Cellular reprogramming using transient and transient plasmid vector expression systems
The transient plasmid vector system efficiently generates footprint-free iPSCs with high clonality and genetic stability, addressing the instability issues of integrating viral systems by minimizing exogenous gene integration and reducing tumorigenic risks.
Patent Information
- Application Number
- JP2024067673
- Authority / Receiving Office
- JP · JP
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2017-10-11
- Filing Date
- 2024-04-18
- Publication Date
- 2025-10-21
- Estimated Expiration
- 2038-10-10
AI Technical Summary
Existing methods for generating induced pluripotent stem cells (iPSCs) using integrating viral systems face challenges such as persistent genomic alterations, insertional mutagenesis, and exogenous gene reactivation, leading to instability and potential tumorigenesis, which complicates drug screening and therapeutic applications.
A transient and temporary plasmid vector system is employed to minimize exogenous gene integration, using a combination of plasmids that include an origin of replication and reprogramming factors like OCT4, with optional EBNA-free sequences, to generate footprint-free, clonally viable 'naive' or 'ground' state iPSCs.
This approach produces homogeneous populations of iPSCs with high clonality, genetic stability, and reduced reversion to pluripotency, enabling stable clonal lines suitable for banking, manipulation, and directed redifferentiation, while minimizing tumorigenic risk.
Smart Images

Figure 0007757457000005 
Figure 0007757457000006 
Figure 0007757457000007
Abstract
Description
[Technical Field]
[0001] Related Applications This application claims priority to U.S. Provisional Patent Application No. 62 / 571,105, filed October 11, 2017, the disclosure of which is incorporated herein by reference in its entirety.
[0002] Reference to an electronically submitted sequence listing This application incorporates by reference the Computer Readable Form (CRF) of the Sequence Listing in ASCII text format filed with this application, titled 13601-187-228_SEQ_LISTING.txt, created on October 9, 2018, and 9,600 bytes in size.
[0003] The present disclosure relates generally to the field of generating human induced pluripotent stem cells (iPSCs or iPS cells). More specifically, the present disclosure relates to obtaining footprint-free iPSCs with desirable properties with high efficiency using a combination of plasmid vectors. [Background technology]
[0004] iPSCs were originally generated using integrating viral systems to express key transcription factors. Retroviral and lentiviral systems, including polycistronic and inducible systems, are now being successfully employed in iPSC generation. However, persistent genomic alterations due to insertional mutagenesis and the possibility of exogenous gene reactivation after iPSC differentiation may present potential challenges for subsequent drug screening and therapeutic applications of cells generated by these methods. In fact, significant differences between iPSC clones generated using the same viral system have been reported, with the majority of clones forming tumors when transplanted as differentiated neurospheres in rodents. Studies have suggested that iPSCs generated using the same viral approach may behave differently upon differentiation. Differences in ectopic gene integration sites may result in different insertional mutagenesis and epigenetic regulation of transgene expression. For iPSC generation methods involving integrating systems, it is necessary to induce and screen many clones to identify clones that are stable in both pluripotent and differentiated states.
[0005] Various non-integrating systems for iPSC generation have been demonstrated, including viral and non-viral methods. Non-integrating viral systems for reprogramming include adenoviral vectors, Sendai virus vectors, and Epstein-Barr virus-based episomal vectors. Examples of non-integrating non-viral systems for reprogramming include minicircle vectors (minimal DNA vectors), PiggyBac (transposons), RNA (mRNA or miRNA), and protein (recombinant polypeptide) vectors.
[0006] There is a significant need in the art for the efficient production of homogenous populations of footprint-free iPSCs, preferably in a pluripotent "naive" or "ground" state, preferably under defined culture conditions. The pluripotent "naive" or "ground" state confers iPSC qualities, including, but not limited to, high clonality, sustained self-renewal, minimal spontaneous differentiation or genomic abnormalities, and high viability as dissociated single cells. The methods and compositions of the present invention, specifically the novel plasmid vector system, address this need and provide other related advantages in the field of cell reprogramming. Summary of the Invention
[0007] By using an efficient, yet transient and temporary expression system that minimizes the presence of exogenous genes to reduce the probability of host genome integration, the present disclosure aims to provide efficient methods and compositions for generating iPSCs without exogenous DNA introduced into non-pluripotent cells for inducing reprogramming. The present disclosure also aims to provide a combination plasmid system that efficiently produces pluripotent and / or highly clonally viable "naive" or "ground" state iPSCs. Ground-state pluripotency of iPSCs allows for the long-term survival and genetic stability of single-cell dissociated iPSCs, thereby enabling the generation of clonal iPSC lines suitable for banking and manipulation, such as single-cell sorting and / or depletion, targeted genome editing of clonal iPSCs, and directed redifferentiation of homogenous populations of iPSCs. Accordingly, it is also an object of the present disclosure to provide methods and compositions for generating single-cell-derived iPSC clonal lines, or derived cells therefrom, that contain one or several genetic modifications, including polynucleotide insertions, deletions, and substitutions, at selected sites, which modifications are retained and remain functional in subsequent derived cells following differentiation, dedifferentiation, reprogramming, expansion, passaging, and / or transplantation.
[0008] One aspect of the present application provides a method for reprogramming non-pluripotent cells to generate pluripotent cells or populations thereof, the method comprising transfecting the non-pluripotent cells with one or more first plasmids, wherein the first plasmid comprises an origin of replication and a polynucleotide encoding one or more reprogramming factors but not EBNA or its derivatives, at least one of the one or more first plasmids comprises a polynucleotide encoding OCT4, wherein introduction of the one or more first plasmids induces the reprogramming process, and optionally introducing into the non-pluripotent cells one of the following: a second plasmid comprising a nucleotide sequence encoding EBNA, wherein the second plasmid does not comprise an origin of replication or a polynucleotide(s) encoding the reprogramming factor(s), EBNA mRNA, or EBNA protein. The transfected cells are then cultured to generate reprogrammed cells that comprise morphological changes from the starting non-pluripotent cells and are essentially free of EBNA, but lack pluripotent cell morphology and do not comprise endogenous OCT4 expression. When the reprogrammed cells are further cultured for a sufficient time, one or more pluripotent cells are generated. The reprogramming methods provided herein minimize exposure of pluripotent cells to the expression of exogenous transgenes that may be integrated into the cellular genome and induce dedifferentiation if reactivated to generate derived cells, or increase the propensity for tumorigenesis if used in a clinical setting.
[0009] In one embodiment, a reprogramming method includes first introducing a combination of plasmids into non-pluripotent cells to induce reprogramming. The combination of plasmids includes one or more first plasmids, the first plasmids including an origin of replication and a polynucleotide encoding one or more reprogramming factors but not EBNA or its derivatives, and at least one first plasmid includes a polynucleotide encoding OCT4. The combination of plasmids including one or more first plasmids further includes a second plasmid including a nucleotide sequence encoding EBNA but not including an origin of replication or a polynucleotide(s) encoding the reprogramming factor(s). After introducing the plasmid system into non-pluripotent cells to induce reprogramming, the cells are cultured to generate reprogrammed cells that contain morphological changes from the starting non-pluripotent cells into which the combination of plasmids is introduced. Reprogrammed cells that exhibit morphological changes are essentially free of EBNA but lack the morphology of pluripotent cells and do not contain endogenous OCT4 expression. In the provided reprogramming methods, the reprogrammed cells are further cultured for a time sufficient to generate one or more pluripotent cells. In some embodiments, the reprogramming cells are cultured in the presence of a small molecule compound comprising at least one of a TGFβ inhibitor, a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor. In some embodiments, the small molecule compound comprises a combination of a TGFβ inhibitor, a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor.
[0010] In some embodiments, the general method further comprises dissociating the pluripotent cells to obtain single-cell dissociated pluripotent cells. In some embodiments, the single-cell dissociated pluripotent cells are suspended in culture medium. In some embodiments, the single-cell dissociated pluripotent cells are sorted by selecting and isolating cells expressing one or more pluripotency markers to enrich for pluripotent cells expressing the selected marker(s). In some other embodiments, the pluripotent cells, or single dissociated cells suspended, sorted, or enriched therefrom, are cultured to maintain pluripotency in the presence of a small molecule compound, including at least one of a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor. In some embodiments, the long-term maintenance of pluripotency is for at least 5, 10, 15, or 20 passages, or more.
[0011] In some embodiments, the above methods are used to induce reprogramming of somatic cells, progenitor cells, or pluripotent cells. In some embodiments of the methods, the non-pluripotent cells for reprogramming are human cells. In some embodiments of the methods, the non-pluripotent cells for reprogramming are immune cells. In some other embodiments, the immune cells for reprogramming can be patient-specific, drug response-specific, or disease state-specific. In one embodiment, the morphological change exhibited by the reprogrammed cells for reprogramming using the disclosed methods is the morphological change of MET (mesenchymal to epithelial transition).
[0012] In one embodiment of the method, the reprogrammed cells are essentially free of EBNA carried by the second plasmid. In one embodiment, the reprogrammed cells are essentially free of the second plasmid. Some embodiments of the method provide reprogrammed cells derived from the combination of plasmids for about 4-10 days (i.e., 4-10 days after transfection of the plasmids), 5-10 days, 6-10 days, or any number of days therebetween. Some embodiments of the method provide reprogrammed cells for 4-12 days after transfection, or any number of days therebetween. Some further embodiments of the method provide reprogrammed cells for 4-14 days after transfection, or any number of days therebetween. Still other embodiments of the method provide reprogrammed cells for 4-21 days or 4-25 days after transfection, or any number of days therebetween.
[0013] In some embodiments, the method produces pluripotent cells that have reduced reversion to pluripotency or spontaneous differentiation, for example, compared to cells introduced with an additional plasmid containing both oriP and EBNA. In some other embodiments, the method produces pluripotent cells that are essentially free of the polynucleotides of the plasmid combination. In some embodiments, pluripotent cells that are essentially free of the polynucleotides of the plasmid are produced without the need for selection or extensive passaging of pluripotent cells. In one embodiment, the method produces pluripotent cells that have at least one of the following characteristics: high clonality, genetic stability, and ground-state pluripotency. In some embodiments, the method produces pluripotent cells that contain reactivated genes associated with extraembryonic cells.
[0014] In some embodiments, the method involves the use of a second plasmid with a high loss rate, such that the expression of EBNA by the second plasmid is short-lived, transient, and temporary, in the sense that EBNA is rapidly lost and expressed in the cytoplasm before the appearance of iPSC morphology or endogenous pluripotency gene expression. In some embodiments of the method, the replication origin and / or EBNA contained in the first and second plasmids, respectively, are EBV-based. In some embodiments of the method, the reprogramming process is carried out under feeder-free conditions, i.e., in a feeder-free medium. In some other embodiments of the method, the ROCK inhibitor contained in the medium is thiazovivin.
[0015] Another aspect of the present application provides a reprogrammed cell or population thereof obtained after transfecting a non-pluripotent cell with one or more first plasmids, wherein the first plasmid comprises an origin of replication and a polynucleotide encoding one or more reprogramming factors but not EBNA or its derivatives, and at least one of the one or more first plasmids comprises a polynucleotide encoding OCT4, and optionally a second plasmid comprising a nucleotide sequence encoding EBNA, wherein the second plasmid does not comprise an origin of replication or a polynucleotide(s) encoding the reprogramming factor(s), EBNA mRNA, and EBNA protein, wherein the reprogrammed cell comprises a morphological change from the non-pluripotent cell prior to introduction of the combination of plasmids and is essentially free of EBNA or its derivatives, the reprogrammed cell comprises (i) a pluripotent cell morphology, and (ii) no endogenous OCT4 expression, and the reprogrammed cell is capable of establishing stable pluripotency when given sufficient time to generate a pluripotent cell. In one embodiment, a second plasmid containing a nucleotide sequence encoding EBNA is used to generate reprogrammed cells and iPSCs, and the second plasmid does not contain a polynucleotide(s) encoding an origin of replication or reprogramming factor(s). In one embodiment, instead of the second plasmid, EBNA mRNA is used with one or more first plasmids to induce reprogramming and generate reprogrammed cells and iPSCs with the disclosed properties. In another embodiment, an EBNA protein or polypeptide is used with one or more first plasmids to induce reprogramming and generate reprogrammed cells and iPSCs with the disclosed properties.
[0016] In some embodiments of the reprogrammed cells or populations thereof, the cells have been induced for about 4 to 10, 12, 14, 21, 25 days, or any number of days therebetween. In some embodiments, the reprogrammed cells or populations thereof are cultured in the presence of a TGFβ inhibitor, a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor. In some other embodiments, the reprogrammed cells or populations thereof are derived from fibroblasts, such that the morphological changes of reprogramming include MET (mesenchymal to epithelial transition) morphological changes. In some embodiments, the reprogrammed cells or populations thereof are essentially free of the first and second plasmids. In some embodiments, the reprogrammed cells give rise to pluripotent cells that are essentially free of the plasmid polynucleotides without the need for selection or extensive passaging of the pluripotent cells. In some other embodiments, the reprogrammed cells or populations thereof give rise to pluripotent cells that exhibit reduced reversion to pluripotency or spontaneous differentiation, for example, compared to cells transfected with an additional plasmid containing both oriP and EBNA. In yet some other embodiments, the reprogrammed cells or populations thereof give rise to pluripotent cells with at least one of the following characteristics: high clonality, genetic stability, and ground state pluripotency. In yet other embodiments, the reprogrammed cells or populations thereof give rise to pluripotent cells that comprise reactivated genes associated with extraembryonic cells.
