TCR alpha transmembrane domain comprises GTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATGACGCTGCGGCTGTGG (SEQ ID NO: 27) It is encoded by the sequence

[0268] In some embodiments, the transmembrane domain comprises a TCR beta transmembrane domain. In some embodiments, the TCR beta transmembrane domain comprises or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence of TILYEILLGKATLYAVLVSALVL (SEQ ID NO: 28). In some embodiments, the TCR beta transmembrane domain comprises or consists essentially of SEQ ID NO: 28. In some embodiments, the TCR beta transmembrane domain comprises ACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGTCAGTGCCCTCGTGCTG (SEQ ID NO: 20) It is encoded by the sequence

[0269] In some embodiments, the transmembrane comprises a CD3 zeta transmembrane domain. In some embodiments, the CD3 zeta transmembrane domain comprises or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence of LCYLLDGILFIYGVILTALFL (SEQ ID NO:29). In some embodiments, the CD3 zeta transmembrane domain comprises or consists essentially of SEQ ID NO:29.

[0270] A transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acids associated with the extracellular region of the protein from which the transmembrane is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or up to 15 amino acids of the extracellular region) and / or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or up to 15 amino acids of the intracellular region).

[0271] In some embodiments, the transmembrane domain may be selected or modified, e.g., by amino acid substitution, to avoid binding to transmembrane domains of the same or different surface membrane proteins as such domains, to minimize interactions with other members of the receptor complex.

[0272] If present, the transmembrane domain may be a native TCR transmembrane domain, a native transmembrane domain from a heterologous membrane protein, or an artificial transmembrane domain. The transmembrane domain may be a membrane anchor domain. Without limitation, a native or artificial transmembrane domain may include a hydrophobic a-helix of about 20 amino acids, often positively charged, adjacent to the transmembrane segment. The transmembrane domain may have one transmembrane segment or two or more transmembrane segments. Prediction of transmembrane domains / segments may be performed using publicly available prediction tools (e.g., TMHMM, Krogh et al. Journal of Molecular Biology 2001;305(3):567-580, or TMpred, Hofmann & Stoffel Biol. Chem. Hoppe-Seyler 1993;347:166). Non-limiting examples of membrane anchor systems include the platelet-derived growth factor receptor (PDGFR) transmembrane domain, glycosylphosphatidylinositol (GPI) anchor (post-translationally added to a signal sequence), and the like.

[0273] Intracellular domain The present disclosure provides fusion proteins comprising an intracellular domain. "Intracellular domain," as the term is used herein, refers to the intracellular portion of a protein.

[0274] In some embodiments, the intracellular domain comprises one or more domains capable of providing a stimulatory signal to the transmembrane domain. In some embodiments, the intracellular domain comprises a first intracellular domain capable of providing a stimulatory signal and a second intracellular domain capable of providing a stimulatory signal. In other embodiments, the intracellular domain comprises first, second, and third intracellular domains capable of providing a stimulatory signal. The intracellular domain capable of providing a stimulatory signal is selected from the group consisting of a CD28 molecule (CD28) domain, an LCK proto-oncogene, a Src family tyrosine kinase (Lck) domain, a TNF receptor superfamily member 9 (4-1BB) domain, a TNF receptor superfamily member 18 (GITR) domain, a CD4 molecule (CD4) domain, a CD8a molecule (CD8a) domain, a FYN proto-oncogene, a Src family tyrosine kinase (Fyn) domain, a zeta chain-associated protein kinase 70 (ZAP70) domain of the T cell receptor, a linker for activation of T cells (LAT) domain, a lymphocyte cytosolic protein 2 (SLP76) domain, an intracellular domain of (TCR) alpha, TCR beta, CD3 delta, CD3 gamma, and CD3 epsilon.

[0275] In some embodiments, the intracellular domain comprises at least one intracellular signaling domain. The intracellular signaling domain generates a signal that promotes a cellular function, such as an immune effector function of a TCR-containing cell, e.g., a TCR-expressing T cell. In some embodiments, the intracellular domain of a fusion protein of the present disclosure comprises at least one intracellular signaling domain. For example, the intracellular domain of CD3 gamma, delta, or epsilon comprises a signaling domain.

[0276] In some embodiments, the extracellular domain, transmembrane domain, and intracellular domain are isolated from or derived from the same protein, for example, T cell receptor (TCR) alpha, TCR beta, CD3 delta, CD3 gamma, or CD3 epsilon.

[0277] Examples of intracellular domains for use in the fusion proteins of the present disclosure include the cytoplasmic sequences of TCR alpha, TCR beta, CD3 zeta, and 4-1BB and intracellular signaling co-receptors that act in concert to initiate signal transduction following antigen receptor binding, as well as any derivatives or variants of those sequences and any recombinant sequences that have the same functional capabilities.

[0278] In some embodiments, the intracellular signaling domain comprises a primary intracellular signaling domain. Exemplary primary intracellular signaling domains include those derived from proteins involved in primary, or antigen-dependent, stimulation.

[0279] The intracellular signaling domain is generally involved in activating at least one of the normal effector functions of the immune cell into which the fusion protein is introduced. The term "effector function" refers to a specialized function of a cell. For example, the effector function of a T cell can be cytolytic activity or helper activity, including cytokine secretion. Thus, the term "intracellular signaling domain" refers to the portion of a protein that transmits the effector function signal and causes the cell to perform the specialized function.

[0280] In some cases, the entire intracellular signaling domain can be used, but in many cases it is not necessary to use the entire intracellular signaling domain. To the extent that a truncated portion of the intracellular signaling domain is used, such a truncated portion may be used in place of the intact chain, so long as it transmits an effector function signal. Thus, the term intracellular signaling domain is meant to include any truncated portion of the intracellular signaling domain sufficient to transmit an effector function signal.

[0281] In some embodiments, the intracellular domain comprises a CD3 delta intracellular domain. In some embodiments, the CD3 delta intracellular domain comprises GHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKGGSRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 30) or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence of

[0282] In some embodiments, the CD3 delta intracellular domain comprises or consists essentially of SEQ ID NO: 30. In some embodiments, the CD3 delta intracellular domain comprises or consists essentially of SEQ ID NO: 30. Encoded by the sequence TIFF0007739261000032.tif37164.

[0283] In some embodiments, the intracellular domain comprises a CD3 epsilon intracellular domain. In some embodiments, the CD3 epsilon intracellular domain comprises or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence of KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGGSRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 32). In some embodiments, the CD3 epsilon intracellular domain comprises or consists essentially of SEQ ID NO: 32. In some embodiments, the CD3 epsilon intracellular domain comprises Encoded by the sequence TIFF0007739261000033.tif37164.

[0284] In some embodiments, the intracellular domain comprises a CD3 gamma intracellular domain. In some embodiments, the CD3 gamma intracellular domain comprises GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNGGSRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 33) or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence of

[0285] In some embodiments, the CD3 gamma intracellular domain comprises or consists essentially of SEQ ID NO: 33. In some embodiments, the CD3 gamma intracellular domain comprises or consists essentially of SEQ ID NO: 33. Encoded by the sequence TIFF0007739261000034.tif37164.

[0286] In some embodiments, the intracellular domain comprises a CD3 zeta intracellular domain. In some embodiments, the CD3 zeta intracellular domain comprises RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 9) or a subsequence thereof, or is identical to the sequence, or an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence, or a subsequence thereof.

[0287] In some embodiments, the CD3 zeta intracellular domain comprises or consists essentially of SEQ ID NO:9.

[0288] In some embodiments, the intracellular domain comprises a TCR alpha intracellular domain. In some embodiments, the TCR alpha intracellular domain comprises Ser-Ser. In some embodiments, the TCR alpha intracellular domain is encoded by the sequence TCCAGC.

[0289] In some embodiments, the intracellular domain comprises a TCR beta intracellular domain. In some embodiments, the TCR beta intracellular domain comprises or is identical to an amino acid sequence having at least 80% identity, at least 90% identity to the sequence of MAMVKRKDSR (SEQ ID NO: 35). In some embodiments, the TCR beta intracellular domain comprises or consists essentially of SEQ ID NO: 35. In some embodiments, the TCR beta intracellular domain comprises ATGGCCATGGTCAAGAGAAAGGATTCCAGA (SEQ ID NO: 36) It is encoded by the sequence

[0290] In some embodiments, the intracellular signaling domain comprises at least one stimulatory intracellular domain. In some embodiments, the intracellular signaling domain comprises a primary intracellular signaling domain, such as a CD3 delta, CD3 gamma, and CD3 epsilon intracellular domain, and one additional stimulatory intracellular domain, such as a costimulatory domain. In some embodiments, the intracellular signaling domain comprises a primary intracellular signaling domain, such as a CD3 delta, CD3 gamma, and CD3 epsilon intracellular domain, and two additional stimulatory intracellular domains.

[0291] Exemplary costimulatory intracellular signaling domains include those derived from proteins involved in costimulatory signals, or antigen-independent stimulation.

[0292] The term "costimulatory molecule" refers to a cognate binding partner on a T cell that specifically binds to a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation. Costimulatory molecules are cell surface molecules other than antigen receptors. Costimulatory molecules and their ligands are necessary for an efficient immune response. Costimulatory molecules include, but are not limited to, MHC class I molecules, BTLA, and Toll ligand receptors, as well as DAP10, DAP12, CD30, LIGHT, OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11a / CD18), 4-1BB (CD137, TNF receptor superfamily member 9), and CD28 molecules (CD28).

[0293] A "costimulatory domain," sometimes referred to as a "costimulatory intracellular signaling domain," can be the intracellular portion of a costimulatory protein. A costimulatory domain can be the domain of a costimulatory protein that transmits a costimulatory signal. Costimulatory proteins can be present in the following protein families: TNF receptor proteins, immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocyte activation molecules (SLAM proteins), and activating NK cell receptors. Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, a ligand that specifically binds to CD83, and CD4. A costimulatory domain can comprise the entire intracellular portion of the molecule from which it is derived, or the entire native intracellular signaling domain, or a functional fragment thereof.

[0294] In some embodiments, the stimulatory domain comprises a costimulatory domain. In some embodiments, the costimulatory domain comprises a CD28 or 4-1BB costimulatory domain. CD28 and 4-1BB are well-characterized costimulatory molecules required for full T cell activation and are known to enhance T cell effector function. For example, CD28 and 4-1BB have been utilized in chimeric antigen receptors (CARs) to enhance cytokine release, cytolytic function, and persistence over first-generation CARs containing only the CD3 zeta signaling domain. Similarly, including costimulatory domains, e.g., CD28 and 4-1BB domains, in engineered TCRs can increase T cell effector function, particularly allowing costimulation in the absence of costimulatory ligands, which are typically downregulated on the surface of tumor cells.

[0295] In some embodiments, the stimulatory domain comprises a CD28 intracellular domain. In some embodiments, the CD28 intracellular domain comprises or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 37). In some embodiments, the CD28 intracellular domain comprises or consists essentially of RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 37). In some embodiments, the CD28 intracellular domain comprises AGGAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCCCGGAGGCCTGGCCCCACCCGGAAGCACTACCAGCCTACGCCCCTCCCAGGGATTTCGCCGCCTACCGGAGC (SEQ ID NO: 38) The gene is encoded by a nucleotide sequence comprising:

[0296] In some embodiments, the stimulatory domain comprises a 4-1BB intracellular domain. In some embodiments, the 4-1BB intracellular domain comprises or is identical to an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to the sequence of KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 39). In some embodiments, the 4-1BB intracellular domain comprises or consists essentially of KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 39). In some embodiments, the 4-1BB intracellular domain is encoded by a nucleotide sequence comprising AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGGCCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG (SEQ ID NO: 40).

[0297] Inhibitory domain The present disclosure provides inhibitory intracellular domains that can be fused to the transmembrane or intracellular domain of any of the TCR subunits to generate inhibitory TCRs.

[0298] In some embodiments, the inhibitory intracellular domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, the inhibitory intracellular domain comprising an ITIM can be isolated or derived from immune checkpoint inhibitors such as CTLA-4 and PD-1. CTLA-4 and PD-1 are immune inhibitory receptors expressed on the surface of T cells and play a central role in attenuating or terminating T cell responses.

[0299] Inhibitory domains can be isolated from the human tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor and CD200 receptor 1.

[0300] In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane domain, or a combination thereof. In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane domain, a hinge region, or a combination thereof. In some embodiments, the inhibitory domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, ITIM-containing inhibitory domains can be isolated or derived from immune checkpoint inhibitors such as CTLA-4 and PD-1.

[0301] The inhibitory domain can be isolated from the human tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor and CD200 receptor 1. In some embodiments, the inhibitory domain is isolated or derived from a human protein, such as a human TRAIL receptor, CTLA-4, or PD-1 protein. In some embodiments, the TRAIL receptor comprises TR10A, TR10B, or TR10D.