[0017] Thus, another aspect of the present application provides a composition comprising the above-described reprogrammed cells or populations thereof. In some embodiments, the composition further comprises a culture medium comprising a TGFβ inhibitor, a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor. In one embodiment, the ROCK inhibitor contained in the culture medium of the composition is thiazovivin. In other embodiments, the culture medium is feeder-free. A further aspect of the present application provides isolated pluripotent cells or pluripotent cell lines produced by the methods disclosed herein. In some embodiments, the isolated pluripotent cells or pluripotent cell lines so produced can be further genomically engineered and / or redifferentiated into non-naturally occurring cells. In some embodiments, the non-naturally occurring cells redifferentiated from the isolated pluripotent cells or pluripotent cell lines are immune cells, including, but not limited to, CD34 cells, hemogenic endothelial cells, hematopoietic stem or progenitor cells, hematopoietic multipotent progenitor cells, T cell precursors, NK cell precursors, T cells, NKT cells, NK cells, B cells, and immunoregulatory cells. In some embodiments, the non-naturally occurring cells derived from pluripotent cells or pluripotent cell lines are rejuvenated cells that comprise at least one of the following characteristics: an overall increase in heterochromatin, improved mitochondrial function, an increased DNA damage response, telomere elongation and a decreased proportion of short telomeres, a decreased fraction of senescent cells, or a higher potential for proliferation, survival, persistence, or memory-like function compared to their natural cellular counterparts.
[0018] A further aspect of the present application provides compositions for therapeutic use comprising pluripotent cells obtained by the methods described herein and, optionally, one or more additional therapeutic agents. Also provided are compositions for therapeutic use comprising the claimed genomically engineered pluripotent cells or derived non-naturally occurring cells obtained by the methods described herein and, optionally, one or more additional therapeutic agents. In some embodiments, these compositions for therapeutic use are for use in treating a subject in need of treatment. The present application also provides compositions for use in producing pluripotent cells for cell-based therapy applications. In some embodiments, the pluripotent cells are allogeneic, i.e., reprogrammed from cells from a subject different from the subject receiving the cell-based therapy, or autologous, i.e., reprogrammed from cells from the same subject receiving the cell-based therapy.
[0019] Kits are provided that include pluripotent cells obtained by the above methods. In some embodiments, the pluripotent cells included in the kits are genomically engineered. Kits are also provided that include non-naturally occurring cells derived from the pluripotent cells obtained by the methods.
[0020] Yet another aspect of the present application provides an in vitro system for initiating reprogramming in non-pluripotent cells, the system comprising: (1) one or more first plasmids, the first plasmid comprising an origin of replication and a polynucleotide encoding one or more reprogramming factors but not EBNA or its derivatives, wherein at least one of the one or more first plasmids comprises a polynucleotide encoding OCT4; and, optionally, (2) one of: (i) a second plasmid comprising a nucleotide sequence encoding EBNA, the second plasmid not comprising an origin of replication or a polynucleotide(s) encoding the reprogramming factor(s); (ii) EBNA mRNA; or (iii) EBNA protein. In some embodiments, the second plasmid of the system has a high loss rate, and expression of EBNA by the second plasmid is short-lived, transient, and temporary. In some other embodiments, the system does not provide for EBNA replication and / or continuous expression in the nucleus. In one embodiment, the system may allow for transient / cytoplasmic expression of EBNA for a short period of time and prior to the appearance of pluripotent cell morphology and inducible expression of endogenous pluripotency genes. In some embodiments, the short period for EBNA expression is about 4, 5, 6, 7, or 8 days post-transfection, but not more than 14, 15, 16, 17, 18, 20, 21, 22, 22, 23, 24, or 25 days post-transfection. In some other embodiments, the system also allows for transient / cytoplasmic expression of one or more reprogramming factors contained in the first plasmid(s) for a short period of time and prior to the appearance of pluripotent cell morphology and inducible expression of endogenous pluripotency genes.
[0021] In one embodiment of this system, the origin of replication of the first plasmid(s) is selected from the group consisting of Polyomavirinae virus, Papillomavirinae virus, and Gammaherpesvirinae virus. In some embodiments, the origin of replication is selected from the group consisting of SV40, BK virus (BKV), bovine papillomavirus (BPV), or Epstein-Barr virus (EBV). In a specific embodiment, the origin of replication corresponds to or is derived from the wild-type origin of replication of EBV. In some other embodiments, the EBNA of the second plasmid in the system is EBV-based. In some embodiments, the system provides one or more first plasmids collectively comprising polynucleotides encoding reprogramming factor(s), including one or more of OCT4, SOX2, NANOG, KLF, LIN28, c-MYC, ECAT1, UTF1, ESRRB, HESRG, CDH1, TDGF1, DPPA4, DNMT3B, ZIC3, and L1TD1. In some embodiments, the polynucleotides encoding the reprogramming factors are contained in a polycistronic or non-polycistronic construct of the first plasmid. In one embodiment of a polycistronic construct, the construct contains a single open reading frame or multiple open reading frames. In embodiments in which the system contains two or more first plasmids, each first plasmid can contain the same or different reprogramming factors encoded by at least one copy of the polynucleotide. In these embodiments in which the system contains two or more first plasmids, the system provides control over the stoichiometry of the reprogramming factors.
[0022] In some embodiments of the system, the first plasmid contains two or more polynucleotides encoding reprogramming factors, and adjacent polynucleotides are operably linked by a linker sequence encoding a self-cleaving peptide or an IRES. In one embodiment, the self-cleaving peptide is a 2A peptide selected from the group consisting of F2A, E2A, P2A, and T2A. In another embodiment, the 2A peptides contained in the first plasmid construct can be the same or different. In yet another embodiment, the system plasmid contains multiple 2A peptides, and two 2A peptides at adjacent positions are different. In some other embodiments of the system, the first and second plasmids each contain one or more promoters for expression of the reprogramming factors and EBNA, and the one or more promoters include at least one of CMV, EF1α, PGK, CAG, UBC, and other suitable promoters that are constitutive, inducible, endogenously regulated, or time-specific, tissue-specific, or cell-type-specific. In one embodiment, the first and second plasmids each contain a CAG promoter.
[0023] Kits containing the in vitro systems described herein are also provided.
[0024] Various objects and advantages of the present method and compositions of use will become apparent from the following description, taken in conjunction with the accompanying drawings, which set forth, by way of illustration and example, certain embodiments of the invention. [Brief explanation of the drawings]
[0025] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0026] [Figure 1]Diagrams of the DNA constructs of Vector 1 and Vector 2 used in the STTR (short-lived transient and transient reprogramming) system and of the DNA construct of an additional Vector 3 used together with Vector 1 and Vector 2 for the EmTTR (EBNA-mediated transient and transient reprogramming) system are shown. [Figure 2] Flow cytometry analysis of SSEA4+ / TRA181+ pluripotency marker expression 15 days after transfection of fibroblasts using the EmTTR system. [Figure 3] Shown is staining for pluripotency markers OCT4, NANOG, TRA181, and SSEA4 30 days after transfection to confirm the appearance of colonies expressing iPSC markers using the EmTTR system. [Figure 4] Flow cytometry analysis of SSEA4+ / TRA181+ pluripotency marker expression 15 days after transfection of fibroblasts using the STTR system. [Figure 5] Shown is staining for pluripotency markers OCT4, NANOG, TRA181, and SSEA4 30 days after transfection to confirm the appearance of colonies expressing iPSC markers using the STTR system. [Figure 6] We show that the majority of the STTR-derived population maintains expression of all three markers of pluripotency, whereas the EmTTR-induced population appears to have lost pluripotency as indicated by a significant decrease in CD30 expression 25 days after transfection. [Figure 7] Figure 2 shows the difference in pluripotency stability between iPSC colonies derived from EmTTR and STTR at day 28 after serial passage. A: iPSC colony morphology and differentiated clusters during culture in both populations. B: The STTR population maintained iPSC colonies with minimal spontaneous differentiation, while the EmTTR population showed high levels of spontaneous differentiation with only a few iPSC colonies present. [Figure 8]1 shows gene expression analysis of EBNA carried in Vector 2 and endogenous OCT4 expression in cell populations during cell reprogramming of fibroblasts using the STTR system. [Figure 9] Characterization of iPSCs obtained using STTR for pluripotency expression and demonstration of teratoma formation in mice. A. Phase images of iPSC clones. B. Flow analysis of SSEA4+ / TRA181+ pluripotency marker expression. C. Immunofluorescence staining of clones for pluripotency markers OCT4, NANOG, TRA181, and SSEA4. D. Ability of iPSC clones to differentiate into three germ layers: endoderm, mesoderm, and ectoderm. [Figure 10] Flow cytometry analysis of SSEA4+ / TRA181+ pluripotency marker expression 15 days after transfection of fibroblasts with the STTR system with additional reprogramming factors. DETAILED DESCRIPTION OF THE INVENTION
[0027] definition Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. For purposes of the present invention, the following terms are defined below. The articles "a," "an," and "the" are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an element" means one element or more than one element.
[0028] The use of the alternative (e.g., "or") should be understood to mean either one, both, or any combination thereof of the alternatives. The term "and / or" should be understood to mean either one or both of the alternatives.
[0029] As used herein, the term "about" or "approximately" refers to an amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length that varies by about 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% compared to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight, or length. In one embodiment, the term "about" or "approximately" refers to a range of ±15%, ±10%, ±9%, ±8%, ±7%, ±6%, ±5%, ±4%, ±3%, ±2%, or ±1% of the amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length relative to the reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight, or length.
[0030] As used herein, the term "substantially" or "essentially" refers to an amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length that is about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more compared to a reference amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length. In one embodiment, the term "essentially the same" or "substantially the same" refers to an amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length range that is about the same as the reference amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length.
[0031] As used herein, the terms "substantially free" and "essentially free" are used interchangeably and, when used to describe a composition such as a cell population or culture medium, refer to a composition that is free of a particular substance or source thereof, e.g., 95% free, 96% free, 97% free, 98% free, 99% free, or undetectable as measured by conventional means. The term "free" or "essentially free" of a particular component or substance in a composition also means that such component or substance (1) is not present in the composition at any concentration, or (2) is present in the composition at a low but functionally inactive concentration. A similar meaning can be applied to the term "absent," which refers to the absence of a particular substance or source thereof in a composition.
[0032] As used herein, the term "isolated" refers to a cell or cell population that has been separated from its original environment; i.e., the environment of the isolated cell is substantially free of at least one component found in the environment of the "non-isolated" reference cell. This term includes cells that have been removed from some or all components found in their natural environment, e.g., tissue, biopsy. This term also includes cells that have been removed from at least one, some, or all components found in a non-natural environment, e.g., culture, cell suspension. Thus, an isolated cell is partially or completely separated from at least one component, including other substances, cells, or cell populations found in nature or grown, stored, or maintained in a non-natural environment. Specific examples of isolated cells include partially pure cells, substantially pure cells, and cells cultured in a non-natural medium. Isolated cells can be obtained by separating a desired cell or population from other substances or cells in the environment, or by removing one or more other cell populations or subpopulations from the environment.
[0033] As used herein, the term "purify" or the like refers to increasing purity. For example, purity can be increased to at least 50%, 60%, 70%, 80%, 90%, 95%, 99%, or 100%.
[0034] Throughout this specification, unless the context requires otherwise, the words "comprise," "comprises," and "comprising" are understood to refer to the inclusion of a stated step or element or group of steps or elements, but not to the exclusion of any other step or element or group of steps or elements. In certain embodiments, the terms "comprise," "have," "contain," and "comprising" are used interchangeably.
[0035] "Consisting of" means including and limited to what follows the phrase "consisting of." Thus, the phrase "consisting of" indicates that the listed elements are required or essential, and that no other elements may be present.
[0036] "Consisting essentially of" means including any elements listed after the phrase, limited to other elements that do not interfere with or contribute to the activity or function indicated in the disclosure of the listed elements. Thus, the phrase "consisting essentially of" indicates that the listed elements are required or essential, but other elements are not optional and may or may not be present depending on whether they affect the activity or function of the listed elements.
[0037] Throughout this specification, references to "one embodiment," "an embodiment," "a special embodiment," "a related embodiment," "a particular embodiment," "an additional embodiment," or "a further embodiment," or combinations thereof, mean that the particular feature, structure, or characteristic described in connection with the embodiment is included in at least one embodiment of the invention. Thus, the appearances of such phrases in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments.
[0038] The term "ex vivo" generally refers to activities occurring outside of a living organism, such as experiments or measurements performed in or on living tissue in an artificial environment outside of a living organism, preferably with minimal alteration of its natural state. In certain embodiments, "ex vivo" procedures involve live cells or tissues taken from an organism and cultured in a laboratory setting, usually under sterile conditions, typically for a few hours or up to about 24 hours, but depending on the circumstances, for up to 48 or 72 hours or longer. In certain embodiments, such tissues or cells can be collected and frozen, and then thawed for ex vivo therapy. Tissue culture experiments or procedures lasting several days or longer using living cells or tissues are typically considered "in vitro," although in certain embodiments, the term can be used interchangeably with ex vivo.
[0039] The term "in vivo" generally refers to activities that occur inside a living organism.
[0040] As used herein, the terms "reprogramming" or "dedifferentiation" or "enhancing differentiation potential" or "enhancing developmental potential" refer to methods or processes that enhance the pluripotency of a cell or dedifferentiate a cell into a less differentiated state. For example, a cell whose pluripotency has been enhanced has more developmental plasticity (i.e., can differentiate into more cell types) compared to the same cell in a non-reprogrammed state. In other words, a reprogrammed cell is a cell that is less differentiated than the same cell in a non-reprogrammed state. In contrast to a reprogrammed cell, a "reprogramming cell" refers to a non-pluripotent cell undergoing reprogramming / dedifferentiation to a pluripotent state that exhibits a transitional morphology (i.e., a change in morphology) without the characteristics of a pluripotent cell, including pluripotent stem cell morphology or stable endogenous pluripotency gene expression, such as OCT4, NANOG, SOX2, SSEA4, TRA181, CD30, and / or CD50. The transitional morphology of a reprogramming cell is distinct from the starting non-pluripotent cell prior to the induction of reprogramming, as well as from a reprogrammed cell that has the characteristic morphology of an embryonic stem cell. For example, when reprogramming fibroblasts, morphological changes in the reprogramming cells include MET (mesenchymal to epithelial transition). Those skilled in the art will readily understand and identify such transitional forms of various types of somatic cells that are induced to reprogram. In some embodiments, the reprogramming cells are intermediate cells that have been induced to reprogram for at least 1, 2, 3, 4, 5, 6, 7, 8 days or more, but not more than 21, 22, 24, 26, 28, 30, 32, 35, 40 days, or any number of days in between, and the cells have not yet reached a self-maintaining or self-sustaining pluripotent state. Non-pluripotent cells can be induced to reprogram when one or more reprogramming factors are introduced into the cells. Reprogramming cells induced to reprogram for 1, 2, 3, or 4 days are cells 1, 2, 3, or 4 days after transduction of the reprogramming factors (the day of transduction is day 0).Unlike somatic cells before exposure to exogenous expression of reprogramming factors, reprogramming cells progress through the reprogramming process to reach a stable pluripotent state and, given sufficient time, become reprogrammed cells even in the absence of exogenously expressed reprogramming factors.
[0041] As used herein, the term "induced pluripotent stem cells" or "iPSCs" means stem cells produced from differentiated adult, neonatal, or fetal cells that have been induced or transformed (i.e., reprogrammed) into cells that can differentiate into tissues of all three germ layers, mesoderm, endoderm, and ectoderm, or dermal layers.
[0042] The term "embryonic stem cell" as used herein refers to the pluripotent stem cells of natural origin in the inner cell mass of blastocyst.Embryonic stem cells are pluripotent and generate all three major germinal components of ectoderm, endoderm, and mesoderm during development.They do not contribute to extraembryonic membranes or placenta, and are not totipotent.
[0043] As used herein, the term "multipotent stem cells" refers to cells that have the developmental potential to differentiate into cells of one or more germ layers (ectoderm, mesoderm, and endoderm), but not all three. Therefore, multipotent cells can also be called "partially differentiated cells." Multipotent cells are well known in the art, and examples of multipotent cells include adult stem cells, such as hematopoietic stem cells and neural stem cells. "Multipotency" indicates that a cell can form many types of cells in a specific lineage, but cannot form cells of other lineages. For example, multipotent hematopoietic cells can form various types of blood cells (red blood cells, white blood cells, platelets, etc.), but cannot form neurons. Therefore, the term "multipotency" refers to a state of a cell that has a degree of developmental potential lower than totipotency and pluripotency.
[0044] As used herein, the term "pluripotency" refers to the ability of a cell to form all lineages of the body or somatic cells (i.e., embryo proper). For example, embryonic stem cells are a type of pluripotent stem cell that can form cells from each of the three germ layers, ectoderm, mesoderm, and endoderm. Pluripotency is a continuum of developmental potential ranging from incompletely or partially pluripotent cells (e.g., epiblast stem cells or EpiSCs) that cannot give rise to a complete organism, to more primitive, more pluripotent cells (e.g., embryonic stem cells) that can give rise to a complete organism.
[0045] Pluripotency can be determined, in part, by assessing the pluripotent properties of cells, including (i) pluripotent stem cell morphology, (ii) the potential for unlimited self-renewal, (iii) the expression of pluripotent stem cell markers, including, but not limited to, SSEA1 (mouse only), SSEA3 / 4, SSEA5, TRA1-60, TRA1-81, TRA1-85, TRA2-54, GCTM-2, TG343, TG30, CD9, CD29, CD133 / prominin, CD140a, CD56, CD73, CD90, CD105, OCT4, NANOG, SOX2, CD30, and / or CD50, (iv) the ability to differentiate into all three somatic lineages (ectoderm, mesoderm, and endoderm), (v) the formation of teratomas composed of the three somatic lineages, and (vi) the formation of embryoid bodies composed of cells of the three somatic lineages.
[0046] Two types of pluripotency have been described: a "primed" or "metastable" state resembling epiblast stem cells (EpiSCs) in late blastocysts, and a "naive" or "ground" state resembling the inner cell population of early / preimplantation blastocysts. While both pluripotent states exhibit the characteristics described above, the naive or ground state additionally exhibits (i) pre- or reactivation of the X chromosome in female cells, (ii) enhanced clonality and viability in single-cell culture, (iii) overall decreased DNA methylation, (iv) decreased deposition of H3K27me3 repressive chromatin marks on developmentally regulated gene promoters, and (v) decreased expression of differentiation markers compared to primed pluripotent cells. Standard cell reprogramming methodologies, in which exogenous pluripotency genes are introduced into somatic cells, expressed, and then silenced or removed from the resulting pluripotent cells, are generally viewed as possessing the characteristics of primed pluripotency. Under standard pluripotent cell culture conditions, such cells remain in a primed state and exhibit ground state characteristics unless expression of an exogenous transgene is maintained.
[0047] As used herein, the term "pluripotent stem cell morphology" refers to the classic morphological characteristics of embryonic stem cells. Normal embryonic stem cell morphology is characterized by a round and compact shape, a high nucleus-to-cytoplasm ratio, prominent nucleoli, and typical cell spacing.
[0048] " Pluripotency factor " or " reprogramming factor " refers to a drug or drug combination that is used to induce or enhance the developmental potential of cells. Pluripotency factors include, but are not limited to, polynucleotides, polypeptides, and small molecules that can enhance the developmental potential of cells. Exemplary pluripotency factors include, for example, transcription factors OCT4 and SOX2, and small molecule reprogramming agents, such as TGFβ inhibitors, GSK3 inhibitors, MEK inhibitors, and ROCK inhibitors.
[0049] As used herein, the term "differentiation" refers to the process by which an unspecialized ("uncommitted") or less specialized cell acquires the characteristics of a specialized cell, such as a blood cell or muscle cell. A differentiated or differentiation-induced cell is one that has occupied a more specialized ("committed") position within the cell's lineage. The term "committed," when applied to the process of differentiation, refers to a cell that has progressed in the differentiation pathway to a point where, under normal circumstances, it will continue to differentiate into a particular cell type or subset of cell types and cannot, under normal circumstances, differentiate into a different cell type or revert to a less differentiated cell type.
[0050] Differentiation of pluripotent stem cells requires modifications to the culture system, such as the addition of stimuli to the medium or changes in the physical state of the cells. Most conventional strategies utilize the formation of embryoid bodies (EBs) as a common and critical intermediate for initiating lineage-specific differentiation. "Embryoid bodies" are three-dimensional clusters that have been shown to mimic embryonic development because they give rise to multiple lineages within a three-dimensional area. Typically, over a period of hours to days, simple EBs (e.g., aggregated pluripotent stem cells induced to differentiate) continue maturing and develop into cystic EBs, at which point they are further processed to continue differentiation, typically over a period of days to weeks. EB formation is initiated by placing pluripotent stem cells in close proximity to each other in three-dimensional multilayered clusters of cells; this is typically achieved by one of several methods, including sedimenting pluripotent cells into droplets, sedimenting cells into "U"-bottom well plates, or by mechanical agitation. Because aggregates maintained in pluripotency culture maintenance medium do not form proper EBs, pluripotent stem cell aggregates require further differentiation cues to promote EB development. As such, pluripotent stem cell aggregates must be transferred to a differentiation medium that provides cues to induce them toward a selected lineage. EB-based culture of pluripotent stem cells typically generates differentiated cell populations (ectoderm, mesoderm, and endoderm germ layers) accompanied by moderate proliferation within the EB cell clusters. However, although proven to promote cell differentiation, EBs often give rise to heterogeneous cells in various differentiation states due to inconsistent exposure of cells within the three-dimensional structure to differentiation cues from the environment. Furthermore, EBs are difficult to create and maintain. Furthermore, EB-mediated cell differentiation is accompanied by moderate cell proliferation, which also contributes to low differentiation efficiency.
[0051] In contrast, "aggregate formation," which differs from "EB formation," can be used to expand populations of pluripotent stem cell-derived cells. For example, during aggregate-based pluripotent stem cell expansion, media are selected to maintain proliferation and pluripotency. Generally, cell proliferation increases aggregate size, leading to the formation of larger aggregates, which can then be routinely mechanically or enzymatically dissociated into smaller aggregates to maintain cell proliferation and increase cell numbers in culture. Unlike EB culture, cells cultured within aggregates in maintenance cultures maintain markers of pluripotency. Pluripotent stem cell aggregates require additional differentiation cues to induce differentiation.
[0052] As used herein, "monolayer differentiation" refers to a differentiation method that differs from differentiation through three-dimensional multilayered clusters of cells, i.e., "EB formation." Among other advantages disclosed herein, monolayer differentiation avoids the need for EB formation to initiate differentiation. Because monolayer culture does not mimic embryonic development such as EB formation, differentiation into specific lineages is considered minimal compared to differentiation into all three germ layers in EBs.
[0053] As used herein, "dissociated" cells refer to cells that have been substantially separated or purified away from other cells or surfaces (e.g., culture plate surfaces). For example, cells can be dissociated from animals or tissues by mechanical or enzymatic methods. Alternatively, cells that aggregate in vitro can be enzymatically or mechanically dissociated from one another, such as by dissociation into clusters, single cells, or a suspension of a mixture of single cells and clusters. In yet another alternative embodiment, adherent cells are dissociated from a culture plate or other surface. Thus, dissociation includes disruption of cellular interactions with the extracellular matrix (ECM) and substrate (e.g., culture surface) or disruption of the ECM between cells.
[0054] As used herein, "feeder cells" or "feeders" are terms used to describe cells of one type that are co-cultured with cells of a second type, providing an environment in which the cells can grow because the feeder cells provide growth factors and nutrients for the support of the second cell type. Feeder cells may be derived from a different species than the cells they support. For example, certain types of human cells, including stem cells, are supported by primary cultures of mouse embryonic fibroblasts or immortalized mouse embryonic fibroblasts. Feeder cells can typically be inactivated when co-cultured with other cells by irradiation or treatment with antimitotic agents such as mitomycin to prevent them from growing beyond the supporting cells. Feeder cells can include endothelial cells, stromal cells (e.g., epithelial cells or fibroblasts), and leukemia cells. Without limiting the foregoing, one particular feeder cell type can be a human feeder, such as human dermal fibroblasts. Another feeder cell type can be mouse embryonic fibroblasts (MEFs). In general, various feeder cells can be used in part to maintain pluripotency, direct differentiation down specific lineages, and promote maturation into specialized cell types such as effector cells.
[0055] As used herein, a "feeder-free" (FF) environment refers to an environment, such as a culture condition, cell culture, or medium, that is essentially free of feeder cells and / or has not been preconditioned by culturing feeder cells. "Preconditioned" medium refers to medium collected after feeder cells have been cultured in the medium for a period of time, such as at least one day. Preconditioned medium contains many mediator substances, such as growth factors and cytokines, secreted by the feeder cells. In some embodiments, a feeder-free environment does not contain feeder cells or has not been preconditioned by culturing feeder cells. Feeder cells include, but are not limited to, stromal cells, mouse embryonic fibroblasts, human fibroblasts, keratinocytes, and embryonic stem cells.
[0056] "Culture" or "cell culture" refers to the maintenance, growth, and / or differentiation of cells in an in vitro environment. "Cell culture medium," "culture medium" (each singular "medium"), "supplement," and "medium supplement" refer to nutritional compositions in which cell cultures are cultivated.
[0057] "Culturing" or "maintaining" refers to maintaining, expanding (growing), and / or differentiating cells outside a tissue or outside the body, for example, in sterile plastic (or coated plastic) cell culture dishes or flasks. "Culturing" or "maintaining" may utilize culture medium as a source of nutrients, hormones, and / or other factors that help to grow and / or maintain the cells.
[0058] As used herein, "passage" or "passaging" refers to the act of dividing cultured cells by subdividing and plating the cells onto multiple cell culture surfaces or vessels when the cells have proliferated to a desired extent. In some embodiments, "passage" or "passaging" refers to subdividing, diluting, and plating the cells. As cells are passed from a primary culture surface or vessel to the next set of surfaces or vessels, subsequent cultures may be referred to herein as "secondary cultures" or "first passages," etc. Each act of subdividing and plating onto a new vessel is considered one passage. In some embodiments, cultured cells are passaged every 1, 2, 3, 4, 5, 6, 7, or more days. In some embodiments, iPSCs initially selected after reprogramming are passaged once every 3-7 days.
[0059] "Functional" as used in the context of genome editing or modification of iPSCs and derived non-pluripotent cells differentiated therefrom, or genome editing or modification of non-pluripotent cells and derived iPSCs reprogrammed therefrom, refers to (1) at the genetic level, successful knock-in, knock-out, knock-down gene expression, transgenic, or controlled gene expression, e.g., inducible or transient expression at a desired cellular developmental stage achieved by direct genome editing or modification, or by "passing-on" via differentiation or reprogramming from an initially genome-engineered starting cell, or (2) at the cellular level, (i) by direct genome editing. "Genome editing" refers to the successful removal, addition, or alteration of a cellular function / property by (i) a gene expression modification obtained in the cell through "transfer" from the original genomically engineered starting cell, (ii) a gene expression modification maintained in the cell by "transfer" via differentiation or reprogramming from the original genomically engineered starting cell, (iii) a downstream gene regulation in the cell as a result of a gene expression modification that is manifest only in the early developmental stages of the cell or only in the starting cell that gave rise to the cell through differentiation or reprogramming, or (iv) an enhanced or newly achieved cellular function or attribute exhibited in the mature cell product originally derived from genome editing or modifications made in the iPSC, progenitor, or de-differentiated cell of origin.