[0302] Endogenous TRAIL is expressed as a 281-amino acid type II transmembrane protein that is anchored to the plasma membrane and displayed on the cell surface. TRAIL is expressed by natural killer cells, which can induce TRAIL-dependent apoptosis in target cells after the establishment of cell-to-cell contact. Physiologically, the TRAIL signaling system has been shown to be essential for immune surveillance, for the construction of the immune system by regulating T helper cell 1 in addition to T helper cell 2 to "helpless" CD8+ T cell numbers, and for the suppression of spontaneous tumor formation.

[0303] In some embodiments, the inhibitory domain comprises an intracellular domain isolated or derived from the CD200 receptor. The cell surface glycoprotein CD200 receptor 1 (Uniprot ref: Q8TD46) represents another example of an inhibitory intracellular domain of the present invention. This inhibitory receptor of the CD200 / OX2 cell surface glycoprotein limits inflammation by inhibiting the expression of proinflammatory molecules, including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS), in response to selected stimuli.

[0304] In some embodiments, the engineered receptor comprises killer cell immunoglobulin-like receptor, three Ig domains and a long cytoplasmic tail 2 (KIR3DL2), killer cell immunoglobulin-like receptor, three Ig domains and a long cytoplasmic tail 3 (KIR3DL3), leukocyte immunoglobulin-like receptor B1 (LIR1), programmed death 1 (PD-1), Fc gamma receptor IIB (FcgRIIB), killer cell lectin-like receptor K1 (NKG2D), CTLA-4, a domain containing a synthetic consensus ITIM, a ZAP70 SH2 domain (e.g., one or both of the N-terminal and C-terminal SH2 domains), or an inhibitory domain isolated or derived from ZAP70 KI_K369A (kinase-inactive ZAP70).

[0305] In some embodiments, the inhibitory domain is isolated or derived from a human protein.

[0306] In some embodiments, the second inhibitory receptor comprises a cytoplasmic domain and a transmembrane domain isolated or derived from the same protein, e.g., an ITIM-containing protein. In some embodiments, the second inhibitory receptor comprises a cytoplasmic domain, a transmembrane domain, and an extracellular domain, or portions thereof, isolated or derived from the same protein, e.g., an ITIM-containing protein. In some embodiments, the second inhibitory receptor comprises an intracellular domain and / or a transmembrane domain and a hinge region isolated or derived from the same protein, e.g., an ITIM-containing protein.

[0307] In some embodiments, the engineered second receptor is a TCR comprising an inhibitory domain (inhibitory TCR). In some embodiments, the inhibitory TCR comprises an inhibitory intracellular domain and / or an inhibitory transmembrane domain. In some embodiments, the inhibitory intracellular domain is fused to the intracellular domain of TCR alpha, TCR beta, CD3 delta, CD3 gamma, or CD3 epsilon, or a portion thereof of a TCR. In some embodiments, the inhibitory intracellular domain is fused to the transmembrane domain of TCR alpha, TCR beta, CD3 delta, CD3 gamma, or CD3 epsilon.

[0308] In some embodiments, the engineered second receptor is a TCR that comprises an inhibitory domain (an inhibitory TCR). In some embodiments, the inhibitory domain is isolated or derived from LILRB1.

[0309] LILRB1 inhibitory receptor The present disclosure provides a second inhibitory receptor comprising a LILRB1 inhibitory domain and, optionally, a LILRB1 transmembrane and / or hinge domain, or a functional variant thereof. The inclusion of the LILRB1 transmembrane domain and / or LILRB1 hinge domain in an inhibitory receptor may increase the inhibitory signal generated by the inhibitory receptor compared to a reference inhibitory receptor having a different transmembrane domain or a different hinge domain. The second inhibitory receptor comprising the LILRB1 inhibitory domain may be a CAR or TCR as described herein. Any suitable ligand-binding domain as described herein may be fused to the LILRB1-based second inhibitory receptor.

[0310] Leukocyte immunoglobulin-like receptor subfamily B member 1 (LILRB1), also known as leukocyte immunoglobulin-like receptor B1, ILT2, LIR1, MIR7, PIRB, CD85J, ILT-2, LIR-1, MIR-7, and PIR-B, is a member of the leukocyte immunoglobulin-like receptor (LIR) family. The LILRB1 protein belongs to the subfamily B class of LIR receptors. These receptors contain two to four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The LILRB1 receptor is expressed on immune cells, where it binds to MHC class I molecules on antigen-presenting cells and transmits negative signals that inhibit stimulation of the immune response. LILRB1 is thought to play a role in regulating inflammatory responses, cytotoxicity, and limiting autoreactivity. Multiple transcript variants encoding different isoforms of LILRB1 exist, all of which are contemplated within the scope of the present disclosure.

[0311] In some embodiments of the inhibitory receptors described herein, the inhibitory receptor comprises one or more domains isolated or derived from LILRB1. In some embodiments of receptors having one or more domains isolated or derived from LILRB1, one or more domains of LILRB1 comprise an amino acid sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to or identical to the sequence or subsequence of SEQ ID NO:65. In some embodiments, one or more domains of LILRB1 comprise an amino acid sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to or identical to the sequence or subsequence of SEQ ID NO:65. In some embodiments, one or more domains of LILRB1 consist of ...

[0312] In some embodiments of receptors having one or more domains isolated or derived from LILRB1, one or more domains of LILRB1 are encoded by a polynucleotide sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical to or identical to the sequence or subsequence of SEQ ID NO:66.

[0313] In some embodiments of a receptor having one or more domains of LILRB1, the one or more domains of LILRB1 are encoded by a polynucleotide sequence that is identical to the sequence or subsequence of SEQ ID NO:66.

[0314] In various embodiments, an inhibitory receptor comprising a polypeptide is provided, wherein the polypeptide comprises one or more of a LILRB1 hinge domain or a functional fragment or variant thereof, a LILRB1 transmembrane domain or a functional variant thereof, and a LILRB1 intracellular domain or an intracellular domain comprising at least one, or at least two immunoreceptor tyrosine-based inhibition motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0315] As used herein, "immunoreceptor tyrosine-based inhibitory motif" or "ITIM" refers to a conserved sequence of amino acids, such as having the consensus sequence S / I / V / LxYxxI / V / L (SEQ ID NO: 274), which is found in the cytoplasmic tails of many inhibitory receptors of the immune system. After inhibitory receptors having an ITIM interact with their ligand, the ITIM motif becomes phosphorylated, allowing the inhibitory receptor to recruit other enzymes, such as the phosphotyrosine phosphatases SHP-1 and SHP-2, or an inositol-phosphatase called SHIP.

[0316] In some embodiments, the polypeptide comprises an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibitory motif (ITIM), at least two ITIMs, at least three ITIMs, at least four ITIMs, at least five ITIMs, or at least six ITIMs. In some embodiments, the intracellular domain has 1, 2, 3, 4, 5, or 6 ITIMs.

[0317] In some embodiments, the polypeptide comprises an intracellular domain comprising at least one ITIM selected from the group of ITIMs consisting of NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0318] In more specific embodiments, the polypeptide comprises an intracellular domain comprising at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0319] In some embodiments, the intracellular domain comprises both the ITIMs NLYAAV (SEQ ID NO:67) and VTYAEV (SEQ ID NO:68). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:71. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO:71.

[0320] In some embodiments, the intracellular domain comprises both ITIMs VTYAEV (SEQ ID NO:68) and VTYAQL (SEQ ID NO:69). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:72. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO:72.

[0321] In some embodiments, the intracellular domain comprises both the ITIMs VTYAQL (SEQ ID NO:69) and SIYATL (SEQ ID NO:70). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:73. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO:73.

[0322] In some embodiments, the intracellular domain comprises the ITIMs NLYAAV (SEQ ID NO:67), VTYAEV (SEQ ID NO:68), and VTYAQL (SEQ ID NO:69). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:74. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO:74.

[0323] In some embodiments, the intracellular domain comprises the ITIMs VTYAEV (SEQ ID NO:68), VTYAQL (SEQ ID NO:69), and SIYATL (SEQ ID NO:70). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:75. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO:75.

[0324] In some embodiments, the intracellular domain comprises the ITIMs NLYAAV (SEQ ID NO:67), VTYAEV (SEQ ID NO:68), VTYAQL (SEQ ID NO:69), and SIYATL (SEQ ID NO:70). In embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO:76. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO:76.

[0325] In some embodiments, the intracellular domain comprises a sequence at least 95% identical to the LILRB1 intracellular domain (SEQ ID NO: 81). In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to the LILRB1 intracellular domain (SEQ ID NO: 81).

[0326] The LILRB1 intracellular domain or functional variant thereof of the present disclosure may have at least 1, at least 2, at least 4, at least 4, at least 5, at least 6, at least 7, or at least 8 ITIMs. In some embodiments, the LILRB1 intracellular domain or functional variant thereof has 2, 3, 4, 5, or 6 ITIMs.

[0327] In certain embodiments, the intracellular domain comprises two, three, four, five, or six immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0328] In certain embodiments, the intracellular domain comprises at least three immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0329] In certain embodiments, the intracellular domain comprises three immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0330] In certain embodiments, the intracellular domain comprises four immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0331] In certain embodiments, the intracellular domain comprises five immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0332] In certain embodiments, the intracellular domain comprises six immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0333] In certain embodiments, the intracellular domain comprises at least seven immunoreceptor tyrosine-based inhibitory motifs (ITIMs), each ITIM independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0334] The LILRB1 protein has four immunoglobulin (Ig)-like domains designated D1, D2, D3, and D4. In some embodiments, the LILRB1 hinge domain comprises a LILRB1 D3D4 domain or a functional variant thereof. In some embodiments, the LILRB1 D3D4 domain comprises a sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to or identical to SEQ ID NO:77. In some embodiments, the LILRB1 D3D4 domain comprises or consists essentially of SEQ ID NO:77.

[0335] In some embodiments, the polypeptide comprises a LILRB1 hinge domain or a functional fragment or variant thereof. In embodiments, the LILRB1 hinge domain or a functional fragment or variant thereof comprises a sequence that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to or identical to SEQ ID NO:84, SEQ ID NO:77, or SEQ ID NO:78. In embodiments, the LILRB1 hinge domain or a functional fragment or variant thereof comprises a sequence that is at least 95% identical to SEQ ID NO:84, SEQ ID NO:77, or SEQ ID NO:78.

[0336] In some embodiments, the LILRB1 hinge domain comprises a sequence identical to SEQ ID NO:84, SEQ ID NO:77, or SEQ ID NO:78.

[0337] In some embodiments, the LILRB1 hinge domain consists essentially of a sequence identical to SEQ ID NO:84, SEQ ID NO:77, or SEQ ID NO:78.

[0338] In some embodiments, the transmembrane domain is a LILRB1 transmembrane domain or a functional variant thereof. In some embodiments, the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical to SEQ ID NO:85. In some embodiments, the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO:85. In some embodiments, the LILRB1 transmembrane domain comprises a sequence identical to SEQ ID NO:85. In embodiments, the LILRB1 transmembrane domain consists essentially of a sequence identical to SEQ ID NO:85.

[0339] In some embodiments, the transmembrane domain can be connected to the extracellular region of the second inhibitory receptor, e.g., the antigen-binding domain or the ligand-binding domain, by a hinge, e.g., a hinge derived from a human protein. For example, in some embodiments, the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, a CD8a hinge, or a LILRB1 hinge.

[0340] In some embodiments, the second inhibitory receptor comprises an inhibitory domain. In some embodiments, the second inhibitory receptor comprises an inhibitory intracellular domain and / or an inhibitory transmembrane domain. In some embodiments, the inhibitory domain is isolated or derived from LILR1B.

[0341] Inhibitory receptors containing combinations of LILRB1 domains In some embodiments, the LILRB1-based inhibitory receptors of the present disclosure comprise two or more LILRB1 domains or functional equivalents thereof, for example, in some embodiments, the inhibitory receptor comprises a LILRB1 transmembrane domain and an intracellular domain, or a LILRB1 hinge domain, a transmembrane domain, and an intracellular domain.

[0342] In certain embodiments, the inhibitory receptor comprises a LILRB1 hinge domain, or a functional fragment or variant thereof, and a LILRB1 transmembrane domain, or a functional variant thereof. In some embodiments, the polypeptide comprises a sequence that is at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, or identical to SEQ ID NO: 79. In some embodiments, the polypeptide comprises a sequence that is at least 95% identical to SEQ ID NO: 79. In some embodiments, the polypeptide comprises a sequence that is identical to SEQ ID NO: 79.