[0060] As used herein, the term "genetic imprint" refers to genetic or epigenetic information that contributes to the preferential therapeutic attributes of a source cell or iPSC and can be retained in source cell-derived iPSCs and / or iPSC-derived non-native hematopoietic cells. As used herein, a "source cell" refers to a non-pluripotent cell that can be used to generate iPSCs through reprogramming, and source cell-derived iPSCs can further differentiate into specific cell types, including any hematopoietic cell. Source cell-derived iPSCs and cells differentiated therefrom may be collectively referred to as "derived cells," depending on the context. As used herein, the genetic imprint(s) that contribute to the preferential therapeutic attributes are incorporated into iPSCs either by reprogramming selected source cells specific to a donor, disease, or treatment response, or by introducing a genetic modification modality into the iPSCs using genome editing. In embodiments of source cells obtained from specifically selected donors, diseases, or therapeutic situations, genetic imprints that contribute to preferential therapeutic attributes can include any situation-specific genetic or epigenetic modifications that manifest a retainable phenotype, i.e., preferential therapeutic attribute, that are transferred to derived cells of the selected source cells, regardless of whether the underlying molecular events have been identified. Donor-, disease-, or therapeutic response-specific source cells can include genetic imprints that can be retained in iPSCs and derived hematopoietic cells, including, but not limited to, prearranged monospecific TCRs from virus-specific T cells or invariant natural killer T (iNKT) cells, traceable and desirable genetic polymorphisms, e.g., homozygotes for point mutations encoding the selected donor's high-affinity CD16 receptor, and selected HLA-matched donor cells that exhibit predetermined HLA requirements, i.e., haplotypes in an expanded population. As used herein, preferential therapeutic attributes include improved engraftment, trafficking, homing, viability, self-renewal, persistence, immune response control and modulation, survival, and cytotoxicity of the derived cells.Preferential therapeutic attributes may also be related to antigen targeting receptor expression, HLA presentation or lack thereof, tolerance to the tumor microenvironment, induction and immunomodulation of bystander immune cells, improved on-target specificity with reduced off-tumor effects, and resistance to treatments such as chemotherapy.
[0061] As used herein, "genetic modification" refers to gene editing, including (1) naturally occurring from rearrangements, mutations, genetic imprinting, and / or epigenetic modifications, or (2) obtained through genome engineering by insertion, deletion, or substitution into the genome of a cell. Genetic modification, as used herein, also includes one or more retainable therapeutic attributes of source-specific immune cells that are donor, disease, or treatment response specific.
[0062] As used herein, the term "enhanced therapeutic properties" refers to the therapeutic properties of a cell that are enhanced compared to typical cells of the same general cell type. In the context of immune cells, for example, NK cells with "enhanced therapeutic properties" would have enhanced, improved, and / or expanded therapeutic properties compared to typical, unmodified, and / or naturally occurring NK cells. Therapeutic properties of immune cells include, but are not limited to, cell engraftment, trafficking, homing, viability, self-renewal, persistence, immune response control and modulation, survival, and cytotoxicity. Therapeutic properties of immune cells are also manifested by antigen-targeting receptor expression, HLA presentation or lack thereof, tolerance to the tumor microenvironment, induction and immunomodulation of bystander immune cells, improved on-target specificity with reduced off-tumor effects, and resistance to treatments such as chemotherapy.
[0063] "Integration" means that one or more nucleotides of a construct are stably inserted into a cell's genome, i.e., covalently linked to a nucleic acid sequence within the cell's chromosomal DNA. "Targeted integration" means that a nucleotide(s) of a construct are inserted into a preselected site or "integration site" of a cell's chromosome or mitochondrial DNA. As used herein, the term "integration" further refers to a process that encompasses the insertion of one or more exogenous sequences or nucleotides of a construct, with or without deletion of the endogenous sequence or nucleotide at the integration site. If there is a deletion at the insertion site, "integration" may further include replacement of the deleted endogenous sequence or nucleotide with one or more inserted nucleotides.
[0064] A "construct" refers to a polymeric or molecular complex containing a polynucleotide that is delivered to a host cell either in vitro or in vivo. As used herein, a "vector" refers to any nucleic acid construct capable of directing the delivery or transfer of foreign genetic material to a target cell where it can replicate and / or express. As used herein, the term "vector" includes the delivered construct. A vector may be a linear or circular molecule. A vector may be integrating or non-integrating. Major types of vectors include, but are not limited to, plasmids, episomal vectors, viral vectors, cosmids, and artificial chromosomes. Viral vectors include, but are not limited to, adenoviral vectors, adeno-associated viral vectors, retroviral vectors, lentiviral vectors, Sendai viral vectors, etc.
[0065] As used herein, the term "encode" refers to the inherent property of a particular sequence of nucleotides in a polynucleotide, such as a gene, cDNA, or mRNA, to serve as a template for the synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA, and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein when transcription and translation of the mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, whose nucleotide sequence is identical to the mRNA sequence and is usually set forth in a sequence listing, and the non-coding strand, which is used as a template for transcription of the gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
[0066] The term "exogenous," as used herein, is intended to mean that a reference molecule or activity is introduced into a host cell. The molecule can be introduced by introducing an encoding nucleic acid into the host genetic material, such as by integration into a host chromosome, or as non-chromosomal genetic material, such as a plasmid. Thus, the term used with respect to expression of an encoding nucleic acid refers to the introduction of the encoding nucleic acid in an expressible form into a cell. The term "endogenous" refers to a reference molecule or activity that is present in a host cell. Similarly, when used with respect to expression of an encoding nucleic acid, the term refers to expression of an encoding nucleic acid that is contained within the cell and not exogenously introduced.
[0067] As used herein, a "gene of interest" or a "polynucleotide sequence of interest" is a DNA sequence that, when placed under the control of an appropriate regulatory sequence, is transcribed into RNA and, in some cases, translated into a polypeptide. A gene of interest or a polynucleotide may include, but is not limited to, a prokaryotic sequence, a cDNA from eukaryotic mRNA, a genomic DNA sequence from eukaryotic (e.g., mammalian) DNA, and a synthetic DNA sequence. For example, a gene of interest may encode an miRNA, an shRNA, a natural polypeptide (i.e., a polypeptide found in nature) or a fragment thereof. A variant polypeptide (i.e., a variant of a natural polypeptide that has less than 100% sequence identity with the natural polypeptide) or a fragment thereof, an engineered polypeptide or peptide fragment, a therapeutic peptide or polypeptide, an imaging marker, a selectable marker, etc.
[0068] As used herein, the term "polynucleotide" refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or their analogs. The sequence of a polynucleotide is composed of the four nucleotide bases: adenine (A), cytosine (C), guanine (G), thymine (T), and, if the polynucleotide is RNA, uracil (U) instead of thymine. Polynucleotides can include genes or gene fragments (such as probes, primers, ESTs, or SAGE tags), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. Polynucleotide also refers to both double-stranded and single-stranded molecules.
[0069] As used herein, the terms "peptide," "polypeptide," and "protein" are used interchangeably and refer to molecules having amino acid residues covalently linked by peptide bonds. A polypeptide must contain at least two amino acids, and there is no limit to the maximum number of amino acids a polypeptide may contain. The term is used herein to refer to both short chains, e.g., commonly referred to in the art as peptides, oligopeptides, and oligomers, and longer chains, commonly referred to in the art as polypeptides or proteins. "Polypeptide" includes, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, polypeptide variants, modified polypeptides, derivatives, analogs, and fusion proteins, among others. Polypeptides include naturally occurring polypeptides, recombinant polypeptides, synthetic polypeptides, or combinations thereof.
[0070] "Operably linked" refers to the association of nucleic acid sequences on a single nucleic acid fragment such that the function of one is affected by the other. For example, a promoter is operably linked to a coding sequence or functional RNA if it can affect the expression of that coding sequence or functional RNA (i.e., if the coding sequence or functional RNA is under the transcriptional control of the promoter). The coding sequence can be operably linked to a regulatory sequence in sense or antisense orientation.
[0071] As used herein, the term "engager" refers to a molecule, e.g., a fusion polypeptide, that can form a link between an immune cell, e.g., a T cell, a NK cell, a NKT cell, a B cell, a macrophage, or a neutrophil, and a tumor cell to activate the immune cell. Examples of engagers include, but are not limited to, a bispecific T cell engager (BiTE), a bispecific killer cell engager (BiKE), a trispecific killer cell engager, or a multispecific killer cell engager, or a universal engager compatible with multiple immune cell types.
[0072] As used herein, the term "surface triggering receptor" refers to a receptor that can induce or initiate an immune response, e.g., a cytotoxic response. Surface triggering receptors can be engineered and expressed on effector cells, such as T cells, NK cells, NKT cells, B cells, macrophages, and neutrophils. In some embodiments, the surface triggering receptor promotes bispecific or multispecific antibody engagement between an effector cell and a specific target cell, e.g., a tumor cell, regardless of the effector cell's native receptor and cell type. This approach can be used to generate iPSCs containing a universal surface triggering receptor, and such iPSCs can be differentiated into a population of various effector cell types that express the universal surface triggering receptor. "Universal" means that the surface triggering receptor can be expressed and activated on any effector cell, regardless of cell type, and all effector cells that express the universal receptor can bind or ligate to an engager that has the same epitope recognizable by the surface triggering receptor, regardless of the engager's tumor-binding specificity. In some embodiments, an engager with the same tumor-targeting specificity is used to bind to the universal surface triggering receptor. In some embodiments, engagers with different tumor-targeting specificities are used to bind to a universal surface triggering receptor, thereby engaging one or more effector cell types to kill one specific type of tumor cell or two or more types of tumors. Surface triggering receptors generally contain a costimulatory domain for effector cell activation and an anti-epitope specific for the engager epitope. Bispecific engagers are specific for the anti-epitope of a surface triggering receptor on one end and for a tumor antigen on the other end.
[0073] The term "safety switch protein" as used herein refers to an engineered protein designed to prevent potential toxicity or other adverse effects of cell therapy. In some cases, expression of the safety switch protein is conditionally controlled to address safety concerns of transplanted engineered cells that have permanently integrated a gene encoding the safety switch protein into their genome. This conditional regulation can be variable and can include post-translational activation via small molecules and tissue-specific and / or temporal transcriptional regulation. Safety switches may mediate induction of apoptosis, inhibition of protein synthesis, DNA replication, growth arrest, transcriptional and post-transcriptional genetic regulation, and / or antibody-mediated depletion. In some examples, safety switch proteins are activated by exogenous molecules, e.g., prodrugs, which, upon activation, trigger apoptosis and / or cell death of the treated cells. Examples of safety switch proteins include, but are not limited to, suicide genes such as caspase 9 (or caspase 3 or 7), thymidine kinase, cytosine deaminase, B-cell CD20, modified EGFR, and any combination thereof. In this strategy, a prodrug administered upon the occurrence of an adverse event is activated by the suicide gene product and kills the transduced cells.
[0074] As used herein, the term "pharmaceutically active protein or peptide" refers to a protein or peptide capable of achieving a biological and / or pharmaceutical effect on an organism. Pharmaceutically active proteins have curative or palliative properties and can be administered to ameliorate, alleviate, relieve, reverse, or reduce the severity of a disease. Pharmaceutically active proteins also have prophylactic properties and are used to prevent the onset of a disease or, if initiated, to reduce the severity of such a disease or condition. Pharmaceutically active proteins include whole proteins or peptides or pharmaceutically active fragments thereof. They also include pharmaceutically active analogs of proteins or peptides or analogs of fragments of proteins or peptides. The term pharmaceutically active protein also refers to multiple proteins or peptides that act cooperatively or synergistically to provide a therapeutic benefit. Examples of pharmaceutically active proteins or peptides include, but are not limited to, receptors, binding proteins, transcription and translation factors, tumor growth suppressor proteins, antibodies or fragments thereof, growth factors, and / or cytokines.
[0075] As used herein, the term "signaling molecule" refers to any molecule that regulates, participates in, inhibits, activates, decreases, or increases cell signaling. Signal transduction refers to the transmission of a molecular signal in the form of a chemical modification through the recruitment of protein complexes along a pathway that ultimately leads to a biochemical event within the cell. Signaling pathways are well known in the art and include, but are not limited to, G protein-coupled receptor signaling, tyrosine kinase receptor signaling, integrin signaling, Tollgate signaling, ligand-gated ion channel signaling, ERK / MAPK signaling pathway, Wnt signaling pathway, cAMP-dependent pathway, and IP3 / DAG signaling pathway.
[0076] As used herein, the term "targeting modality" refers to a molecule, e.g., a polypeptide, that is genetically incorporated into a cell to promote antigen and / or epitope specificity, including, but not limited to: i) antigen specificity, whether associated with a unique chimeric antigen receptor (CAR) or T cell receptor (TCR); ii) engager specificity, whether associated with a monoclonal antibody or bispecific engager; iii) targeting of transformed cells; iv) targeting of cancer stem cells; and v) other targeting strategies in the absence of a specific antigen or surface molecule.
[0077] As used herein, the terms "specific" or "specificity" refer to the ability of a molecule, e.g., a receptor or engager, to selectively bind to a target molecule, as opposed to non-specific or non-specific binding.
[0078] "HLA deficiency," including HLA class I deficiency, HLA class II deficiency, or both, refers to cells that lack, no longer maintain, or have reduced surface expression levels of complete MHC complexes containing HLA class I protein heterodimers and / or HLA class II heterodimers, such that the reduced or decreased levels are lower than those inherently detectable by other cells or by synthetic methods. HLA class I deficiency can be achieved by functional deletion of any region of the HLA class I locus (chromosome 6p21) or by deletion or reduction of the expression levels of HLA class I-related genes, including, but not limited to, the beta 2 microglobulin (B2M) gene, the TAP 1 gene, the TAP 2 gene, and tapasin. HLA class II deficiency can be achieved by functional deletion or reduction of HLA-II-related genes, including, but not limited to, RFXANK, CIITA, RFX5, and RFXAP. Prior to the present invention, it was unclear whether HLA complex-deficient iPSCs or modified iPSCs have the ability to develop, mature, and generate functional differentiated cells while retaining regulated activity. Furthermore, prior to the present invention, it was unclear whether HLA complex-deficient differentiated cells could be reprogrammed into iPSCs and maintained as pluripotent stem cells while retaining HLA complex deficiency. Unexpected failures during cell reprogramming, maintenance of pluripotency, and differentiation may be related to aspects including, but not limited to, developmental stage-specific gene expression or lack thereof, the requirement for HLA complex presentation, protein shedding of introduced surface expression modalities, the need for proper and efficient clonal reprogramming, and the need for reconfiguration of differentiation protocols.
[0079] As used herein, "modified HLA-deficient iPSCs" refers to HLA-deficient iPSCs that have been further modified by introducing genes expressing proteins related to, but not limited to, improved differentiation potential, antigen targeting, antigen presentation, antibody recognition, persistence, immune evasion, suppression of tolerance, proliferation, costimulation, cytokine stimulation, cytokine production (autocrine or paracrine), chemotaxis, and cytotoxicity such as non-classical HLA class I proteins (e.g., HLA-E and HLA-G), chimeric antigen receptors (CARs), T cell receptors (TCRs), CD16 Fc receptors, BCL11b, NOTCH, RUNX1, IL15, 41BB, DAP10, DAP12, CD24, CD3z, 41BBL, CD47, CD113, and PDL1. Cells that are "modified HLA-deficient" also include cells other than iPSCs.
[0080] Fc receptors, abbreviated as FcR, are classified based on the type of antibody they recognize. For example, those that bind to IgG, the most common class of antibody, are called Fc-gamma receptors (FcγR), those that bind IgA are called Fc-alpha receptors (FcαR), and those that bind IgE are called Fc-epsilon receptors (FcεR). FcR classes are also distinguished by the cells that express them (macrophages, granulocytes, natural killer cells, T and B cells) and the signaling properties of each receptor. Fc-gamma receptors (FcγR) include several members with different molecular structures and therefore different antibody affinities, including FcγRI (CD64), FcγRIIA (CD32), FcγRIIB (CD32), FcγRIIIA (CD16a), and FcγRIIIB (CD16b).
[0081] CD16 has been identified as two isoforms of the Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b). CD16a is a transmembrane protein expressed by NK cells that binds to monomeric IgG attached to target cells, activating NK cells and promoting antibody-dependent cellular cytotoxicity (ADCC). As used herein, "high-affinity CD16," "non-cleavable CD16," or "high-affinity non-cleavable CD16" refer to variants of CD16. Wild-type CD16 has low affinity and is subject to exodomain shedding, a proteolytic cleavage process that controls the cell surface density of various cell surface molecules on leukocytes upon NK cell activation. F176V and F158V are exemplary CD16 variants with high affinity, while the S197P variant is an example of a non-cleavable version of CD16.
[0082] The term "adoptive cell therapy," as used herein, refers to cell-based immunotherapy involving the transfusion of autologous or allogeneic lymphocytes, such as CD34 cells, hemogenic endothelial cells, hematopoietic stem or progenitor cells, hematopoietic multipotent progenitor cells, T cell precursors, NK cell precursors, T cells, NKT cells, NK cells, B cells, or immunoregulatory cells, whether genetically modified or not, that have been expanded ex vivo prior to said transfusion.
[0083] As used herein, a "therapeutically sufficient amount" includes within its meaning a non-toxic but sufficient and / or effective amount of a particular therapeutic and / or pharmaceutical composition that refers to providing the desired therapeutic effect. The exact amount required will vary from subject to subject, depending on factors such as the patient's overall health, the patient's age, the stage and severity of the condition, and the like. In particular embodiments, a therapeutically sufficient amount is sufficient and / or effective to ameliorate, reduce, and / or improve at least one symptom associated with the disease or condition in the subject being treated.
[0084] As used herein, the term "subject" refers to any animal, preferably a human patient, livestock, or other domestic animal.
[0085] As used herein, the terms "treat," "treatment," and the like, when used in reference to a subject in need of therapeutic treatment, refer to obtaining a desired pharmacological and / or physiological effect, including, but not limited to, achieving an improvement or elimination of disease symptoms. The effect may be prophylactic, in terms of completely or partially preventing a disease or its symptoms, and / or therapeutic, in terms of achieving an improvement or elimination of symptoms or providing a partial or complete cure of a disease and / or adverse effects caused by the disease. The term "treatment" includes the treatment of mammalian, particularly human, disease, including (a) preventing a disease from occurring in a subject who may be predisposed to, but has not yet been diagnosed with, the disease; (b) suppressing or arresting the onset of the disease; (c) alleviating the disease or causing regression of the disease or completely or partially eliminating the symptoms of the disease; and (d) restoring an individual to a pre-morbid state, such as by reconstituting the hematopoietic system.
[0086] I. Novel reprogramming system and cells generated therefrom In general, the present disclosure provides a reprogramming process that is initiated by contacting a non-pluripotent cell with at least one reprogramming factor, optionally in the presence of a combination of a TGFβ receptor / ALK inhibitor, a MEK inhibitor, a GSK3 inhibitor, and a ROCK inhibitor (FRM, Table 1). [Table 1]
[0087] One aspect of the present invention provides a method for obtaining footprint-free iPSCs using a plasmid system that mediates transient and temporary transgene expression, comprising one or more first plasmids (V1) carrying polynucleotides encoding a replication origin and reprogramming factor(s) but not containing EBNA, and a second plasmid (V2) containing a polynucleotide encoding EBNA but not containing an origin of replication or reprogramming factor-encoding sequences.
[0088] The combination of plasmids allows for transient cytoplasmic expression of the transgenes (EBNA and exogenous reprogramming factors) within the cells upon transduction, generating a population of intermediate EBNA-free cells that exhibit transitional morphology or morphological changes (e.g., mesenchymal-to-epithelial transition (MET)) but lack pluripotent cell morphology or endogenous pluripotency gene expression, such as OCT4, yet are capable of entering a stable, self-sustaining pluripotent state. This distinct cell population is therefore referred to as "reprogrammed cells." The reprogrammed cells described herein are also distinct not only morphologically but also functionally from somatic cells prior to the introduction of reprogramming factors, and can be reprogrammed to a pluripotent state given sufficient time under culture conditions that support the reprogramming process (e.g., FMM). Thus, one aspect of the present disclosure provides EBNA-free reprogrammed cells that have a transitional morphology and are capable of undergoing the reprogramming process and establishing a stable pluripotent state. In some embodiments, the EBNA-free reprogrammed cells do not contain a transgene. Therefore, the resulting iPSC populations and iPSCs are footprint-free, eliminating the need for EBNA selection or serial passaging to eliminate EBNA and transgenes, which are necessary for episomal reprogramming. Furthermore, iPSCs generated using this transient, short-lived plasmid system possess at least one of the following characteristics: enhanced clonality and genetic stability, high homogeneity, a high rate of normal karyotypes, minimal reversion or spontaneous differentiation, and single-cell survival and selection, long-term expansion and self-renewal, and monolayer differentiation, regardless of feeder conditions.
[0089] It is generally accepted in the field that exogenously introduced reprogramming factors must be expressed for at least 10-12 days to generate iPSCs (Okita et al., Science (2008); 322:949-953; Brambrink et al., Cell Stem Cell (2008); 2(2):151-159; Stadtfeld et al., Cell Stem Cell (2008); 2(3):230-240). Adenoviral transduction of exogenous transcription factors may require repeated transfections due to the transient nature of gene expression mediated by non-integrating viral vectors. Furthermore, the reprogramming efficiency using the adenovirus method is only 0.001–0.0001% in mice (Stadtfeld et al., Science (2008); 322:945–946) and 0.0002% in human cells (Zhou et al., Stem Cells (2009); 27:2667–2674). In the case of Sendai virus vector-mediated reprogramming, multiple transductions are not necessary because this viral vector can continuously produce large amounts of exogenous protein over a long period of time, creating a specific dependency on transgene expression to maintain pluripotency. Sendai virus can reprogram neonatal and adult fibroblasts and blood cells with a high efficiency of 0.1%–1% in approximately 25 days. However, it takes approximately 10 passages for the virus to be completely lost from recently reprogrammed iPSCs, which is considered a drawback of Sendai-based reprogramming, including an increased possibility of DNA integration or an increased selection of iPSC-like clones supported by transgene expression rather than the endogenous circuitry of pluripotency genes (Fusaki et al., Proc Jpn Acad Ser B Phys Biol Sci. (2009); 85:348-362; Seki et al., Cell Stem Cell (2010); 7:11-14; Ban et al., PNAS (2011); 108:14234-14239).
[0090] Plasmids containing promoters and transgene(s) are poorly incorporated into the nucleus, are not replicable, and are rapidly lost from transfected cells. When used to generate iPS cells, plasmid vectors, including minicircle DNA vectors (minimal plasmids without bacterial DNA), reprogram cells with unacceptably low efficiency under feeder conditions. Only with repeated daily transfections can efficient reprogramming be observed, often resulting in host genome integration of the transfected transgene (Okita et al., Science (2008); 322:949-953: genomic integration was observed using standard plasmids with repeated daily transfections; 1-4 integration-free clones were obtained from 10E6 cells; Narsinh et al., Nat Protoc. (2011); 6(1):78-88: approximately 0.005% efficiency).
[0091] Compared to plasmids, episomes can either be autonomous in the cytoplasm or maintain and replicate along with the chromosomes of dividing host cells. Episomal vector-mediated cell reprogramming is primarily demonstrated with the application of Epstein-Barr virus (EBV)-based episomal vectors. In addition to the exogenous gene(s) of interest, EBV-based episomal vectors contain a polynucleotide encoding the Epstein-Barr nuclear antigen-1 (EBNA1) protein and possess an EBV-derived origin of replication (oriP). EBNA binds to cellular chromosomes, enabling nuclear localization of the vector and tethering of oriP to sister chromatids. Thus, stably expressed EBNA, in cooperation with oriP, replicates and maintains the episomal vector in the nucleus of dividing cells, providing stable, long-term expression of the exogenous gene containing EBNA in the cell. Episomal vectors typically persist for approximately 4–8 weeks, enhancing the likelihood of transgene integration (Yates et al., 1984, 1985; Reisman et al., 1985; Sugden et al., 1985). oriP / EBNA episomal vectors improve reprogramming efficiency compared to plasmid reprogramming, but it is still in the unsatisfactory range of 0.006% to 0.1% (Malik et al., Methods Mol Biol. (2013); 997:23-33).
[0092] In addition to continuously expressing EBNA in the same vector as oriP, where EBNA is replicated and transcribed, the EBNA coding sequence can also be integrated into the genome of host cells to provide stably expressed EBNA, which improves the transfection rate of vectors containing oriP and a transgene (Mazda et al., 1997, J. Immunol. Methods; 204:143-151). However, such designs ultimately fail to achieve the goal of obtaining footprint-free pluripotent cells without further cell manipulation.
[0093] In some embodiments, the reprogramming system comprises at least one first plasmid and at least one second plasmid, where the first plasmid has a construct providing oriP and one or more reprogramming factors but not EBNA, and the second plasmid has a construct providing EBNA but not oriP or the reprogramming factors. In some embodiments, the reprogramming system comprises two or more first plasmids, each providing the same or different reprogramming factors or a combination thereof. Reprogramming using this plasmid system differs from conventional plasmid reprogramming methods known in the art in that it does not require multiple transfections of cells, does not require genomic integration of the transgene, and yet provides very high reprogramming efficiency. Compared to episomal reprogramming, in which EBNA and reprogramming factor(s) are placed in the same expression cassette and oriP is present on the same vector, the plasmid system of some embodiments does not provide EBNA replication and / or continuous expression of EBNA and the transgene in the nucleus, but allows transient / cytoplasmic expression for a short period of time prior to the emergence of pluripotent cell morphology and the inducible expression of endogenous pluripotency genes, such as OCT4. Thus, the present disclosure provides footprint-free iPSCs generated from reprogrammed cells lacking EBNA expression at an early stage (e.g., around 4-6 days after transfection of a typically 21-32 day reprogramming process) that precludes positive selection or serial passaging of iPSCs to obtain footprint-free iPSCs by episomal reprogramming. In some embodiments, the short period for EBNA expression is about 4, 5, 6, 7, or 8 days after transfection, but not longer than 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, or 25 days after transfection.
[0094] The origin of replication (oriP) is the site at or near the site where DNA replication begins. It is composed of two cis-acting sequences: the FR (family of repeats), which functions as both an EBNA (Epstein-Barr nuclear antigen)-binding site and a transcriptional enhancer for the cis promoter, and the DS (dyad symmetry element), which is responsible for the initiation of DNA synthesis upon EBNA binding to the FR and is controlled by the host cell replication system. EBNA binding to the FR site affects efficient partitioning of the oriP plasmid after replication once per cell cycle, localizing the oriP plasmid to the nucleus and maintaining plasmid retention in both daughter cells during parent cell division. In one embodiment, oriP can be the origin of replication for a Papovaviridae or Herpesviridae virus. In some embodiments, oriP can be the origin of replication for a Polyomavirinae, Papillomavirinae, or Gammaherpesvirinae virus. In some other embodiments, oriP may be the origin of replication of SV40, BK virus (BKV), bovine papillomavirus (BPV), or Epstein-Barr virus (EBV). In one embodiment, oriP corresponds to or is derived from the wild-type origin of replication of EBV. In one embodiment, EBNA is a polypeptide or derivative corresponding to the wild-type protein corresponding to EBNA-1 of EBV (UniProtKB / Swiss-Prot Accession Number: P03211; SEQ ID NO: 1). A derivative of EBNA-1 is a polypeptide having a modified amino acid sequence containing a deletion, insertion, or substitution of one or more amino acids of EBNA-1 compared to the corresponding wild-type polypeptide. In one embodiment, a derivative of EBNA comprises a truncation compared to wild-type EBNA. In one embodiment, the truncated EBNA protein has the polypeptide of SEQ ID NO: 2.In other embodiments, a derivative of EBNA-1 encodes a protein having at least 80% amino acid sequence identity to residues 1 to about 90, residues 1 to about 40, residues 41 to about 90, residues 91 to about 324 (GA-rich repeat region), residues 325 to about 377, residues 378 to about 386, residues 451 to about 608, and / or residues 609 to about 641 of EBNA-1.