[0343] In further embodiments, the inhibitory receptor comprises a LILRB1 transmembrane domain or a functional variant thereof, and a LILRB1 intracellular domain and / or an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibition motif (ITIM), wherein the ITIM is selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70). In some embodiments, the polypeptide comprises a LILRB1 transmembrane domain or a functional variant thereof, and a LILRB1 intracellular domain and / or an intracellular domain comprising at least two ITIMs, wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

[0344] In some embodiments, the inhibitory receptor comprises a LILRB1 transmembrane domain and an intracellular domain. In some embodiments, the polypeptide comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, or identical to SEQ ID NO: 80. In some embodiments, the polypeptide comprises a sequence at least 95% identical to SEQ ID NO: 80. In some embodiments, the polypeptide comprises a sequence identical to SEQ ID NO: 80. In some embodiments, the inhibitory receptor comprises a LILRB1 transmembrane domain and an intracellular domain of SEQ ID NO: 80 fused to an extracellular ligand-binding domain. In some embodiments, the inhibitory receptor comprises a first polypeptide comprising SEQ ID NO: 80 fused to a TCR alpha variable domain and a second polypeptide comprising SEQ ID NO: 80 fused to a TCR beta variable domain.

[0345] In a preferred embodiment, the inhibitory receptor comprises a LILRB1 hinge domain or a functional fragment or variant thereof, a LILRB1 transmembrane domain or a functional variant thereof, and a LILRB1 intracellular domain and / or an intracellular domain comprising at least two immunoreceptor tyrosine-based inhibition motifs (ITIMs), each ITIM independently selected from LYAAV (SEQ ID NO: 67), VTYAE (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 11).

[0346] In some embodiments, the inhibitory receptor comprises a sequence at least 95% identical to SEQ ID NO:82 or SEQ ID NO:83, or a sequence at least 99% identical to SEQ ID NO:82 or SEQ ID NO:83, or a sequence identical to SEQ ID NO:82 or SEQ ID NO:83.

[0347] In some embodiments, the polypeptide comprises a sequence at least 99% identical to SEQ ID NO:79, or a sequence at least 99% identical to SEQ ID NO:79, or a sequence identical to SEQ ID NO:79.

[0348] In some embodiments, the polypeptide comprises a sequence at least 99% identical to SEQ ID NO:80, or a sequence at least 99% identical to SEQ ID NO:80, or a sequence identical to SEQ ID NO:80.

[0349] [Table 13-1] [Table 13-2] [Table 13-3]

[0350] Linker In some embodiments, the engineered receptor comprises a linker that connects two domains of the engineered receptor. Provided herein are linkers that, in some embodiments, can be used to connect domains of the engineered receptors described herein.

[0351] The terms "linker" and "flexible polypeptide linker" as used in the context of linking protein domains, e.g., intracellular domains or domains within an scFv, refer to a peptide linker consisting of amino acids, such as glycine and / or serine residues, used alone or in combination to link two domains together.

[0352] Any linker may be used, and many types of linkers for fusion proteins are known. For example, the linker may be flexible or rigid. Non-limiting examples of rigid and flexible linkers are provided in Chen et al. (Adv Drug Deliv Rev. 2013;65(10):1357-1369).

[0353] The antigen binding domains described herein may be linked to each other in a random or specific order.

[0354] The antigen-binding domains described herein may be linked to each other in any direction from N-terminus to C-terminus.

[0355] In some cases, a short oligo- or polypeptide linker, for example, 2 to 40 amino acids (eg, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) in length, may form the link between the domains.

[0356] In some embodiments, the linker is a peptide of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more than 30 amino acid residues. Non-limiting examples of amino acids found in a linker include Gly, Ser, Glu, Gin, Ala, Leu, Iso, Lys, Arg, Pro, etc. In some embodiments, the linker is [(Gly)n1Ser]n2, where n1 and n2 can be any number (e.g., n1 and n2 can independently be 1, 2, 4, 5, 6, 7, 8, 9, 10, or more than 10). In some embodiments, n1 is 4.

[0357] In some embodiments, the flexible polypeptide linker is a Gly / Ser linker and comprises the amino acid sequence (Gly-Gly-Ser), (Gly-Gly-Gly-Ser, SEQ ID NO: 231), or (Gly-Gly-Gly-Gly-Ser, SEQ ID NO: 226), which may be repeated n times, where n is a positive integer greater than or equal to 1. For example, n=1, n=2, n=3, n=4, n=5, n=6, n=7, n=8, n=9, and n=10. In some embodiments, flexible polypeptide linkers include, but are not limited to, GGS, GGGGS (SEQ ID NO: 226), GGGGS GGGGS (SEQ ID NO: 227), GGGGS GGGGS GGGGS (SEQ ID NO: 228), GGGGS GGGGS GGGGS GG (SEQ ID NO: 229), or GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 230).

[0358] In some embodiments, the linker comprises multiple repeats of (Gly Gly Ser), (Gly Ser) or (Gly Gly Gly Ser (SEQ ID NO: 231)). Also included within the scope of the present invention are linkers described in WO2012 / 138475, which is incorporated herein by reference.

[0359] In some embodiments, the linker sequence comprises a long linker (LL) sequence. In some embodiments, the long linker sequence comprises four repeats of GGGGS (SEQ ID NO: 226). In some embodiments, GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 230) is used to link the intracellular domains in the TCR alpha fusion proteins of the present disclosure.

[0360] In some embodiments, the long linker sequence comprises three repeats of GGGGS (SEQ ID NO: 226). In some embodiments, GGGGS GGGGS GGGGS (SEQ ID NO: 228) is used to link the intracellular domains in the TCR beta fusion proteins of the present disclosure.

[0361] In some embodiments, the linker sequence comprises a short linker (SL) sequence. In some embodiments, the short linker sequence comprises GGGGS (SEQ ID NO: 226).

[0362] In some embodiments, a glycine-serine doublet may be used as a suitable linker.

[0363] In some embodiments, the domains are fused directly to each other by peptide bonds without the use of a linker.

[0364] Assay Provided herein are assays that can be used to measure the activity of the engineered receptors of the present disclosure.

[0365] The activity of engineered receptor can be measured using engineered cell line to express receptor activity reporter, such as luciferase reporter.Exemplary cell line includes Jurkat T cell, but any suitable cell line known in the art can be used.For example, Jurkat cell expressing luciferase reporter under the control of NFAT promoter can be used as effector cell.The expression of luciferase by this cell line reflects TCR-mediated signal transduction.

[0366] Reporter cells can be transfected with each of the various fusion protein constructs, combinations of fusion protein constructs or controls described herein.

[0367] Expression of the fusion protein in the reporter cells can be confirmed by detecting the expression of the fusion protein using a fluorescently labeled MHC tetramer, for example, an Alexa Fluor 647-labeled NY-ESO-1-MHC tetramer.

[0368] To assay the activity of the engineered receptor, target cells are loaded with an antigen before being exposed to effector cells containing a reporter and an engineered receptor. For example, target cells can be loaded with an antigen at least 12, 14, 16, 18, 20, 22, or 24 hours before exposure to effector cells. Exemplary target cells include A375 cells, but any suitable cells known in the art can be used. In some cases, target cells can be loaded with serially diluted concentrations of antigen, such as NY-ESO-1 peptide. The effector cells can then be co-cultured with the target cells for a suitable period, such as 6 hours. Luciferase is then measured by luminescence reading after co-culture. Luciferase luminescence can be normalized based on maximum and minimum intensity, allowing for comparison of the activating peptide concentration of each engineered receptor construct.

[0369] Provided herein is a method for determining the relative EC50 of an engineered receptor of the present disclosure. As used herein, "EC50" refers to the concentration of an inhibitor or drug at which the response (or binding) is reduced by half. The EC50 of an engineered receptor of the present disclosure refers to the concentration of antigen at which binding between the engineered receptor and the antigen is reduced by half. Binding of an antigen or probe to an engineered receptor can be measured by staining with a labeled peptide or labeled peptide-MHC complex, such as an MHC:NY-ESO-1 pMHC complex conjugated to a fluorophore. EC50 can be obtained by nonlinear regression curve fitting of reporter signals from peptide titration. Probe binding and EC50 can be normalized to the level of a benchmark TCR, such as NY-ESO-1 (clone 1G4), without the fusion protein.

[0370] Polynucleotides The present disclosure provides polynucleotides that encode the sequence(s) of the engineered receptors described herein.

[0371] In some embodiments, the sequence of the first and / or second fusion protein is operably linked to a promoter, hi some embodiments, the sequence encoding the first fusion protein is operably linked to a first promoter and the sequence encoding the second fusion protein is operably linked to a second promoter.

[0372] The present disclosure provides vectors comprising the polynucleotides described herein.

[0373] The present disclosure provides vectors encoding the coding sequence(s) of any of the engineered receptors described herein. In some embodiments, the sequence of the first and / or second fusion protein is operably linked to a promoter. In some embodiments, the sequence encoding the first fusion protein is operably linked to a first promoter and the sequence encoding the second fusion protein is operably linked to a second promoter.

[0374] In some embodiments, the first engineered receptor is encoded by a first vector and the second engineered receptor is encoded by a second vector, hi some embodiments, both engineered receptors are encoded by a single vector.

[0375] In some embodiments, the first and second receptors are encoded by a single vector. Methods for encoding multiple polypeptides using a single vector will be known to those of skill in the art and include, among other things, encoding multiple polypeptides under the control of different promoters, or, when a single promoter is used to control transcription of multiple polypeptides, the use of internal ribosome entry sites (IRES) and / or self-cleaving peptide-encoding sequences. Exemplary self-cleaving peptides include the T2A, P2A, E2A, and F2A self-cleaving peptides. In some embodiments, the T2A self-cleaving peptide comprises the sequence EGRGSLLTCGDVEENPGP (SEQ ID NO: 271). In some embodiments, the P2A self-cleaving peptide comprises the sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO: 192). In some embodiments, the E2A self-cleaving peptide comprises the sequence QCTNYALLKLAGDVESNPGP (SEQ ID NO: 272). In some embodiments, the F2A self-cleaving peptide comprises the sequence VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 273).

[0376] In some embodiments, the vector is an expression vector, ie, directed to expression of the fusion protein in a suitable cell.

[0377] Vectors derived from retroviruses, such as lentiviruses, are suitable tools for achieving long-term gene transfer because they allow stable long-term integration of the transgene and its propagation in daughter cells. Lentiviral vectors have an additional advantage over vectors derived from oncoretroviruses, such as murine leukemia viruses, in that they can transduce non-proliferating cells, such as hepatocytes. They also have the additional advantage of low immunogenicity.

[0378] Expression of natural or synthetic nucleic acids encoding fusion proteins is typically achieved by operably linking the nucleic acid encoding the fusion protein or a portion thereof to a promoter and incorporating the construct into an expression vector. The vector may be suitable for replication and integration in eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for controlling the expression of the desired nucleic acid sequence.

[0379] The polynucleotide encoding the fusion protein can be cloned into many types of vectors. For example, the polynucleotide can be cloned into vectors including, but not limited to, plasmids, phagemids, phage derivatives, animal viruses, and cosmids. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

[0380] Furthermore, the expression vector may be provided to cells, such as immune cells, in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) and other virology and molecular biology manuals. Viruses useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains a functional origin of replication in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (e.g., WO01 / 96584, WO01 / 29058, and U.S. Patent No. 6,326,193).

[0381] Many virus-based systems have been developed for gene transfer into mammalian cells.For example, retrovirus provides a convenient platform for gene delivery systems.Selected genes can be inserted into vectors using techniques known in the art and packaged into retroviral particles.Recombinant viruses can then be isolated and delivered to target cells either in vivo or ex vivo.Many retroviral systems are known in the art.In some embodiments, adenoviral vectors are used.Many adenoviral vectors are known in the art.In one embodiment, lentiviral vectors are used.

[0382] Additional promoter elements, such as enhancers, regulate the frequency of transcription initiation. They are typically located 30–110 base pairs (bp) upstream of the start site, although recent studies have shown that many promoters contain functional elements downstream of the start site as well. The spacing between promoter elements is frequently flexible, allowing promoter function to be maintained even when elements are inverted or moved relative to one another. In the thymidine kinase (TK) promoter, the spacing between promoter elements can increase to 50 bp before activity begins to decline. Depending on the promoter, individual elements may function either cooperatively or independently to activate transcription.