[0095] Any reprogramming factor known in the art for stem cell reprogramming can be used in the present reprogramming system and method. In one embodiment, reprogramming factors include, but are not limited to, OCT4, SOX2, NANOG, KLF, LIN28, c-MYC, ECAT1, UTF1, ESRRB, HESRG, CDH1, TDGF1, DPPA4, DNMT3B, ZIC3, and L1TD1. Polynucleotides encoding these reprogramming factors may be contained in the same plasmid construct containing oriP but not EBNA (i.e., the same first plasmid). Polynucleotides encoding these reprogramming factors may be contained in at least two plasmid constructs each containing oriP but not EBNA (i.e., multiple first plasmids). Polynucleotides encoding these reprogramming factors may be contained in a polycistronic construct (i.e., multiple coding sequences controlled by one promoter) or a non-polycistronic construct (multiple coding sequences, some controlled by one promoter and some controlled by different promoters). The promoter can be, for example, CMV, EF1α, PGK, CAG, UBC, or other suitable promoters that are constitutive, inducible, endogenously regulated, or temporal, tissue, or cell type specific. In one embodiment, the promoter is CAG. In another embodiment, the promoter is EF1α. In some embodiments, polycistronic constructs can provide a single open reading frame (e.g., multiple coding sequences operably linked by a self-cleaving peptide-encoding sequence such as 2A) or multiple open reading frames (e.g., multiple coding sequences linked by an internal ribosome entry site, or IRES).
[0096] In some embodiments of the plasmid system of the present application, one or more plasmid constructs (first plasmids) collectively comprise polynucleotides encoding one or more reprogramming factors selected from the group consisting of OCT4, SOX2, NANOG, KLF, LIN28, c-MYC, ECAT1, UTF1, ESRRB, HESRG, CDH1, TDGF1, DPPA4, DNMT3B, ZIC3, and L1TD1. In some embodiments, only one first plasmid construct is present in the system and provides all of the selected reprogramming factors. In some other embodiments, there are two or more first plasmid constructs providing one or more reprogramming factors, each construct comprising the same or different reprogramming factors encoded by at least one copy of a polynucleotide. In one embodiment, one or more first plasmid constructs in the system comprise at least a polynucleotide encoding OCT4. In one embodiment, one or more first plasmid constructs collectively comprise at least two polynucleotides encoding OCT4. In another embodiment, one or more first plasmid constructs collectively comprise polynucleotides encoding OCT4 and SOX2. In one embodiment, the one or more first plasmid constructs collectively comprise at least one polynucleotide encoding OCT4 but not c-MYC. In some embodiments, the one or more first plasmid constructs collectively comprise at least two polynucleotides encoding OCT4 and one or more polynucleotides encoding at least one of ECAT1, UTF1, ESRRB, HESRG, CDH1, TDGF1, DPPA4, DNMT3B, ZIC3, and L1TD1.
[0097] When the first plasmid construct contains two or more polynucleotides encoding reprogramming factors, the adjacent polynucleotides are operably linked by a linker sequence encoding a self-cleaving peptide or an IRES. The self-cleaving peptide may be a 2A peptide. The 2A peptide may be derived from FMDV (foot-and-mouth disease virus), ERAV (equine rhinitis A virus), PTV-1 (porcine teschovirus-1), or TaV (thosea asigna virus), which are referred to as F2A, E2A, P2A, and T2A, respectively. The multiple 2A peptides in the first plasmid construct may be the same or different. In some embodiments, the two most adjacent 2A peptides are different, for example, RF-2A1-RF-2A2-RF-2A1, where 2A1 and 2A2 are different.
[0098] A library of first plasmid constructs can be pre-constructed, each containing one or more polynucleotides encoding various numbers, types, and / or combinations of reprogramming factors. Reprogramming is known to be a long-latency, inefficient, and stochastic process. The timing and level of expression and stoichiometry of reprogramming factors drive reprogramming kinetics at various stages of reprogramming, and the intermediate states of cells undergoing reprogramming determine the completion of reprogramming. The stoichiometry of reprogramming factors also influences reprogramming efficiency, generating iPSCs of various qualities, such as primed versus ground-state pluripotency, and related biological properties, such as iPSC clonality, self-renewal, homogeneity, and maintenance of pluripotency (as opposed to spontaneous differentiation). Stoichiometry measures the quantitative relationship between reagents in a reaction process and is used to determine the amount of reagent required for a particular reaction and, sometimes, the amount of product produced. Stoichiometry considers both stoichiometric amounts of reagents or stoichiometric ratios of reagents, which is the optimal amount or ratio of reagent(s) to complete a reaction. One aspect of the present application provides systems and methods for evaluating or utilizing the stoichiometry of reprogramming factors by conveniently selecting, mix-and-matching, titrating, and co-transfecting one or more first plasmids from a library.
[0099] The second plasmid of the reprogramming system provides an expression cassette containing a promoter and a polynucleotide encoding EBNA, and neither the expression cassette nor the second plasmid contains a polynucleotide encoding a reprogramming factor. The promoter contained in the second plasmid can be, for example, CMV, EF1α, PGK, CAG, UBC, or other suitable promoters that are constitutive, inducible, endogenously regulated, or time-, tissue-, or cell-type-specific. In one embodiment, the promoter is CAG. In another embodiment, the promoter is EF1α. By co-transfecting non-pluripotent cells with a combination of at least one of the first and second plasmids described above, standalone EBNA and oriP are introduced into the non-pluripotent cells along with at least one reprogramming factor, initiating reprogramming.
[0100] In some embodiments, reprogramming is initiated in the presence of a combination of small molecule compounds, including a TGFβ receptor / ALK inhibitor, a MEK inhibitor, a GSK3 inhibitor, and a ROCK inhibitor, and iPSCs are generated after a sufficient period of time. In some embodiments, reprogramming is performed under feeder-free conditions. In particular embodiments, the feeder-free environment is essentially free of human feeder cells and is not pre-conditioned by feeder cells, including, but not limited to, mouse embryonic fibroblasts, human fibroblasts, keratinocytes, and embryonic stem cells.
[0101] In some embodiments, after about 7-35, 10-32, 15-31, about 17-29, about 19-27, or about 21-25 days of induction, the cells are optionally dissociated by either enzymatic or mechanical means to dissociate the cells into a single-cell suspension. The dissociated cells can be resuspended in any suitable solution or medium for maintaining the cells or for performing cell sorting. In some embodiments, the suspension of single dissociated cells includes a ROCK inhibitor. In some other embodiments, the suspension of single dissociated cells includes a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor. In particular embodiments, the suspension of single cells contains a GSK3 inhibitor, a MEK inhibitor, and a ROCK inhibitor, but lacks a TFGβ inhibitor. In certain embodiments, the GSK3 inhibitor is CHIR99021, the MEK inhibitor is PD0325901, and / or the ROCK inhibitor is thiazovivin.
[0102] In some embodiments, the suspension of single dissociated cells can be further sorted. In one embodiment, enrichment provides a method for inducing clonal iPSC colonies in a relatively short time, thereby improving the efficiency of iPSC generation. Enrichment can involve sorting a population of cells by identifying and obtaining cells that express markers of pluripotency, thereby obtaining an enriched population of pluripotent cells. Additional enrichment methodologies include differentiation, depletion of cells that express markers of non-reprogrammed or non-pluripotent cells. In some embodiments, the cells for sorting are pluripotent cells. In some embodiments, the cells for sorting are reprogrammed cells. In some embodiments, the cells for sorting have been induced to reprogram for at least 1, 2, 3, 4, 5, 6, 7, 8 days or more, but not more than 25, 26, 28, 30, 32, 35, 40 days, or any number of days in between. In some embodiments, the cells for selection are induced to reprogram for about 21 to 25 days, about 19 to 23 days, about 17 to 21 days, about 15 to about 19, or about 16 to about 18 days.
[0103] Cells can be sorted using any suitable method for sorting cells, such as magnetic bead or flow cytometry (FACS) sorting. Cells can be sorted based on expression of one or more pluripotency markers, including, but not limited to, expression of SSEA3 / 4, TRA1-60 / 81, TRA1-85, TRA2-54, GCTM-2, TG343, TG30, CD9, CD29, CD133 / prominin, CD140a, CD56, CD73, CD105, OCT4, NANOG, SOX2, KLF4, SSEA1 (mouse), CD30, SSEA5, CD90, and / or CD50. In various embodiments, cells are sorted based on expression of at least two, at least three, or at least four of the pluripotency markers. In certain embodiments, cells are sorted based on expression of SSEA4, and in certain specific embodiments, based on expression of SSEA4 in combination with TRA1-81 and / or TRA1-60. In certain embodiments, cells are sorted based on SSEA4, TRA1-81, or TRA1-60, and / or CD30 expression. In one embodiment, cells are sorted based on SSEA4, TRA1-81, and CD30. In another embodiment, cells are sorted based on SSEA4, TRA1-60, and CD30. In certain embodiments, cells are first depleted of non-reprogrammed cells using one or more surface markers of differentiated cells, including, but not limited to, CD13, CD26, CD34, CD45, CD31, CD46, and CD7, and then enriched for pluripotency markers such as SSEA4, TRA1-81, and / or CD30.
[0104] After reprogramming, iPSCs are maintained, passaged, and expanded. In some embodiments, iPSCs are cultured as single cells for extended periods of time in a maintenance medium, e.g., FMM as shown in Table 1. iPSCs cultured in FMM have been shown to maintain an undifferentiated, basal, or naive profile, genomic stability without the need for culture washing or selection, and readily give rise to all three somatic cell lineages, in vitro differentiation via embryoid bodies or monolayers (without embryoid body formation), and in vivo differentiation via teratoma formation. See, e.g., U.S. Patent Application No. 61 / 947,979 and U.S. Patent Application Publication No. 20170073643, the disclosures of which are incorporated herein by reference. Cells suitable for reprogramming using the present reprogramming systems and methods generally include any non-pluripotent cells. Non-pluripotent cells include, but are not limited to, terminally differentiated cells, or multipotent or progenitor cells, which cannot give rise to all three germ layer lineage cells. In some embodiments, the non-pluripotent cells for reprogramming are primary cells, i.e., cells isolated directly from human or animal tissue. In some embodiments, the non-pluripotent cells for reprogramming are source-specific cells, e.g., donor-, disease-, or treatment response-specific. In some embodiments, the non-pluripotent cells for reprogramming are primary immune cells. In some embodiments, the non-pluripotent cells for reprogramming are themselves derived from pluripotent cells, including embryonic stem cells and induced pluripotent stem cells. In some embodiments, the non-pluripotent cells for reprogramming are derived immune cells, e.g., non-natural T- or NK-like cells derived from iPSCs.
[0105] In some other embodiments, the non-pluripotent cells for reprogramming are genomically modified primary cells or induced-derived cells. Genetic modifications included in non-pluripotent cells include insertions, deletions, or substitutions in the genome that result in knock-in, knock-out, or knock-down of gene expression. The modified expression in non-pluripotent cells for reprogramming can be constitutive or inducible (e.g., developmental stage-, tissue-, cell-, or inducer-specific). In some embodiments, the insertion or substitution is a locus-specific targeted integration. In some embodiments, the locus selected for integration is a safe harbor locus or an endogenous locus of interest. Safe harbor loci include AAVS1, CCR5, ROSA26, collagen, HTRP, H11, beta2 microglobulin, GAPDH, TCR, or RUNX1, and other loci that meet the genomic safe harbor criteria. For an integration site to be a potential safe harbor locus, it ideally should meet several criteria, including but not limited to: absence of disruption of regulatory elements or genes as determined by sequence annotation; location within an intergenic region within a gene-dense region or a convergent location between two genes transcribed in opposite directions; distance between vector-encoded transcriptional activators and the promoters of adjacent genes, particularly between cancer-related genes and microRNA genes, to minimize the possibility of long-range interactions; and apparent ubiquitous transcriptional activity, as reflected by widespread spatial and temporal expressed sequence tag (EST) expression patterns indicative of ubiquitous transcriptional activity. This latter feature is particularly important for pluripotent cells, where chromatin remodeling during differentiation typically leads to the silencing of some gene loci and the potential activation of others. Within a region suitable for exogenous insertion, the precise locus selected for insertion should be free of repetitive elements and conserved sequences, allowing for easy design of primers for amplification of homology arms.In one example, a non-pluripotent cell for reprogramming using the present systems and methods is a T cell that contains a CAR at the endogenous TCR locus, where TCR expression is disrupted as a result of CAR integration.
[0106] In one embodiment, reprogramming of genetically modified non-pluripotent cells is to obtain genome-manipulated iPSCs containing the same genetic modification(s).Therefore, in some other embodiments, one or more such genome edits can be introduced into iPSCs after reprogramming to obtain genome-manipulated iPSCs.In one embodiment, the iPSCs for genome editing are a clonal line or population of clonal iPSCs.
[0107] In some embodiments, genomically engineered iPSCs containing one or more targeted gene edits are maintained, passaged, and expanded in media containing MEKi, GSKi, and ROCKi, and free of or essentially free of TGFβ receptor / ALK5 inhibitors, such that the iPSCs retain intact and functional targeted edits at selected sites. In some embodiments, the gene edits introduce one or more of the following: safety switch proteins, targeting modalities, receptors, signaling molecules, transcription factors, pharmaceutically active proteins or peptides, drug target candidates, and proteins that promote engraftment, trafficking, homing, tumor invasion, viability, self-renewal, persistence, and / or survival of pluripotent cells and / or their derived cells. In one embodiment, the genomically engineered iPSCs contain one or more suicide gene-mediated safety switches, including, but not limited to, caspase 9 (or caspase 3 or 7), thymidine kinase, cytosine deaminase, B cell CD20, modified EGFR, and any combination thereof. In some embodiments, the genomically engineered iPSCs have at least one genomic modification comprising the introduction or increased expression of a chimeric receptor, a homing receptor, an anti-inflammatory molecule, an immune checkpoint protein, a cytokine / chemokine decoy receptor, a growth factor, an altered pro-inflammatory cytokine receptor, a CAR, or a surface triggering receptor for binding to a bi- or multispecific or universal engager, or the decreased or suppressed expression of a costimulatory gene. In some embodiments, the genomically engineered iPSCs comprise high-affinity and / or non-cleavable CD16 as a targeting modality. In some other embodiments, the targeting modality comprised in the genomically engineered iPSCs is a chimeric antigen receptor (CAR) that is T cell-specific, NK cell-specific, or compatible with both T and NK cells.