[0383] One example of a suitable promoter is the immediate-early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of inducing high-level expression of any polynucleotide sequence operably linked to it. Another example of a suitable promoter is elongation growth factor-1α (EF-1α). However, other constitutive promoter sequences may also be used, including the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, avian leukosis virus promoter, Epstein-Barr virus immediate-early promoter, and Rous sarcoma virus promoter, as well as human gene promoters, such as, but not limited to, the actin promoter, myosin promoter, hemoglobin promoter, and creatine kinase promoter. Furthermore, the present invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the present invention. The use of an inducible promoter provides a molecular switch that can turn on expression of a polynucleotide sequence to which the promoter is operably linked when such expression is desired, or turn off expression when expression is undesirable. Examples of inducible promoters include, but are not limited to, metallothionine promoters, glucocorticoid promoters, progesterone promoters, and tetracycline promoters.

[0384] To assess fusion protein expression, the expression vector introduced into cells may also contain either a selectable marker gene or a reporter gene, or both, to facilitate identification and selection of expressing cells from a population of cells desired to be transfected or infected with the viral vector. In other embodiments, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both the selectable marker and the reporter gene may be adjacent to appropriate regulatory sequences to enable expression in the host cell. Useful selectable markers include, for example, antibiotic resistance genes, such as neo.

[0385] Reporter genes are used to identify potential transfected or transduced cells and evaluate the functionality of regulatory sequences. Generally, reporter genes are genes encoding polypeptides that are not present in or expressed by recipient organisms or tissues, and whose expression is manifested by some easily detectable characteristic, such as enzymatic activity. The expression of the reporter gene is assayed at a suitable time after the DNA is introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyltransferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479:79-82). Suitable expression systems are well known and may be prepared using known techniques or commercially available. Generally, the construct with the smallest 5' flanking region that exhibits the highest level of reporter gene expression is identified as the promoter. Such promoter regions may be linked to reporter genes and used to evaluate drugs for their ability to modulate promoter-driven transcription.

[0386] Methods for introducing and expressing genes in cells are known in the art. In the context of expression vectors, the vectors can be easily introduced into host cells, such as mammalian, bacterial, yeast, or insect cells, by any method in the art. For example, expression vectors can be transferred into host cells by physical, chemical, or biological means.

[0387] Physical methods for introducing polynucleotides into host cells include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, etc. Methods for generating cells containing vectors and / or exogenous nucleic acids are well known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). One method for introducing polynucleotides into host cells is calcium phosphate transfection.

[0388] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, particularly retroviral vectors, have become the most widely used method for inserting genes into mammalian cells, e.g., human cells. Other viral vectors can be derived from lentiviruses, poxviruses, herpes simplex virus I, adenoviruses, and adeno-associated viruses, etc. See, e.g., U.S. Patent Nos. 5,350,674 and 5,585,362.

[0389] Chemical means for introducing polynucleotides into host cells include colloidal dispersion systems, such as macromolecular complexes, nanocapsules, microspheres, beads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).

[0390] Regardless of the method used to introduce exogenous nucleic acid into host cells or otherwise expose the cells to an inhibitor of the invention, various assays may be performed to confirm the presence of the recombinant DNA sequence in the host cells. Such assays include, for example, "molecular biological" assays well known to those skilled in the art, such as Southern and Northern blotting, RT-PCR and PCR, "biochemical" assays, such as detecting the presence or absence of specific peptides by immunological means (ELISA and Western blot), or by the assays described herein to identify agents within the scope of the invention.

[0391] immune cells Provided herein are immune cells comprising the polynucleotides, vectors, fusion proteins and engineered receptors described herein.

[0392] As used herein, the term "immune cells" refers to cells involved in the innate or adaptive (acquired) immune system. Exemplary innate immune cells include phagocytes, such as neutrophils, monocytes, and macrophages, natural killer (NK) cells, polymorphonuclear leukocytes, such as neutrophils, eosinophils, and basophils, and mononuclear cells, such as monocytes, macrophages, and mast cells. Immune cells involved in adaptive immunity include lymphocytes, such as T cells and B cells.

[0393] As used herein, "T cell" refers to a type of lymphocyte derived from myeloid precursors that develop in the thymus. There are several different types of T cells that develop upon migration to the thymus, including helper CD4+ T cells, cytotoxic CD8+ T cells, memory T cells, regulatory CD4+ T cells, and stem memory T cells. Different types of T cells can be distinguished by one skilled in the art based on the expression of their markers. Methods for distinguishing between T cell types will be readily apparent to one skilled in the art.

[0394] In some embodiments, the engineered immune cells express the first and second receptors at a ratio of about 100:1 to 1:100. In some embodiments, the engineered immune cells express the first and second receptors at a ratio of about 50:1 to 1:50. In some embodiments, the engineered immune cells express the first and second receptors at a ratio of about 10:1 to 1:10. In some embodiments, the engineered immune cells express the first and second receptors at a ratio of about 5:1 to 1:5. In some embodiments, the engineered immune cells express the first and second receptors at a ratio of about 3:1 to 1:3. In some embodiments, the engineered immune cells express the first and second receptors at a ratio of about 2:1 to 1:2. In some embodiments, the engineered immune cells express the first and second receptors in a ratio of about 1:1.

[0395] In some embodiments, the engineered immune cells comprising the engineered receptors of the present disclosure are T cells. In some embodiments, the T cells are effector T cells or regulatory T cells.

[0396] Methods for transducing populations of immune cells, such as T cells, with vectors of the present disclosure will be readily apparent to those skilled in the art. For example, CD3+ T cells can be isolated from PBMCs using a CD3+ T cell negative isolation kit (Miltenyi) according to the manufacturer's instructions. T cells can be cultured at a density of 1 x 10^6 cells / mL in X-Vivo15 medium supplemented with 5% human A / B serum and 1% Pen / strep in the presence of CD3 / 28 Dynabeads (1:1 cell-to-bead ratio) and 300 units / mL of IL-2 (Miltenyi). After two days, T cells can be transduced with a viral vector, such as a lentiviral vector, using methods known in the art. In some embodiments, the viral vector is transduced at a multiplicity of infection (MOI) of 5. Cells can then be cultured for an additional five days before enrichment in IL-2 or other cytokines, such as a combination of IL-7 / 15 / 21. Methods for isolating and culturing other immune cell populations, such as B cells, or other T cell populations, will be readily apparent to those skilled in the art. While the present method outlines a potential approach, it should be noted that these techniques are rapidly evolving. For example, successful viral transduction of peripheral blood mononuclear cells can be achieved after 5 days of expansion, generating a highly transduced cell population that is greater than 99% CD3+.

[0397] Methods for activating and culturing T cell populations containing engineered TCRs, CARs, fusion proteins, or vectors encoding the fusion proteins of the present disclosure will be readily apparent to one of skill in the art.

[0398]

[0013] Whether prior to or after T cell genetic modification to express an engineered TCR, the T cells may be engineered to express a TCR, as described, for example, in U.S. Patent Nos. 6,352,694, 6,534,055, 6,905,680, 6,692,964, 5,858,358, 6,887,466, 6,905,681, 7,144,575, 7,067, 318, 7,172,869, 7,232,566, 7,175,843, 5,883,223, 6,905,874, 6,797,514, 6,867,041, 10040846, and U.S. Patent Application Publication No. 2006 / 0121005.

[0399] In some embodiments, T cells of the present disclosure are expanded and activated in vitro. Generally, T cells of the present disclosure are expanded in vitro by contact with an agent that stimulates CD3 / TCR complex-associated signals and a surface bound to a ligand that stimulates a costimulatory molecule on the surface of the T cells. In particular, a T cell population may be stimulated as described herein, such as by contact with an anti-CD3 antibody. For costimulation of an accessory molecule on the surface of the T cells, a ligand that binds to the accessory molecule is used. For example, a T cell population may be contacted with an anti-CD3 antibody and an anti-CD28 antibody under conditions suitable for stimulating T cell proliferation. An anti-CD3 antibody and an anti-CD28 antibody may be used to stimulate proliferation of either CD4+ T cells or CD8+ T cells. Examples of anti-CD28 antibodies include 9.3, B-T3, and XR-CD28 (Diaclone, Besancon, France), and can be used as well as other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol Meth. 227(1-2):53-63, 1999).

[0400] In some embodiments, the primary and costimulatory signals for T cells may be provided by different protocols. For example, the agents providing each signal may be in solution or may be bound to a surface. If bound to a surface, the agents may be bound to the same surface (i.e., in a "cis" configuration) or to separate surfaces (i.e., in a "trans" configuration). Alternatively, one agent may be bound to a surface and the other agent may be in solution. In some embodiments, the agent providing the costimulatory signal is bound to a cell surface, and the agent providing the primary activation signal is in solution or bound to a surface. In certain embodiments, both agents may be in solution. In other embodiments, the agents may be soluble and then crosslinked to a surface, such as a cell expressing an Fc receptor or antibody or other binding agent that will bind to the agent. In this regard, see, e.g., U.S. Patent Application Publication Nos. 20040101519 and 20060034810, for artificial antigen-presenting cells (aAPCs) contemplated for use in the activation and expansion of T cells in the present invention.

[0401] In some embodiments, the two agents are immobilized on beads either on the same bead, i.e., "cis," or on separate beads, i.e., "trans." For example, the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof, and the agent providing the costimulatory signal is an anti-CD28 antibody or an antigen-binding fragment thereof, with both agents co-immobilized on the same bead with comparable molecular weights. In one embodiment, a 1:1 ratio of antibodies bound to beads for CD4+ T cell proliferation and T cell growth is used. In some embodiments, the ratio of CD3:CD28 antibodies bound to beads ranges from 100:1 to 1:100, and all integer values ​​therebetween. In one aspect of the invention, more anti-CD28 antibodies than anti-CD3 antibodies are bound to the particles, i.e., the CD3:CD28 ratio is less than 1. In certain embodiments of the invention, the ratio of anti-CD28 antibodies to anti-CD3 antibodies bound to beads is greater than 2:1.

[0402] Particle-to-cell ratios of 1:500 to 500:1 and any integer value therebetween may be used to stimulate T cells or other target cells. As one of ordinary skill in the art will readily appreciate, the particle-to-cell ratio may depend on the particle size relative to the target cells. For example, small beads can bind only a few cells, while larger beads can bind many cells. In certain embodiments, the cell-to-particle ratio ranges from 1:100 to 100:1 and any integer value therebetween, and in further embodiments, ratios ranging from 1:9 to 9:1 and any integer value therebetween may also be used to stimulate T cells. In some embodiments, a 1:1 cell-to-bead ratio is used. One of ordinary skill in the art will appreciate that various other ratios may be suitable for use in the present invention. In particular, the ratio will vary depending on particle size, as well as cell size and cell type.

[0403] In a further embodiment of the invention, cells such as T cells are combined with drug-coated beads, followed by separation of the beads and cells, and then culturing the cells. In an alternative embodiment, the drug-coated beads and cells are not separated prior to culturing, but are cultured together. In a further embodiment, the beads and cells are first concentrated by applying a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.

[0404] As an example, cell surface proteins may be ligated by contacting T cells with paramagnetic beads conjugated with anti-CD3 and anti-CD28. In one embodiment, cells (e.g., CD4+ T cells) and beads (e.g., DYNABEADS CD3 / CD28 T paramagnetic beads in a 1:1 ratio) are combined in a buffer solution. Again, one of skill in the art will readily appreciate that any cell concentration may be used. In certain embodiments, it may be desirable to significantly reduce the volume in which the particles and cells are mixed together (i.e., increase the cell concentration) to ensure maximum contact between the cells and particles. For example, in one embodiment, a concentration of approximately 2 billion cells / ml is used. In another embodiment, greater than 100 million cells / ml is used. In further embodiments, cell concentrations of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells / ml are used. In yet other embodiments, cell concentrations of 75, 80, 85, 90, 95, or 100 million cells / ml are used. In further embodiments, concentrations of 125 or 150 million cells / ml may be used. In some embodiments, concentrations of 1 x 10 6 Cells cultured at a density of 1000 cells / mL are used.

[0405] In some embodiments, the mixture may be cultured for a few hours (about 3 hours) to about 14 days, or any integer value in between. In another embodiment, the beads and T cells are cultured together for 2 to 3 days. Suitable conditions for T cell culture include an appropriate medium (e.g., Minimal Essential Medium or RPMI Medium 1640 or X-vivo15 (Lonza)), which may contain factors necessary for growth and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-γ, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ, and TNF-α, or any other additives known to those skilled in the art for cell growth. Other additives for cell growth include, but are not limited to, detergents, plasmanate, and reducing agents, such as N-acetyl-cysteine ​​and 2-mercaptoethanol. Media can include RPMI1640, AIM-V, DMEM, MEM, α-MEM, F-12, X-Vivo15, and X-Vivo20, Optimizer, supplemented with amino acids, sodium pyruvate, and vitamins, and may be serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones and / or cytokine(s) in amounts sufficient for T cell growth and proliferation. In some embodiments, the media comprises X-VIVO-15 medium supplemented with 5% human A / B serum, 1% penicillin / streptomycin (pen / strep), and 300 units / ml of IL-2 (Miltenyi).

[0406] The T cells are maintained under conditions necessary to support growth, eg, an appropriate temperature (eg, 37° C.) and atmosphere (eg, air plus 5% CO 2 ).

[0407] In some embodiments, T cells comprising the engineered TCRs of the present disclosure are autologous. Prior to expansion and genetic modification, a source of T cells is obtained from the subject. Immune cells such as T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from an infection site, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available in the art may be used. In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to those skilled in the art, such as, for example, Ficoll™ separation.

[0408] In some embodiments, cells derived from an individual's circulating blood are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In some embodiments, cells collected by apheresis may be washed to remove the plasma fraction and place the cells in an appropriate buffer or medium for subsequent processing steps. In some embodiments, cells are washed with phosphate-buffered saline (PBS). In alternative embodiments, the wash solution lacks calcium, may lack magnesium, or may lack many, but not all, divalent cations. As will be readily understood by one of skill in the art, washing steps may be accomplished by methods known to those of skill in the art, such as by using a semi-automated "flow-through" centrifuge (e.g., a Cobe 2991 cell processing device, a Baxter CytoMate, or a Haemonetics Cell Saver 5) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as Ca2+-free PBS, Mg2+-free PBS, PlasmaLyte A, or other saline solutions with or without buffer. Alternatively, undesirable components of the apheresis sample may be removed and the cells resuspended directly in culture medium.

[0409] In some embodiments, immune cells such as T cells are isolated from peripheral blood lymphocytes by lysing red blood cells and depleting monocytes, for example, by centrifugation through a PERCOLL™ gradient or by counterflow centrifugal elutriation. Specific subpopulations of immune cells, such as T cells, B cells, or CD4+ T cells, can be further isolated by positive or negative selection techniques. For example, in one embodiment, T cells are isolated by incubation with anti-CD4-conjugated beads for a period sufficient for positive selection of the desired T cells.

[0410] Enrichment of immune cell populations, such as T cell populations, by negative selection can be achieved using a combination of antibodies directed against surface markers unique to the negatively selected cells. One method is cell sorting and / or selection by negative magnetic immunoadhesion or flow cytometry using a cocktail of monoclonal antibodies directed against cell surface markers present on the negatively selected cells. For example, to enrich CD4+ cells by negative selection, the monoclonal antibody cocktail typically includes antibodies against CD14, CD20, CD11b, CD16, HLA-DR, and CD8.

[0411] To isolate a desired immune cell population by positive or negative selection, the concentration of cells and surfaces (e.g., particles such as beads) can be varied. In certain embodiments, it may be desirable to significantly reduce the volume in which the beads and cells are mixed together (i.e., increase the cell concentration) to ensure maximum contact between the cells and the beads.

[0412] In some embodiments, cells may be incubated on a rotator at either 2-10° C. or room temperature for different lengths of time at various speeds.

[0413] PBMCs from which immune cells such as T cells for stimulation or T cells are isolated may also be frozen after a washing step. Without wishing to be bound by theory, the freezing step and subsequent thawing step provides a more uniform product by removing granulocytes and, to some extent, monocytes in the cell population. After a washing step to remove plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this regard, one method involves using PBS containing 20% ​​DMSO and 8% human serum albumin, or culture medium containing 10% dextran 40 and 5% dextrose, 20% human serum albumin, and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% dextrose 5%, 0.45% NaCl, 10% dextran 40 and 5% dextrose, 20% human serum albumin, and 7.5% DMSO, or other suitable cell freezing medium containing, for example, Hespan and PlasmaLyte A. The cells are then frozen to -80°C at a rate of 1°C / min and stored in the vapor phase of a liquid nitrogen storage tank. Other controlled freezing methods may be used, as well as immediate uncontrolled freezing at -20°C or in liquid nitrogen.

[0414] Pharmaceutical Composition The present disclosure provides a pharmaceutical composition comprising an immune cell comprising an engineered receptor of the present disclosure and a pharmaceutically acceptable diluent, carrier, or excipient.

[0415] Such compositions may include buffers, such as neutral buffered saline, phosphate buffered saline, etc., carbohydrates, such as glucose, mannose, sucrose or dextran, mannitol, etc., proteins, polypeptides or amino acids such as glycine, antioxidants, chelating agents such as EDTA or glutathione, and preservatives.

[0416] Methods for treating diseases Provided herein is a method of treating a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a composition comprising an immune cell comprising an engineered receptor of the present disclosure, wherein the immune cell expresses both engineered receptors within the same cell.

[0417] In some embodiments, the subject in need of treatment has cancer. Cancer is a disease in which abnormal cells divide uncontrollably and metastasize to nearby tissues. In some embodiments, the cancer comprises a liquid tumor or a solid tumor. Exemplary liquid tumors include leukemia and lymphoma. Additional cancers that are liquid tumors may be, for example, cancers that develop in the blood, bone marrow, and lymph nodes, and may include, for example, leukemia, myeloid leukemia, lymphocytic leukemia, lymphoma, Hodgkin's lymphoma, melanoma, and multiple myeloma. Leukemias include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), and hairy cell leukemia. Exemplary solid tumors include sarcomas and carcinomas. Cancer can occur in virtually any organ in the body, including blood, bone marrow, lung, breast, colon, bone, central nervous system, pancreas, prostate, and ovaries. Additional cancers that are solid tumors include, for example, prostate cancer, testicular cancer, breast cancer, brain cancer, pancreatic cancer, colon cancer, thyroid cancer, stomach cancer, lung cancer, ovarian cancer, Kaposi's sarcoma, skin cancer, squamous cell skin cancer, kidney cancer, head and neck cancer, pharynx cancer, squamous cell carcinoma that forms on the moist mucosal lining of the nose, mouth, and throat, bladder cancer, osteosarcoma, cervical cancer, endometrial cancer, esophageal cancer, liver cancer, and kidney cancer. In some embodiments, the condition treated by the methods described herein is metastasis of melanoma cells, prostate cancer cells, testicular cancer cells, breast cancer cells, brain cancer cells, pancreatic cancer cells, colon cancer cells, thyroid cancer cells, gastric cancer cells, lung cancer cells, ovarian cancer cells, Kaposi's sarcoma cells, skin cancer cells, renal cancer cells, head and neck cancer cells, pharyngeal cancer cells, squamous cell carcinoma cells, bladder cancer cells, osteosarcoma cells, cervical cancer cells, endometrial cancer cells, esophageal cancer cells, liver cancer cells, or kidney cancer cells.

[0418] Any cancer in which multiple cancer cells express a first activator ligand and do not express a second inhibitor ligand is contemplated within the scope of the present disclosure. For example, CEA-positive cancers that can be treated using the methods described herein include colorectal cancer, pancreatic cancer, esophageal cancer, gastric cancer, lung adenocarcinoma, head and neck cancer, diffuse large B-cell carcinoma, or acute myeloid leukemia cancer.

[0419] Treatment of cancer can result in a reduction in tumor size. A reduction in tumor size is sometimes referred to as "tumor regression." Preferably, after treatment, the tumor size is reduced by 5% or more compared to the tumor size before treatment, more preferably by 10% or more, more preferably by 20% or more, more preferably by 30% or more, more preferably by 40% or more, even more preferably by 50% or more, and most preferably by more than 75% or more. Tumor size may be measured by any reproducible measurement means. Tumor size may be measured as the diameter of the tumor.

[0420] Cancer treatment can result in a reduction in tumor volume.Preferably, after treatment, tumor volume is reduced by 5% or more compared to the tumor size before treatment, more preferably, tumor volume is reduced by 10% or more, more preferably, by 20% or more, more preferably, by 30% or more, more preferably, by 40% or more, even more preferably, by 50% or more, and most preferably, by more than 75% or more.Tumor volume can be measured by any reproducible measurement means.

[0421] Cancer treatment results in a decrease in tumor count. Preferably, after treatment, the tumor count is reduced by 5% or more compared to the count before treatment, more preferably by 10% or more, more preferably by 20% or more, more preferably by 30% or more, more preferably by 40% or more, even more preferably by 50% or more, and most preferably by more than 75%. The tumor count may be measured by any reproducible measurement means. The tumor count may be measured by counting tumors visible with the naked eye or at a specific magnification. Preferably, the specific magnification is 2x, 3x, 4x, 5x, 10x, or 50x.

[0422] Cancer treatment can result in a reduction in the number of metastatic lesions in other tissues or organs distant from the primary tumor site.Preferably, after treatment, the number of metastatic lesions is reduced by 5% or more compared to the number before treatment, more preferably by 10% or more, more preferably by 20% or more, more preferably by 30% or more, more preferably by 40% or more, even more preferably by 50% or more, and most preferably by more than 75%.The number of metastatic lesions can be measured by any reproducible measurement means.The number of metastatic lesions can be measured by counting the metastatic lesions visible with the naked eye or under a specific magnification.Preferably, the specific magnification is 2x, 3x, 4x, 5x, 10x, or 50x.

[0423] Cancer treatment can result in an increase in the average survival time of the treated subject population compared to the population that is administered with carrier alone.Preferably, the average survival time increases by more than 30 days, more preferably more than 60 days, more preferably more than 90 days, and most preferably more than 120 days.The increase in the average survival time of the population can be measured by any reproducible means.For example, the increase in the average survival time of the population can be measured by calculating the average survival time of the population after the start of treatment with active compound.The increase in the average survival time of the population can also be measured by, for example, calculating the average survival time of the population after the completion of the first round of treatment with active compound.

[0424] Cancer treatment can result in an increase in the average survival time of the treated subject population compared to the untreated subject population.Preferably, the average survival time increases by more than 30 days, more preferably more than 60 days, more preferably more than 90 days, and most preferably more than 120 days.The increase in the average survival time of the population can be measured by any reproducible means.For example, the increase in the average survival time of the population can be measured by calculating the average survival time of the population after the start of treatment with the active compound.The increase in the average survival time of the population can also be measured by, for example, calculating the average survival time of the population after the completion of the first round of treatment with the active compound.

[0425] Cancer treatment can result in an increase in the average survival time of the treated subject population compared to a population receiving monotherapy with a drug other than the compound of the present invention, or its pharmaceutically acceptable salt, prodrug, metabolite, analog or derivative.Preferably, the average survival time increases by more than 30 days, more preferably more than 60 days, more preferably more than 90 days, and most preferably more than 120 days.The increase in the average survival time of a population can be measured by any reproducible means.For example, the increase in the average survival time of a population can be measured by calculating the average survival time of the population after the start of treatment with the active compound.The increase in the average survival time of a population can also be measured by, for example, calculating the average survival time of the population after the completion of the first round of treatment with the active compound.

[0426] Treatment of cancer may result in a reduction in mortality in a treated subject population compared to a population administered with carrier alone. Treatment of cancer may result in a reduction in mortality in a treated subject population compared to an untreated population. Treatment of cancer may result in a reduction in mortality in a treated subject population compared to a population receiving monotherapy with a drug other than the compound of the present invention, or a pharmaceutically acceptable salt, prodrug, metabolite, analog, or derivative thereof. Preferably, the mortality rate is reduced by more than 2%, more preferably by more than 5%, more preferably by more than 10%, and most preferably by more than 25%. The reduction in mortality in a treated subject population may be measured by any reproducible means. The reduction in mortality in a population may be measured, for example, by calculating the average number of disease-related deaths per unit time for the population after the start of treatment with the active compound. The reduction in mortality in a population may also be measured, for example, by calculating the average number of disease-related deaths per unit time for the population after the completion of the first round of treatment with the active compound.

[0427] Cancer treatment can result in a decrease in tumor growth rate. Preferably, after treatment, tumor growth rate is reduced by at least 5% compared to the number before treatment, more preferably by at least 10%, more preferably by at least 20%, more preferably by at least 30%, more preferably by at least 40%, more preferably by at least 50%, even more preferably by at least 50%, and most preferably by at least 75%. Tumor growth rate can be measured by any reproducible measurement means. Tumor growth rate can be measured by the change in tumor diameter per unit time.

[0428] Cancer treatment can result in a reduction in tumor regrowth.Preferably, after treatment, tumor regrowth is less than 5%, more preferably tumor regrowth is less than 10%, more preferably less than 20%, more preferably less than 30%, more preferably less than 40%, more preferably less than 50%, even more preferably less than 50%, and most preferably less than 75%.Tumor regrowth can be measured by any reproducible measurement method.Tumor regrowth is measured, for example, by measuring the increase in tumor diameter after previous tumor shrinkage after treatment.A reduction in tumor regrowth is indicated by tumor not recurring after treatment is stopped.