[0108] In some embodiments, the genomically engineered iPSCs comprise one or more exogenous polynucleotides or indels (in / dels) in one or more endogenous genes. In some embodiments, the indels in the endogenous genes result in disruption of gene expression. In some embodiments, the indels in the endogenous genes result in knockout of the edited gene. In some embodiments, the indels in the endogenous genes result in knockdown of the edited gene. In some embodiments, the genomically engineered iPSCs comprising one or more exogenous polynucleotides at selected site(s) may further comprise one or more targeted edits comprising indels at selected site(s). In some embodiments, the indels are in one or more endogenous genes associated with immune response regulation and mediation. In some embodiments, the indels are in one or more endogenous checkpoint genes. In some embodiments, the indels are in one or more endogenous T cell receptor genes. In some embodiments, the indels are in one or more endogenous MHC class I suppressor genes. In some embodiments, the indels are in one or more endogenous genes associated with the major histocompatibility complex. In one embodiment, the modified iPS cells comprise deleted or reduced expression of at least one of B2M, TAP1, TAP2, tapasin, NLRC5, RFXANK, CIITA, RFX5, RFXAP, and any HLA gene in the chromosome 6p21 region. In another embodiment, the modified iPS cells comprise introduced or increased expression of HLA-E or HLA-G. In yet some other embodiments, the genomically engineered iPS cells comprise a disrupted TCR locus.
[0109] Various methods for targeted gene editing of iPSCs, particularly methods for effectively manipulating iPSCs at the single cell level using multiple genes in a multi-locus targeting strategy, include, for example, the methods described in International Application Publication WO2017 / 079673, the disclosure of which is incorporated herein by reference.
[0110] The present invention also provides methods for identifying agents that reprogram somatic cells to a less differentiated state, and the agents so identified. In one embodiment, the method involves reprogramming somatic cells using the reprogramming compositions and methods disclosed herein, wherein at least one vector contains a candidate agent, and selecting cells with the appearance of pluripotent cell morphology and the inducible expression of at least one endogenous pluripotency gene, such as OCT4. The presence of cells expressing the appropriate selection marker indicates that the agent reprograms the somatic cell. Such agents are considered reprogramming agents for the purposes of this application. In a further embodiment, the method involves contacting somatic cells with a candidate agent using the reprogramming compositions and methods disclosed herein, selecting cells that express the appropriate selection marker, and evaluating the so selected cells for pluripotency characteristics. The presence of a complete set of pluripotency characteristics indicates that the agent reprograms the somatic cell to become pluripotent. Candidate agents used in the present invention encompass many chemical classes, but typically they are organic molecules, including small organic compounds. Candidate agents are also found among biomolecules, including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, nucleic acids and derivatives, structural analogs, or combinations thereof. Candidate agents may be naturally occurring, recombinant, or laboratory-designed. Candidate agents may be isolated from microorganisms, animals, or plants, or produced recombinantly, or synthesized by chemical methods known in the art. In some embodiments, candidate agents are isolated from libraries of synthetic or natural compounds using the methods of the present invention. Numerous means are available for the random and directed synthesis of a wide variety of organic compounds and biomolecules, including, for example, expression of randomized oligonucleotides and oligopeptides. Alternatively, libraries of natural compounds in the form of bacterial, fungal, plant, and animal extracts are available or readily produced. Furthermore, natural or synthetically produced libraries and compounds can be readily modified by conventional chemical, physical, and biochemical means and used to generate combinatorial libraries.Known pharmacological agents may be subjected to directed or random chemical modifications, including acylation, alkylation, esterification, amidification to produce structural analogs. See, e.g., ChemBridge DIVERSet. TM There are many commercially available compound libraries, such as:
[0111] The above screening methods are based on assays carried out in cells. These cell-based assays can be carried out in high-throughput screening (HTS) formats described in the art. For example, Stockwell et al. described high-throughput screening of small molecules in a miniaturized mammalian cell-based assay that includes post-translational modifications (Stockwell et al., 1999). Similarly, Qian et al. described a leukemia cell-based assay for high-throughput screening of anti-cancer drugs (Qian et al., 2001). Both references are incorporated herein in their entirety.
[0112] II. iPSC-derived cells obtained in vitro In some embodiments, the present invention further provides non-pluripotent cells derived from iPSCs obtained using the systems and methods disclosed herein. In some embodiments, the iPSCs used to generate the derived non-pluripotent cells are genomically engineered through targeted editing of the iPSCs or through reprogramming of genomically engineered non-pluripotent cells with site-specific integration or indels. In some embodiments, the iPSC-derived non-pluripotent cells are progenitor cells or fully differentiated cells. In some embodiments, the iPSC-derived cells that retain the same targeted editing contained in the genomically engineered iPSCs are non-native mesodermal cells, CD34 cells, hemogenic endothelial cells, hematopoietic stem or progenitor cells, hematopoietic multipotent progenitor cells, T cell progenitors, NK cell progenitors, T cells, NKT cells, NK cells, B cells, immunoregulatory cells, or any cell of any germ layer lineage. In some embodiments, iPSC-derived non-natural immunoregulatory cells include myeloid-derived suppressor cells (MDSCs), regulatory macrophages, regulatory dendritic cells, or mesenchymal stromal cells, which are potent immunomodulators of NK, B, and T cells.
[0113] In addition to generating unlimited numbers of cells of specific types or subtypes that are difficult to obtain by isolation from donor sources, human iPSC-derived lineages exhibit fetal cell characteristics, suggesting that the reprogramming process not only resets cell fate (from specification / differentiation to pluripotency) but also the chronological age characteristics of the donor cell population, regardless of the age of the initial somatic cell donor. Beyond the fetal-like characteristics observed in iPSC-derived lineages containing neural, cardiac, or pancreatic cells, hallmarks of senescent cells show measurable changes indicating rejuvenation of iPSC-derived cells after the reprogramming process. Age-related parameters expressed in aged donor fibroblast populations were reset after iPSC induction and differentiation into iPSC-derived fibroblast-like cells (Miller et al., 2013). iPSC-derived antigen-specific T cells differentiated from iPSCs reprogrammed from T cell clones exhibit rejuvenation with longer telomeres than the original T cell clones. Additional changes in fully differentiated cells indicative of the rejuvenation process include, but are not limited to, an overall increase in heterochromatin, improved mitochondrial function (reduced ROS, fewer mtDNA mutations, and the presence of ultrastructure), increased DNA damage response, telomere elongation and a decrease in the proportion of short telomeres, and a decrease in the proportion of senescent cells (Nishimura et al., 2013). Positive resetting in these various age-related aspects results in non-native cells with greater potential for proliferation, survival, persistence, and memory-like functions. Thus, rejuvenation through reprogramming and redifferentiation confers many molecular, phenotypic, and functional characteristics to fully differentiated iPSC-derived cells, distinguishing them from their primary cell counterparts despite their similarity in cell lineage.
[0114] Applicable differentiation methods and compositions for obtaining iPSC-derived hematopoietic cell lineages include, for example, those set forth in International Application No. PCT / US2016 / 044122, the disclosure of which is incorporated herein by reference. As provided, methods and compositions for generating hematopoietic cell lineages are derived from pluripotent stem cells, including iPSCs, under serum-free, feeder-free, and / or stroma-free conditions and in a scalable monolayer culture platform without the need for EB formation. Cells that can be differentiated according to the provided methods range from pluripotent stem cells to progenitor cells committed to specific terminally differentiated and transdifferentiated cells, to cells of various lineages that transition directly to a hematopoietic fate without passing through a pluripotent intermediate. Similarly, cells generated by stem cell differentiation range from multipotent stem cells or progenitor cells to terminally differentiated stem cells and all intervening hematopoietic cell lineages.
[0115] A method for differentiating and expanding hematopoietic lineage cells from pluripotent stem cells in monolayer culture includes contacting the pluripotent stem cells with a BMP pathway activator and, optionally, bFGF. As provided, mesodermal cells derived from pluripotent stem cells are obtained and expanded without forming embryoid bodies from the pluripotent stem cells. Then, without forming embryoid bodies from the pluripotent stem cells, the mesodermal cells are contacted with a BMP pathway activator, bFGF, and a WNT pathway activator to obtain expanded mesodermal cells with definitive hemogenic endothelial (HE) potential. Subsequent contact with bFGF, and optionally a ROCK inhibitor and / or a WNT pathway activator, differentiates the mesodermal cells with definitive HE potential into definitive HE cells, which also expand during differentiation.
[0116] The methods for obtaining cells of the hematopoietic lineage provided herein are superior to EB-mediated pluripotent stem cell differentiation because EB formation results in moderate to minimal cell expansion, does not allow for monolayer culture, which is important for many applications requiring homogenous expansion and homogenous differentiation of cells within a population, and is laborious and low-efficiency.
[0117] The provided monolayer differentiation platform promotes the differentiation of hematopoietic stem cells into definitive hemogenic endothelium, leading to the induction of differentiated progeny such as T, B, NKT, NK cells, and regulatory cells. The monolayer differentiation strategy, combined with improved differentiation efficiency and large-scale expansion, enables the delivery of therapeutically relevant numbers of pluripotent stem cell-derived hematopoietic cells for a variety of therapeutic applications. Furthermore, monolayer culture using the methods provided herein results in functional hematopoietic lineage cells capable of a full range of in vitro differentiation, ex vivo regulation, and in vivo long-term hematopoietic self-renewal, reconstitution, and engraftment. As provided, iPSC-derived hematopoietic lineage cells include, but are not limited to, definitive hemogenic endothelium, hematopoietic multipotent progenitor cells, hematopoietic stem cells and progenitors, T cell progenitors, NK cell progenitors, T cells, NK cells, NKT cells, B cells, macrophages, neutrophils, myeloid-derived suppressor cells (MDSCs), regulatory macrophages, regulatory dendritic cells, and mesenchymal stromal cells.
[0118] A method for directing the differentiation of pluripotent stem cells into definitive hematopoietic lineage cells, the method comprising: (i) contacting the pluripotent stem cells with a composition comprising a BMP activator, and optionally bFGF, to initiate the differentiation and expansion of mesodermal cells from the pluripotent stem cells; (ii) contacting the mesodermal cells with a composition comprising a BMP activator, bFGF, and a GSK3 inhibitor, optionally without a TGFβ receptor / ALK inhibitor, to initiate the differentiation and expansion of mesodermal cells with definitive HE potential; and (iii) contacting the mesodermal cells with definitive HE potential with a composition comprising a ROCK inhibitor, one or more growth factors and cytokines selected from the group consisting of bFGF, VEGF, SCF, IGF, EPO, IL6, and IL11, and optionally a Wnt pathway activator, optionally without a TGFβ receptor / ALK inhibitor, to initiate the differentiation and expansion of definitive hemogenic endothelium from pluripotent stem cell-derived mesodermal cells with definitive hemogenic endothelial potential.
[0119] In some embodiments, the method further comprises contacting the pluripotent stem cells with a composition comprising a MEK inhibitor, a GSK3 inhibitor, and a ROCK inhibitor, the composition not comprising a TGFβ receptor / ALK inhibitor, to seed and expand the pluripotent stem cells. In some embodiments, the pluripotent stem cells are iPSCs, or naive iPSCs, or iPSCs comprising one or more genetic imprints, wherein the one or more genetic imprints comprised in the iPSCs are retained in hematopoietic cells differentiated therefrom. In some embodiments of the method for directing differentiation of pluripotent stem cells into cells of the hematopoietic lineage, the differentiation of the pluripotent stem cells into cells of the hematopoietic lineage is in the form of a monolayer culture without the generation of embryoid bodies.
[0120] In some embodiments of the above methods, the resulting pluripotent stem cell-derived definitive hemogenic endothelial cells are CD34+. In some embodiments, the resulting definitive hemogenic endothelial cells are CD34+CD43-. In some embodiments, the resulting definitive hemogenic endothelial cells are CD34+CD43-CXCR4-CD73-. In some embodiments, the definitive hemogenic endothelial cells are CD34+CXCR4-CD73-. In some embodiments, the definitive hemogenic endothelial cells are CD34+CD43-CD93-. In some embodiments, the definitive hemogenic endothelial cells are CD34+CD93-. In some embodiments, the definitive hemogenic endothelial cells are CD34+CD93-CD73-.
[0121] In some embodiments of the above method, the method further includes (i) contacting the pluripotent stem cell-derived definitive hemogenic endothelium with a composition comprising a ROCK inhibitor, one or more growth factors and cytokines selected from the group consisting of VEGF, bFGF, SCF, Flt3L, TPO, and IL7, and optionally a BMP activator, to initiate differentiation of the definitive hemogenic endothelium into a pre-T cell precursor, and optionally (ii) contacting the pre-T cell precursor with a composition comprising one or more growth factors and cytokines selected from the group consisting of SCF, Flt3L, and IL7, but excluding one or more of VEGF, bFGF, TPO, a BMP activator, and a ROCK inhibitor, to initiate differentiation of the pre-T cell precursor into a T cell precursor or T cell. In some embodiments of the method, the pluripotent stem cell-derived T cell precursor is CD34+CD45+CD7+. In some embodiments of the method, the pluripotent stem cell-derived T cell precursor is CD45+CD7+. In some embodiments, pluripotent stem cell-derived T cells comprise a much higher proportion of γδ T cells than primary T cells isolated from a donor source.