[0429] Treatment or prevention of cell proliferation disorders can result in a decrease in cell proliferation rate. Preferably, after treatment, cell proliferation rate is reduced by at least 5%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 40%, more preferably at least 50%, even more preferably at least 50%, and most preferably at least 75%. Cell proliferation rate can be measured by any reproducible measurement method. For example, cell proliferation rate can be measured by measuring the number of dividing cells in a tissue sample per unit time.

[0430] Treatment or prevention of cell proliferation disorders can result in a decrease in the proportion of proliferating cells. Preferably, after treatment, the proportion of proliferating cells is reduced by at least 5%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 40%, more preferably at least 50%, even more preferably at least 50%, and most preferably at least 75%. The proportion of proliferating cells can be measured by any reproducible measurement means. Preferably, the proportion of proliferating cells is measured, for example, by quantifying the number of dividing cells compared to the number of non-dividing cells in a tissue sample. The proportion of proliferating cells can correspond to the mitotic index.

[0431] Treatment or prevention of cell proliferation disorders can result in a reduction in the size of the cell proliferation area or compartment. Preferably, after treatment, the size of the cell proliferation area or compartment is reduced by at least 5% compared to its size before treatment, more preferably by at least 10%, more preferably by at least 20%, more preferably by at least 30%, more preferably by at least 40%, more preferably by at least 50%, even more preferably by at least 50%, and most preferably by at least 75%. The size of the cell proliferation area or compartment may be measured by any reproducible measurement means. The size of the cell proliferation area or compartment may be measured as the diameter or width of the cell proliferation area or compartment.

[0432] Treatment or prevention of cell proliferation disorders can result in a decrease in the number or proportion of cells with abnormal appearance or morphology. Preferably, after treatment, the number of cells with abnormal morphology is reduced by at least 5% compared to their size before treatment, more preferably by at least 10%, more preferably by at least 20%, more preferably by at least 30%, more preferably by at least 40%, more preferably by at least 50%, even more preferably by at least 50%, and most preferably by at least 75%. Abnormal cell appearance or morphology can be measured by any reproducible measurement means. Abnormal cell morphology can be measured by microscopy, for example, using an inverted tissue culture microscope. Abnormal cell morphology can take the form of nuclear pleomorphism.

[0433] Kits and Products The present disclosure provides kits and articles of manufacture comprising polynucleotides and vectors encoding the engineered receptors described herein, and immune cells comprising the engineered receptors described herein. In some embodiments, the kits include items such as vials, syringes, and instructions for use.

[0434] In some embodiments, the kit comprises a polynucleotide or vector comprising a sequence encoding one or more engineered receptors of the present disclosure.

[0435] In some embodiments, the kit comprises a plurality of immune cells comprising an engineered receptor as described herein. In some embodiments, the plurality of immune cells comprises a plurality of T cells. [Example]

[0436] Example 1: Selection of activator targeting ligands We searched the GTex gene expression database (gtexportal.org / home / ) for activator ligands. Activator ligands should have the following properties: First, certain types of activator ligands should have high surface expression, which confers the potential for transmitting large activation signals. Alternatively, activators such as MiHA may be present at low density on the cell surface. Second, activator ligands may have essential cellular functions, which prevent the loss of activator ligand alleles due to tumor cell aneuploidy and reduce their likelihood of undergoing mutagenesis during tumor evolution. Finally, activator ligands should be present on all tumor cells. An activator ligand can be expressed on all cells if the inhibitor ligand is also expressed on all cells except target cells. Activators should also be expressed on cancer cells. When used in combination with an inhibitor, activators can be broadly expressed on all cells, for example.

[0437] Figure 4A shows the RNA expression profile of an exemplary activator ligand, transferrin receptor (TFRC). As seen in Figure 4A, TFRC expression at the RNA level is ubiquitous and relatively uniform. Furthermore, TFRC is an essential gene, and loss-of-function homozygous TFRC mutations are embryonic lethal in mice.

[0438] Figure 4B shows the HLA-A expression profiles of candidate blockers and HLA-B expression profiles of candidate activators. As can be seen in Figure 4B, candidate activator and blocker HLA class I expression tracks together, easing the difficulty of optimizing activator and blocker pairs.

[0439] Example 2: Selection of inhibitor target ligands lost in cancer cells Loss of heterozygosity One pool of potential inhibitor ligands is those lost in tumor cells due to loss of heterozygosity. In an analysis of 3,131 tumor samples across 26 tissue types, Beroukhim et al. found that in a typical tumor, 25% of the genome is affected by single copy number changes (duplications and deletions), 10% of the genome is affected by focal single copy number changes, and 2% is duplicated (Beroukhim et al., Nature 463:899-905 (2010)). Furthermore, many of the LOH regions overlap between tumor types, with only 22% of regions unique to a single tumor type. For example, Beroukhim et al. found that 80% of amplification peaks and 78% of deletion peaks were common to the 17 most representative tumor types. Therefore, alleles lost by LOH that can be selectively bound by the inhibitor LBD are potential inhibitor targets that are not expressed by target cells.

[0440] We searched the Cancer Genome Atlas Program (http: / / portals.broadinstitute.org / tcga / home) for inhibitor ligands that may have been lost in cancer due to loss of heterozygosity. The all_cancers dataset (all_cancers) consisted of 10,844 cancer samples from 33 cancer types. A certain type of inhibitor ligand should have the following properties: First, the inhibitor ligand should have high and uniform surface expression across tissues, conferring the ability to transmit a large, uniform inhibitory signal. The inhibitor ligand should be absent or polymorphic in many tumors. Furthermore, loss of the inhibitor ligand in tumor cells should be easily distinguishable by conventional methods, such as antibody staining or genetic analysis. Other types of inhibitor ligands, such as MiHA, may have low surface expression.

[0441] One pool of inhibitor ligands are major histocompatibility complex (MHC) alleles that are lost by loss of heterozygosity in cancer cells. Their use as inhibitor ligands does not require peptide MHC targets (pMHC), for example, pan-HLA-A*02 alleles can be used.

[0442] Loss of the Y chromosome Y chromosome genes expressed in adult males are potential inhibitor ligands upon Y chromosome loss. At least 60 protein-coding genes are present on the Y chromosome. Some Y chromosome genes are widely expressed in adult males and may be lost in cancer upon Y chromosome loss. Several other widely expressed cytoplasmic proteins are pMHC inhibitor candidates (e.g., TMSB4Y, EIF1AY). NLGN4Y, a type I integral membrane protein widely expressed in males, is also a candidate.

[0443] Example 3: Targeting cells lacking surface antigens with A and B receptor pairs We show that the loss of heterozygosity targeting system works in vitro and in a mouse cancer model.

[0444] Distinguishing between normal and tumor cells relies on two features: (i) an activator ("A") receptor that recognizes an epitope on the surface of normal cells that is retained on the tumor, and (ii) a blocker ("B") receptor that recognizes a second surface epitope on the allelic product that has been lost from the tumor cell. In this example, we used peptide-MHC (pMHC) targets for both A and B (see Figure 5A): A chimeric antigen receptor comprising an scFv against HLA-A*02-MAGE-A3 (FLWGPRALV) pMHC as the A receptor, and A chimeric antigen receptor (CIR) containing an scFv that binds to HLA-A*02-NY-ESO-1 (SLLMWITQC / V) as a B receptor and containing the PD-1 intracellular domain (ICD), the CTLA-4 intracellular domain (ICD), or the LILRB1 (LIR1) intracellular domain (ICD).

[0445] Each blocker (B) receptor bearing the PD-1 ICD or CTLA-4 ICD mediated a less than 10-fold shift in the EC50 of activation in Jurkat cells, as measured by titration of peptides loaded onto T2 cells as stimuli (Figure 5B). Surprisingly, B receptors containing the NY-ESO-1 LBD and the intracellular, transmembrane, and hinge domains of the LIR-1 (LILRB1) receptor mediated a more than 5,000-fold EC50 shift (also Figure 5B). Titration of irrelevant control HLA-A*02-binding peptides other than SLLMWITQC / V provided an estimate of the shift caused by competition of the loaded peptides on T2 cells for available HLA molecules, with their contribution to the total shift typically being less than 10-fold (Figure 8). For the EC50 shift values ​​reported here, we typically compare them to the EC50 of the activator-only construct.

[0446] A total of six different scFvs grafted onto LIR-1 mediated dramatic EC50 shifts ranging from 10- to 1,000-fold for four different pMHC targets (Figure 5C). The magnitude of the EC50 shift (i.e., blocking strength) correlated with the EC50 of the scFv when fused to a standard CAR (data not shown). LIR-1 B signaling blocked A signaling from multiple A targets and scFvs (Figure 5D, Figure 26). Blocking was ligand-dependent (Figure 9). Control B receptors with an LBD but lacking an ICD or containing mutations in critical elements of the ICD did not block activation by A receptor signals (Figure 10). Engineered T cells bearing A and B receptors function across multiple target antigens and antigen-binding domains (i.e., LBD sequences).

[0447] The LIR-1 ICD also functions when fused to T cell receptor (TCR) extracellular domains with three different pMHC targets (see Methods). TCRs against three different pMHC targets, two derived from MAGE-A3 and one derived from HPV, were assayed. In each case, LIR-1-based B receptors significantly shifted the activation EC50 in the range of 1,000-10,000-fold. LIR-1-based B receptors fused to the NY-ESO-1 TCR variable domain LBD "ESO(Ftcr)" were also able to block activation by either CAR or TCR. This includes the following receptor pairs: 1.MAGE-A3 FLWGPRALV Activator (A) TCR containing the TCR LBD binding to the peptide:MHC complex ("MP1-TCR") was blocked by the B receptor containing scFv NY-ESO-1 scFv LBD ("ESO") and the LIR-1 ICD, resulting in a significant shift in the activation EC50 (Figure 5E). 2.MAGE-A3 MPKVAELVHFL An A TCR containing a second TCR LBD ("MP2-TCR") binding to the peptide:MHC complex was blocked by a B receptor containing scFv NY-ESO-1 scFv LBD ("ESO") and the LIR-1 ICD, resulting in a significant shift in the activation EC50 (Figure 5E). 3.HPV TIHDIILECV A TCR containing the TCR LBD ("HPV E6-TCR") binding to the peptide:MHC complex was blocked by B receptor containing the scFv NY-ESO-1 scFv LBD ("ESO") and LIR-1 ICD, resulting in a significant shift in activation EC50 (Figure 5E). 4.MAGE-A3 FLWGPRALV A TCR containing a TCR LBD ("MP1-TCR") that binds to the peptide:MHC complex was blocked by a B receptor containing the NY-ESO-1 TCR LBD ("ESO(Ftcr)") and the LIR-1 ICD. This blocker significantly shifted the activation EC50 (Figure 5F). 5.MAGE-A3 FLWGPRALVA CAR ("MP1-CAR") containing an scFv LBD that binds to the peptide:MHC complex was blocked by a B receptor containing the TCR NY-ESO-1 TCR variable domain LBD ("ESO(Ftcr)") and the LIR-1 ICD. This blocker significantly shifted the activation EC50 (Figure 5F).

[0448] Confirmation of the cis effect The engineered effector cells should be able to distinguish potential target cells that are only A+, i.e., that only present an activator, from cells that are dual A+ and B+. To confirm that our receptor system works as intended, target-loaded beads roughly the size of cells (d ∼2.8 μm) were tested with engineered effector cells (Jurkat cells) that have A and B receptors (Figure 5G). The effector cells were indeed activated by a mixture of A+ and B+ beads, even when A+ beads comprised only 20% of the total beads. This confirms that the effector cells can recognize targets with loss of heterozygosity (represented by A+ beads) in a mixed population that also includes normal cells (represented by B+ beads).

[0449] Confirmation of target concentration independence In patients, target density will vary depending on the expression levels of A and B targets. We confirmed that the system works with both high- and low-density targets, both when varying A target density (data not shown) and B target density (Figure 5H). In Figure 5H, we tested scFvs that bound to either the B cell marker CD19 or HLA-A*02 in a peptide-independent manner. These non-pMHC targets present surface antigens with a potential range of 100,000 epitopes per cell. In this case, the ratio of A to B module expression was varied using different DNA concentrations in transient transfection assays. A more than 10-fold Emax shift was observed. These experiments demonstrated that the properties of the dual receptor system observed for pMHC targets were generally the same for high-density targets.

[0450] B receptor function in primary T cells MCF7 tumor cells expressing Renilla luciferase (Biosettia) loaded with titrations of target peptides were used as target cells, and luciferase was used as a measure of cell viability. Primary T cells were transduced with the HPV TCR ("HPV E7 TCR") as the A receptor and an anti-NY-ESO-1 scFv fused to the LIR-1 hinge, transmembrane domain, and ICD-containing B receptor ("ESO-LIR-1"), or were not transduced ("untransduced"). Transduced T cells were enriched by physical selection using beads coupled to HLA-A*02 tetramers, which bind to the B receptor LBD. To vary the target concentration, target cells were loaded with various amounts of HPV peptides. Primary T cells were activated in a dose-dependent manner. Expression of the B receptor shifted the EC50 curve by approximately 100-fold (Figure 6A). Similar results were obtained with anti-NY-ESO-1 CAR A receptor paired with anti-HLA-A*02 LBD and B receptor containing LIR-1 hinge, transmembrane domain, and ICD in Jurkat cells at various ratios of A receptor to B receptor (achieved by transfecting with various activator:blocker DNA ratios) (Figure 6B). This result was confirmed with CD19 CAR activator paired with HLA-A*02 blocker in T cells (Figure 6C). Thus, the basic function of activator and blocker receptor pairs was recapitulated in primary T cells, despite their complexity, heterogeneity, and donor-to-donor variability.

[0451] Example 4: Targeting loss of heterozygosity using A and B receptor pairs The HLA locus is polymorphic, with only a subset of the population having the HLA-A*02 allele. A ligand binding domain that binds to the MHC of the HLA*A02 allele regardless of the loaded peptide (a "pan-HLA-A*02" LBD) may be used to target tumors in subjects who are HLA heterozygous and have LOH of the HLA-A*02 allele in their tumor cells.

[0452] We fused an HLA-A*02-specific scFv to the LIR-1 module and showed that it functioned as a blocker in the presence of a pMHC-dependent activator (ESO-CAR, Figure 6B) in Jurkat cells. Furthermore, in primary T cells expressing both an A receptor containing an anti-CD19 scFv and a B receptor containing an HLA-A*02-specific scFv and the LIR-1 LBD, the B receptor blocked the A receptor as desired (Figure 6C).

[0453] CD19+, HLA-A*02-negative Raji target cells can be used to model tumor cells that have lost HLA-A*02 due to loss of heterozygosity. The same cell line stably expressing HLA-A*02 can be used as a model for normal cells. The Raji cell line activated Jurkat effector cells expressing a CD19 CAR and an HLA-A*02 LIR-1 blocker when the Raji target cells expressed only CD19. Transfection of Raji target cells with a polynucleotide encoding HLA-A*02 blocked Jurkat effector cell activation (Figure 11).

[0454] As described above, the CD19-binding A receptor and the HLA-A*02-binding B receptor functioned on Jurkat cells as well as primary T cells. The engineered T cells killed CD19-expressing Raji cells in the absence of HLA-A*02 expression (Figure 6C, top panel). Raji cells expressing both CD19 and HLA-A*02 were killed by T cells expressing only the activation module, but were blocked from both gamma interferon (IFNg) secretion (data not shown) and cytotoxicity when cocultured with T cells expressing both the activator and blocker modules (Figure 6C, center panel). Primary T cells bearing the activator and blocker modules discriminated between CD19+ "tumor" cells (Figure 6C, bottom panel) and CD19+ / HLA-A*02+ "normal" cells (Figure 6C, right panel) in mixed cultures.

[0455] T cell therapeutics based on activator and blocker mechanisms should be able to function reversibly, i.e., to cycle from a blocked to an activated state and back to a blocked state. Effector cells were cocultured with either CD19+ or CD19+ / HLA-A2*02+ Raji cells for multiple rounds and removed from the culture between rounds. As expected, effector cells exposed to normal cells were not activated when exposed to Raji target cells for both the blocking-killing-blocking program (Figure 6D) and the killing-blocking-killing program (Figure 6E). Effector T cells could cycle from a blocked to a cytotoxic state and back, depending on the target cells to which they were exposed.

[0456] Example 5: In vivo targeting of loss of heterozygosity using A and B receptor pairs To prepare for in vivo experiments, we showed that the CD19 / HLA-A*02 activator / blocker pair engineered in primary T cells enabled extensive expansion in vitro using standard CD3 / CD28 stimulation (Figure 7A). Thus, the cell product could be manufactured in sufficient quantities for use in patients as a therapeutic.

[0457] CD19+ / HLA-A*02+ or CD19+ / HLA-A*02- tumor cell mouse xenografts were obtained by injecting Raji target cells into the flanks of immunocompromised (NGS-HLA-A2.1) mice (Figure 7B). Raji cells were injected at two doses: 2e6 or 1e7 T cells. Tumor growth and persistence of the transplanted T cells were analyzed over time. Only CD19+ / HLA-A*02- tumor cells died in the mice, and tumor control was tracked by the number of transferred T cells, promoting host mouse survival (Figures 7C-7E and Figure 12). Normal CD19+ / HLA-A*02+ cells, designed to model normal cells, were unaffected by treatment.

[0458] summary We have developed a synthetic signal integration system that can exploit a broad class of novel cancer targets derived from LOH. This system meets the requirements for cell therapy of patients with LOH without undue experimentation. The system functions robustly in Jurkat cells, primary T cells, and in vivo. This system is also (i) modular and flexible, functioning across CAR and TCR formats with different targeting densities; (ii) silencing of blocker and activator targets occurs when they are present in cis on a surface, but not when only a minority of cells express the activator; and (iii) reversible switching between states, consistent with the need to interrogate tumor cells throughout the body.

[0459] Example 6: Methods of Examples 3 to 5 cell culture Jurkat cells encoding an NFAT luciferase reporter were obtained from BPS Bioscience. All other cell lines used in this study were obtained from ATCC. In culture, Jurkat cells were maintained in RPMI medium supplemented with 10% FBS, 1% Pen / Strep, and 0.4 mg / mL G418 / Geneticin. T2, MCF7, and Raji cells were maintained as suggested by ATCC. "Normal" Raji cells were generated by transducing Raji cells with HLA-A*02 lentivirus (Custom Lentivirus, Alstem) at an MOI of 5. HLA-A*02-positive Raji cells were sorted using a FACSMelody cell sorter (BD).

[0460] Plasmid constructs NY-ESO-1-responsive inhibitory constructs were generated by fusing the NY-ESO-1 scFv LBD to receptor domains, including the hinge, transmembrane region, and / or intracellular domain of leukocyte immunoglobulin-like receptor subfamily B member 1 (LIR-1), programmed cell death protein 1 (PDCD1), or cytotoxic T lymphocyte protein 4 (CTLA-4). Using Golden Gate cloning, the gene segments were combined and inserted downstream of the human EF1α promoter contained in a lentiviral expression plasmid.

[0461] Jurkat cell transfection Jurkat cells were transiently transfected using a Neon electroporation system (Thermo Fisher Scientific) in a 100µL format according to the manufacturer's protocol using the following settings: 3 pulses, 1500V, 10ms. Co-transfections were performed with 1-3µg of activator CAR or TCR constructs and 1-3µg of either scFv or Ftcr blocker constructs or empty vector per 1e6 cells and harvested in RPMI medium supplemented with 20% heat-inactivated FBS and 0.1% Pen / Strep.

[0462] Jurkat-NFAT luciferase activation assay The peptides MAGE-A3 (MP1, FLWGPRALV), MAGE-A3 (MP2, MPKVAELVHFL), HPV E6 (TIHDIILECV), HPV E7 (YMLDLQPET), and modified NY-ESO-1 ESO (ESO, SLLMWITQV) were synthesized by Genscript. Activation peptides were serially diluted starting at 50 μM. The blocker peptide NY-ESO-1 was diluted to 50 μM (unless otherwise indicated) and added to the activation peptide serial dilutions. Subsequently, 1e4 T2 cells were loaded onto 15 μL of RPMI supplemented with 1% BSA and 0.1% Pen / Strep in a Corning® 384-well low flange white flat-bottom polystyrene TC-treated microplate. The next day, 1e4 Jurkat cells were resuspended in 15uL of RPMI supplemented with 10% heat-inactivated FBS and 0.1% Pen / Strep and added to the peptide-loaded T2 cells for 6 hours. Jurkat luminescence was assessed using the ONE-Step Luciferase Assay System (BPS Bioscience). Assays were performed in technical duplicate.

[0463] Transduction, expansion, and enrichment of primary T cells Frozen PBMCs were thawed in a 37°C water bath, cultured at 1e6 cells / mL in LymphoONE (Takara) containing 1% human serum, and activated using T cell TransAct (Miltenyi) at a dilution of 1:100 supplemented with IL-15 (10 ng / mL) and IL-21 (10 ng / mL). After 24 hours, lentivirus was added to the PBMCs at an MOI of 5. PBMCs were cultured for an additional 2–3 days, allowing cells to expand under TransAct stimulation. After expansion, primary T cells transduced with activators and blockers were enriched using anti-PE microbeads (Miltenyi) according to the manufacturer's instructions. Briefly, primary T cells were incubated with CD19-Fc (R&D Systems) at a dilution of 1:100 in MACS buffer (PBS, 0.5% BSA + 2 mM EDTA) at 4°C for 30 minutes. Cells were washed three times in MACS buffer and incubated with secondary antibody (1:200) in MACS buffer for 30 min at 4° C. Cells were then incubated with anti-PE microbeads and passed through an LS column (Miltenyi).

[0464] In vitro cytotoxicity assay of primary T cells For cytotoxicity studies using pMHC targets, enriched primary T cells were incubated with 2e3 MCF7 cells expressing Renilla luciferase (Biosettia) loaded with titrations of target peptides as described above at an effector:target ratio of 3:1 for 48 hours. Luciferase-expressing live MCF7 cells were quantified using the Renilla Luciferase Reporter Assay System (Promega). For cytotoxicity studies using non-pMHC targets, enriched primary T cells were incubated with 2e3 WT Raji cells ("tumor" cells) or HLA-A*02-transduced Raji cells ("normal" cells) at an effector:target ratio of 3:1 for up to 6 days. WT "tumor" Raji cells stably expressing GFP and Renilla luciferase (Biosettia) or HLA-A*02 "normal" Raji cells stably expressing RFP and firefly luciferase (Biosettia) were imaged together with unlabeled primary T cells using an IncuCyte live-cell imager. The fluorescence intensity of live Raji cells over time was quantified using IncuCyte imaging software. For reversibility studies, enriched primary T cells were similarly cocultured with "normal" or "tumor" Raji cells for 3 days and imaged. After 3 days, T cells were separated from remaining Raji cells using CD19 negative selection and replated with fresh "normal" or "tumor" Raji cells as described. In separate wells, live luciferase-expressing Raji cells were quantified using the Dual-Luciferase Reporter Assay System (Promega).

[0465] Mouse xenograft study Frozen PBMCs were thawed in a 37°C water bath and incubated overnight in serum-free TexMACS Medium (Miltenyi) before activation. PBMCs were activated at 1.5e6 cells / mL using TexMACS Medium supplemented with T cell TransAct (Miltenyi) and IL-15 (20 ng / mL) and IL-21 (20 ng / mL). 24 hours later, lentivirus was added to the PBMCs at an MOI of 5. PBMCs were cultured for an additional 8–9 days to allow expansion under TransAct stimulation. After expansion, T cells were enriched for A2-LIR-1 (pMHC HLA-A*02 ScFv fused to the LIR-1 hinge, TM, and ICD) using anti-PE microbeads (Miltenyi) against streptavidin-PE-HLA-A*02-pMHC before in vivo injection.

[0466] Five- to six-week-old female NOD.Cg-Prkdcscid Il2rgtm1Wjl Tg(HLA-A / H2-D / B2M)1Dvs / SzJ(NSG-HLA-A2 / HHD) mice were purchased from The Jackson Lab. Animals were acclimated to the vivarium for at least three days before the start of the study. Animals were injected subcutaneously in the right flank with 2e6 WT Raji cells or HLA-A*02-transduced Raji cells in a volume of 100 μL. Tumors grew to an average of 70 mm 3 When the tumor volume reached (V = L × W × W / 2), animals were randomized into five groups (n = 7) and received either 2e6 (data not shown) or 1e7 T cells via the tail vein. After T cell infusion, tumor measurements were performed three times a week, and blood was collected 10 and 17 days later for blood flow analysis. After RBC lysis, cells were stained with anti-hCD3, anti-hCD4, anti-hCD8, and anti-msCD45 antibodies (Biolegend).

[0467] Example 7: The ability of a blocker receptor (C1765) bearing an HLA-AA*02 antigen-binding domain and an LIR-1 ICD to block activation of Jurkat cells expressing an activator CAR bearing an EGFR antigen-binding domain (CT479) was assayed using the NFAT luciferase reporter system as previously described. Wild-type HeLa tumor cells that are EGFR+ and HLA-A*02- were used as target cells. EGFR+ / HLA-A*02- HeLa cells were also transduced with a polynucleotide encoding HLA-A*02+ to obtain EGFR+ / HLA-A*02+ HeLa cells, which were used as target cells expressing both the activator and blocker antigens.

[0468] As shown in Figure 13, expression of HLA-A*02 LIR-1 blocker in Jurkat cells expressing EGFR CAR significantly increased CAR Emax compared to CAR Emax in Jurkat cells not expressing blocker. MAX It will increase by more than five times.

[0469] Furthermore, we observed that the lower the level of HLA-A2 expression on target cells, the less blocking occurred. Wild-type HCT116 cells are EGFR+ and HLA-A*02. EGFR and HLA-A*02 levels were assayed in HCT116 cells and HeLa cells transduced with a polynucleotide encoding the HLA-A*02 polynucleotide using anti-EGFR and anti-HLA-A*02 antibodies (BB7.2), followed by FACs sorting. As shown in Figures 14A and 14B, HCT116 cells have lower levels of the blocker HLA-A*02 antigen than transduced HeLa cells. When HCT116 target cells expressing EGFR and HLA-A*02 antigens were presented to Jurkat cells expressing an EGFR CAR and an HLA-A*02 LIR-1 blocker, the presence of the HLA-A*02 LIR-1 blocker inhibited the E-cell response of the EGFR CAR. MAX In contrast, transduced HeLa cells expressing higher levels of HLA-A*02 antigen showed a 1.8-fold increase in EGFR CAR E MAXAs a control, there was minimal activation by EGFR knockout HCT116 cells (FIG. 15A).

[0470] The ratio of blocker to activator required to achieve 50% blockage using EGFR CAR and HLA-A*02 LIR-1 blockers was assayed using a bead-based system and is shown in Figures 16A and 16B.

[0471] To determine the EC50 of an activator antigen, activator beads were coated with different concentrations of activator antigen. An irrelevant protein was added to each concentration to achieve the same total protein concentration, and a fixed amount of beads was added to Jurkat effector cells expressing an EGFR CAR (Figure 16A).

[0472] To determine blocker antigen IC50, beads were coated with activator antigen at the EC50 concentration (determined in Figure 16A) and then coated with different concentrations of blocker antigen. An irrelevant protein was added at each concentration so that the total protein concentration remained the same, and a fixed amount of beads was added to Jurkat effector cells expressing either an EGFR CAR or an EGFR CAR and an HLA-A*02 LIR-1 blocker (Figure 16B).

[0473] Example 8: LIR-1-based blockers can inhibit TCR signaling using solid tumor cell lines Jurkat effector cells expressing the MAGE-A3 activator TCR and the NY-ESO-1 scFv LIR-1-based inhibitory receptor (including the LIR-1 hinge, TM, and ICD) were assayed using A375 target cells loaded with different concentrations of activator and blocker peptides. Jurkat cell activation was assayed using an NFAT luciferase assay (see Example 6). As shown in Figure 17, loading A375 cells with 50 μM NY-ESO-1 peptide increased the activation of the activator TCR E MAXThe peptide loading efficiency of A375 cells versus T2 target cells shifted by more than 10-fold. There is an estimated 100-fold difference in peptide loading efficiency. Peptide loading may explain the apparent therapeutic window.

[0474] Example 9: HLA-A*02 LIR-1-based blockers can inhibit CAR signaling using B-cell leukemia cell lines Jurkat effector cells expressing a non-pMHC high-density CD19-specific activator (CD19 scFv CAR activator) with or without co-expression of a pMHC HLA-A*02 scFv LIR-1-based inhibitory receptor (including the LIR hinge, TIM, and ICD) were assayed using NALM6 target cells. Jurkat cell activation was assayed using an NFAT luciferase assay (see Example 6) and varying effector cell to target cell (E:T) ratios.

[0475] As shown in Figure 18, expression of the blocking agent by Jurkat cells was significantly associated with the E MAX We were able to increase the rate by more than five times.

[0476] Example 10: HLA-A*02 LIR-1-based blockers can inhibit CAR signaling in a dose-dependent manner Jurkat effector cells expressing the NY-ESO-1 scFv CAR and the pMHC HLA-A*02 scFv LIR-1-based inhibitory receptor were assayed using T2 target cells loaded with various amounts of peptide (note that in this case, the same peptide is recognized by both the activator and blocker ScFvs). Activation of Jurkat cells was assayed using an NFAT luciferase assay (see Example 6). Jurkat cells were transfected with various ratios of activator to blocker DNA, i.e., 1:1, 1:2, and 1:3, to vary the ratio of receptors expressed by the Jurkat cells.

[0477] As can be seen in Figure 19, even in Jurkat cells transfected with activator and blocker receptor DNA at a 1:1 ratio, the MHC HLA-A*02 scFv LIR-1-based inhibitory receptor (blocker) was able to block Jurkat cell activation by the activator CAR. Furthermore, the extent to which the inhibitory receptor blocked activation increased with increasing amounts of inhibitory receptor DNA compared to the activator receptor DNA used for Jurkat cell transfection.

[0478] Example 11: HLA-A*02 LIR-1-based blockers can inhibit universal (pan-HLA class I) activators with tunable potency The activation of Jurkat effector cells expressing a pan-HLA scFv CAR with three different scFv binding domains based on the pan-HLA antibody W6 / 32 and a pMHC HLA-A*02 scFv LIR-1-based inhibitory receptor was assayed using HLA-A*02-positive T2 cells. As can be seen in Figure 20, each activator scFv supported different functional signals in HLA-A*02-negative Jurkat cells. The pMHC HLA-A*02 scFv LIR-1-based inhibitory receptor was able to block the functional signals of all three pan-HLA scFv CARs when Jurkat cells were contacted with HLA-A*02-positive T2 target cells at an E:T ratio of 1:2. Furthermore, the pMHC HLA-A*02 scFv LIR-1-based inhibitory receptor was able to suppress the activator by up to 25-fold.

[0479] Example 12: HLA-A*02 LIR-1-based inhibitory receptors can block activation by MSLN CAR activators Activation of Jurkat effector cells expressing MSLN CAR activators and pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors was assayed using the NFAT luciferase assay described in Example 6.

[0480] Jurkat cells were transfected with activator:blocker DNA at a 1:4 ratio and assayed for activation in a cell-free bead-based assay (Figure 21A). Beads were loaded with either activator antigen or activator and blocker antigen, and the ratio of beads to Jurkat cells was varied. In the cell-free bead-based assay, the pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptor was able to block Jurkat cell activation when the cells were contacted with beads carrying the pMHC HLA-A*02 blocker and MSLN activator in cis. The presence of the pMHC HLA-A*02 blocker on the beads inhibited the activation of the MSLN CAR. MAX The change was more than 12-fold (Figure 21A).

[0481] Activated Jurkat cells transfected with the same activators and blockers at a DNA ratio of 1:4 were assayed for activation using the chronic myeloid leukemia cell line K562. K562 expresses the activator antigen MSLN. Jurkat effector cell responses were assayed against K562 cells transduced with HLA-A*02 to express both activator and blocker antigens (MSLN+HLA-A*02+) and untransduced K562 cells that expressed the activator antigen but not the blocker antigen (MSLN+HLA-A*02-). As can be seen in Figure 21B, expression of HLA-A*02+ by K562 cells correlated with the activation of MSLN CAR E. MAX We were able to increase the rate by more than five times.

[0482] The ability of the pMHC HLA-A*02 inhibitory receptor to block activation by the MSNL ScFv CAR was also assayed using effector primary T cells and SiHa or HeLa target cells, as described for Raji in Example 6. SiHa and HeLa cells endogenously express MSLN and were transduced to express the HLA-A*02 inhibitory receptor target. Activation of primary effector T cells was assayed by examining the fold induction of IFNγ. As shown in Figure 22, the pMHC HLA-A*02 LIR-1 inhibitory receptor was able to block primary T cell activation when presented with SiHa or HeLa target cells expressing HLA-A*02 (over 10-fold and 5-fold inhibition, respectively).

[0483] The pMHC HLA-A*02 inhibitory receptor was also able to inhibit killing by T cells expressing both the MSLN ScFv CAR and the pMHC HLA-A*02 LIR-1 inhibitory receptor when the T cells were presented with SiHa cells that expressed MSLN but not HLA-A*02 (Figure 23).

[0484] Example 13: HLA-A*02 LIR-1-based inhibitory receptors can block activation by EGFR CAR activators Activation of Jurkat effector cells expressing EGFR CAR activators and pMHC HLA-A*02 ScFv LIR-1-based inhibitory receptors (including the LIR-1 ...

Claims

1. An immune cell, a. an engineered first receptor, the engineered first receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a first ligand-binding domain capable of specifically binding to an epidermal growth factor receptor (EGFR) ligand; b. an engineered second receptor, the engineered second receptor comprising a transmembrane region and an extracellular region, the extracellular region comprising a second ligand-binding domain capable of specifically binding to a human leukocyte antigen A*02 (HLA-A*02) allele; binding of the first ligand binding domain to the EGFR ligand activates or promotes activation of the immune cell via the first receptor; binding of the second ligand-binding domain to the HLA-A*02 allele inhibits activation of the immune cell by the first receptor; the first ligand-binding domain comprises a heavy chain variable region (VH) comprising CDR-H1 of SEQ ID NO: 137, CDR-H2 of SEQ ID NO: 143, and CDR-H3 of SEQ ID NO: 149, and a light chain variable region (VL) comprising CDR-L1 of SEQ ID NO: 155, CDR-L2 of SEQ ID NO: 160, and CDR-L3 of SEQ ID NO: 166; the second ligand-binding domain comprises a heavy chain variable region (VH) comprising CDR-H1 of SEQ ID NO: 44, CDR-H2 of SEQ ID NO: 45, and CDR-H3 of SEQ ID NO: 46, and a light chain variable region (VL) comprising CDR-L1 of SEQ ID NO: 41, CDR-L2 of SEQ ID NO: 42, and CDR-L3 of SEQ ID NO: 43; The immune cells.

2. The immune cell of claim 1, wherein the second ligand binding domain comprises the sequence of SEQ ID NO:

53.

3. The immune cell of claim 1 or 2, wherein the engineered second receptor comprises an intracellular domain isolated or derived from LILRB1.

4. The immune cell of claim 3, wherein the intracellular domain derived from LILRB1 comprises a sequence that is at least 95% identical to the sequence of SEQ ID NO:

76.

5. The immune cell of claim 1 , wherein the engineered second receptor comprises a LILRB1 transmembrane domain.

6. The immune cell of claim 5, wherein the LILRB1 transmembrane domain comprises a sequence that is at least 95% identical to the sequence of SEQ ID NO:

85.

7. The immune cell of claim 1 , wherein the engineered second receptor comprises a LILRB1 hinge domain.

8. The immune cell of claim 7, wherein the LILRB1 hinge domain comprises a sequence that is at least 95% identical to the sequence of SEQ ID NO: 84, SEQ ID NO: 77, or SEQ ID NO:

78.

9. The immune cell of claim 1 , wherein the engineered second receptor comprises a LILRB1 intracellular domain and a LILRB1 transmembrane domain.

10. The immune cell of claim 9, wherein the LILRB1 intracellular domain and the LILRB1 transmembrane domain comprise the sequence of SEQ ID NO: 80 or a sequence that is at least 95% identical to the sequence of SEQ ID NO:

80.

11. The immune cell of claim 1 , wherein the first and second receptors are expressed on the surface of the immune cell in a ratio of the first receptor to the second receptor of 1:10 to 10:

1.

12. The immune cell of claim 1 , wherein the first and second receptors are expressed on the surface of the immune cell in a ratio of the first receptor to the second receptor of 1:3 to 3:

1.

13. The immune cell of claim 1 , wherein the immune cell is selected from the group consisting of a T cell, a B cell, and a natural killer (NK) cell.

14. The immune cell of claim 1 , wherein the immune cell is a T cell.

15. The immune cell of claim 1 , wherein the immune cell is non-naturally occurring.

16. The immune cell of any one of claims 1 to 15, wherein the immune cell is isolated.

17. A pharmaceutical composition comprising a plurality of immune cells according to any one of claims 1 to 16.

18. An immune cell according to any one of claims 1 to 16 or a pharmaceutical composition according to claim 17 for use in the treatment of EGFR+ cancer.

19. The immune cell or pharmaceutical composition of claim 18, wherein cells of the cancer express an EGFR ligand.

20. The immune cell or pharmaceutical composition of claim 18 or 19, wherein cells of the cancer do not express the HLA-A*02 allele due to loss of heterozygosity or loss of the Y chromosome.

21. The immune cell or pharmaceutical composition of any one of claims 18 to 20, wherein the non-target cell expresses both an EGFR ligand and an HLA-A*02 allele.

Images