[0122] In some further embodiments of the above-described methods for directing differentiation of pluripotent stem cells into cells of a hematopoietic lineage, the method further comprises: (i) contacting the pluripotent stem cell-derived definitive hemogenic endothelium with a composition comprising a ROCK inhibitor, one or more growth factors and cytokines selected from the group consisting of VEGF, bFGF, SCF, Flt3L, TPO, IL3, IL7, and IL15, and optionally a BMP activator, to initiate differentiation of the definitive hemogenic endothelium into pre-NK cell precursors; and, optionally, (ii) contacting the pluripotent stem cell-derived pre-NK cell precursors with a composition comprising one or more growth factors and cytokines selected from the group consisting of SCF, Flt3L, IL3, IL7, IL15, wherein the medium does not comprise one or more of VEGF, bFGF, TPO, a BMP activator, and a ROCK inhibitor, to initiate differentiation of the pre-NK cell precursors into NK cell precursors or NK cells. In some embodiments, the pluripotent stem cell-derived NK progenitor cells are CD3-CD45+CD56+CD7+. In some embodiments, the pluripotent stem cell-derived NK cells are CD3-CD45+CD56+. In some embodiments, the pluripotent stem cell-derived NK cells are optionally further defined by one or more of NKp46 (CD335), NKp30 (CD337), DNAM-1 (CD226), 2B4 (CD244), CD57, and CD16.
[0123] In another embodiment of the method, the method allows for the production of immunoregulatory cells by contacting final HE derived from pluripotent stem cells with a medium comprising a ROCK inhibitor, MCSF, GMCSF, one or more growth factors and cytokines selected from the group consisting of IL1b, IL3, IL6, IL4, IL10, IL13, TGFβ, bFGF, VEGF, SCF, and FLT3L, and optionally one or both of an AhR antagonist and a prostaglandin pathway agonist.
[0124] In some embodiments, the derived immunoregulatory cells comprise myeloid-derived suppressor cells (MDSCs). In one embodiment, the population of derived immunoregulatory cells comprises CD45+CD33+ cells. In some embodiments, the population of derived immunoregulatory cells comprises monocytes. In some embodiments, the monocytes comprise CD45+CD33+CD14+ cells. In yet some other embodiments, the population of derived immunoregulatory cells comprises CD45+CD33+PDL1+ cells. One aspect of the invention provides enriched cell populations or subpopulations of iPSC-derived immunoregulatory cells comprising CD45+CD33+, CD45+CD33+CD14+, or CD45+CD33+PDL1+ cells. In some other embodiments, the population of derived immunoregulatory cells comprises CD33+CD15+CD14-CD11b- cells. In some embodiments, the population of derived immunoregulatory cells comprising iMDSCs contains less than 50%, 40%, 30%, 20%, 10%, 5%, 2%, 1%, 0.1% of erythrocytes, lymphocytes, granulocytes, CD45-CD235+ cells, CD45+CD7+ cells, or CD45+CD33+CD66b+ cells. In some embodiments, the population of derived immunoregulatory cells is essentially free of erythrocytes, lymphocytes, granulocytes, CD45-CD235+ cells, CD45+CD7+ cells, or CD45+CD33+CD66b+ cells.
[0125] III. Therapeutic Uses of iPSCs and Immune Cells Derived Therefrom In some embodiments, the present invention provides compositions comprising iPSCs and / or isolated populations or subpopulations of immune cells derived from said iPSCs using the disclosed methods and compositions. In some embodiments, the iPSCs comprise one or more targeted gene edits that can be retained in the iPSC-derived immune cells, and the engineered iPSCs and their derived cells are suitable for cell-based adoptive therapy. In one embodiment, the isolated population or subpopulation of engineered immune cells comprises iPSC-derived HSC cells. In one embodiment, the isolated population or subpopulation of engineered immune cells comprises iPSC-derived HSC cells. In one embodiment, the isolated population or subpopulation of engineered immune cells comprises iPSC-derived proT or T cells. In one embodiment, the isolated population or subpopulation of engineered immune cells comprises iPSC-derived proNK or NK cells. In one embodiment, the isolated population or subpopulation of engineered immune cells comprises iPSC-derived immunoregulatory cells or myeloid-derived suppressor cells (MDSCs). In some embodiments, the iPSC-derived engineered immune cells are further conditioned ex vivo for improved therapeutic potential. In one embodiment, the isolated population or subpopulation of iPSC-derived engineered immune cells comprises an increased number or proportion of naive T cells, stem cell memory T cells, and / or central memory T cells. In one embodiment, the isolated population or subpopulation of iPSC-derived engineered immune cells comprises an increased number or proportion of type I NKT cells. In another embodiment, the isolated population or subpopulation of iPSC-derived engineered immune cells comprises an increased number or proportion of adaptive NK cells. In some embodiments, the isolated population or subpopulation of iPSC-derived engineered CD34 cells, HSC cells, T cells, NK cells, or myeloid-derived suppressor cells is allogeneic. In some other embodiments, the isolated population or subpopulation of iPSC-derived engineered CD34 cells, HSC cells, T cells, NK cells, or MDSC is autologous.
[0126] In some embodiments, iPSCs for differentiation contain genetic imprints that convey desirable therapeutic attributes to effector cells, which genetic imprints are retained and functional in differentiated hematopoietic cells derived from said iPSCs.
[0127] In some embodiments, the genetic imprinting of the pluripotent stem cells comprises (i) one or more genetic modification modalities obtained by genomic insertion, deletion, or substitution into the genome of the pluripotent cells during or after reprogramming of non-pluripotent cells to iPSCs, or (ii) one or more retainable therapeutic attributes of source-specific immune cells that are donor, disease, or treatment response specific, where the pluripotent cells are reprogrammed from source-specific immune cells and the iPSCs retain the therapeutic attributes of the source, including those in iPSC-derived hematopoietic lineage cells.
[0128] In some embodiments, the genetic modification modality comprises one or more of safety switch proteins, targeting modalities, receptors, signaling molecules, transcription factors, pharmaceutically active proteins and peptides, drug target candidates, or proteins that promote engraftment, trafficking, homing, viability, self-renewal, persistence, immune response control and modulation, and / or survival of iPSCs or derived cells. In some other embodiments, the genetic modification modality includes one or more of: (i) deletion or reduced expression of B2M, TAP1, TAP2, tapasin, NLRC5, PD1, LAG3, TIM3, RFXANK, CIITA, RFX5, or RFXAP, and any genes in the chromosome 6p21 region; (ii) introduction or increased expression of HLA-E, HLA-G, HACD16, 41BBL, CD3, CD4, CD8, CD47, CD113, CD131, CD137, CD80, PDL1, A2AR, CAR, TCR, Fc receptor, or surface triggering receptor for binding to a bi- or multispecific or universal engager.
[0129] In yet some other embodiments, the hematopoietic lineage cells comprise therapeutic attributes of source-specific immune cells related to one or more of: (i) antigen targeting receptor expression; (ii) HLA presentation or lack thereof; (iii) tolerance to the tumor microenvironment; (iv) induction of bystander immune cells and immunomodulation; (iv) improved on-target specificity with reduced off-tumor effects; (v) resistance to treatments such as chemotherapy; and (vi) improved homing, persistence, and cytotoxicity.
[0130] In some embodiments, iPSCs and their derived hematopoietic cells comprise one or more of the following: B2M null or low, HLA-E / G, PDL1, A2AR, CD47, LAG3 null or low, TIM3 null or low, TAP1 null or low, TAP2 null or low, tapasin null or low, NLRC5 null or low, PD1 null or low, RFKANK null or low, CIITA null or low, RFX5 null or low, and RFXAP null or low. These cells with modified HLA class I and / or II have increased resistance to immune detection, resulting in improved in vivo persistence. Furthermore, such cells can avoid the need for HLA matching in adoptive cell therapy, thus providing a source of universal, commercially available therapeutic regimens.
[0131] In some embodiments, iPSCs and derived hematopoietic cells are identified as comprising hnCD16 (high affinity non-cleavable CD16), HLA-E, HLA-G, 41BBL, CD3, CD4, CD8, CD47, CD113, CD131, CD137, CD80, PDL1, A 2A R, CAR, or TCR. Such cells have improved immune effector capabilities.
[0132] In some embodiments, the iPSCs and their derived hematopoietic cells are antigen-specific.
[0133] The introduction of the immune cells of the present invention into subjects suitable for adoptive cell therapy can ameliorate a variety of diseases, including, but not limited to, various autoimmune disorders, including alopecia areata, autoimmune hemolytic anemia, autoimmune hepatitis, dermatomyositis, diabetes mellitus (type 1), some forms of juvenile idiopathic arthritis, glomerulonephritis, Graves' disease, Guillain-Barré syndrome, idiopathic thrombocytopenic purpura, myasthenia gravis, some forms of myocarditis, multiple sclerosis, pemphigus / pemphigoid, pernicious anemia, polyarteritis nodosa, polymyositis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, scleroderma / systemic sclerosis, Sjogren's syndrome, systemic lupus erythematosus, some forms of thyroiditis, some forms of uveitis, vitiligo, and granulomatosis with polyangiitis (Wegener's disease). hematological malignancies, including but not limited to acute and chronic leukemia, lymphoma, multiple myeloma and myelodysplastic syndromes; solid tumors, including but not limited to tumors of the brain, prostate, breast, lung, colon, uterus, skin, liver, bone, pancreas, ovary, testicle, bladder, kidney, head, neck, stomach, cervix, rectum, larynx, or esophagus; and infectious diseases, including but not limited to HIV (human immunodeficiency virus), RSV (respiratory syncytial virus), EBV (Epstein-Barr virus), CMV (cytomegalovirus), adenovirus, and BK polyomavirus related disorders.
[0134] According to some embodiments, the present invention further provides compositions for therapeutic use comprising hematopoietic cells derived from pluripotent cells produced by the methods and compositions disclosed herein, wherein the pharmaceutical composition further comprises a pharmaceutically acceptable medium. In one embodiment, the composition for therapeutic use comprises T cells derived from pluripotent cells produced by the methods and compositions disclosed herein. In one embodiment, the composition for therapeutic use comprises NK cells derived from pluripotent cells produced by the methods and compositions disclosed herein. In one embodiment, the composition for therapeutic use comprises CD34+ HE cells derived from pluripotent cells produced by the methods and compositions disclosed herein. In one embodiment, the composition for therapeutic use comprises HSCs derived from pluripotent cells produced by the methods and compositions disclosed herein. In one embodiment, the composition for therapeutic use comprises MDSCs derived from pluripotent cells produced by the methods and compositions disclosed herein.
[0135] Furthermore, the present invention provides, in some embodiments, therapeutic uses of the above-described therapeutic compositions by introducing the composition into a subject suitable for adoptive cell therapy, the subject having an autoimmune disorder, a hematological malignancy, a solid tumor, or an infection associated with HIV, RSV, EBV, CMV, adenovirus, or BK polyomavirus.
[0136] Isolated pluripotent stem cell-derived hematopoietic lineage cells can have at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% T cells, NK cells, NKT cells, proT cells, proNK cells, CD34+ HE cells, HSCs, B cells, myeloid-derived suppressor cells (MDSCs), regulatory macrophages, regulatory dendritic cells, or mesenchymal stromal cells. In some embodiments, isolated pluripotent stem cell-derived hematopoietic lineage cells have about 95% to about 100% T cells, NK cells, NKT cells, proT cells, proNK cells, CD34+ HE cells, HSCs, B cells, myeloid-derived suppressor cells (MDSCs), regulatory macrophages, regulatory dendritic cells, or mesenchymal stromal cells. In some embodiments, the present invention provides therapeutic compositions comprising purified T cells, NK cells, NKT cells, CD34+ HE cells, proT cells, proNK cells, HSCs, B cells, myeloid-derived suppressor cells (MDSCs), regulatory macrophages, regulatory dendritic cells, or mesenchymal stromal cells, e.g., compositions comprising about 95% isolated population of T cells, NK cells, NKT cells, proT cells, proNK cells, CD34+ HE cells, HSCs, B cells, myeloid-derived suppressor cells (MDSCs), regulatory macrophages, regulatory dendritic cells, or mesenchymal stromal cells, for treating a subject in need of cell therapy.
[0137] Treatment using the derived hematopoietic lineage cells of the embodiments disclosed herein may be performed when symptoms arise or to prevent recurrence. The terms "treat," "treatment," and the like are used herein generally to mean achieving a desired pharmacological and / or physiological effect. The effect may be prophylactic, in terms of completely or partially preventing a disease, and / or therapeutic, in terms of partially or completely curing adverse effects resulting from a disease. As used herein, "treatment" encompasses any treatment of a disease in a mammal and includes preventing a disease from occurring in a subject who may have the disease but has not yet been diagnosed as having it, suppressing the disease, i.e., arresting its development, or alleviating the disease, i.e., causing the disease to recede. Therapeutic agents or compositions can be administered before, during, or after the onset of disease or injury. Treatment of ongoing disease, in which treatment stabilizes or alleviates undesirable clinical symptoms in the patient, is also of particular interest. In particular embodiments, the subject in need of treatment has a disease, condition, and / or injury in which at least one associated symptom can be treated, ameliorated, and / or improved by cell therapy. Certain embodiments contemplate that subjects in need of cell therapy include, but are not limited to, bone marrow or stem cell transplant candidates, subjects who have undergone chemotherapy or radiation therapy, subjects suffering from or at risk of having a hyperproliferative disorder or cancer, e.g., a hyperproliferative disorder or cancer of the hematopoietic system, subjects having or at risk of developing a tumor, e.g., a solid tumor, subjects having or at risk of having a viral infection or a disease associated with a viral infection.
[0138] Therapeutic compositions containing iPSC-derived hematopoietic lineage cells as disclosed herein can be administered to a subject before, during, and / or after other treatments. Thus, combination therapy methods can include administering or preparing iPSC-derived immune cells before, during, and / or after the use of additional therapeutic agents. As described above, the one or more additional therapeutic agents can include peptides, cytokines, mitogens, growth factors, small RNAs, double-stranded RNAs (dsRNAs), mononuclear blood cells, feeder cells, feeder cell components or replacement factors thereof, vectors containing one or more polynucleic acids of interest, antibodies, chemotherapeutic or radioactive agents, or immunomodulatory drugs (IMiDs). Administration of iPSC-derived immune cells can be separated from administration of the additional therapeutic agent by hours, days, or weeks. Additionally or alternatively, administration can be combined with other bioactive agents or modalities, such as, but not limited to, anti-tumor agents, non-pharmacologic therapies such as surgery, etc.
[0139] In some embodiments, the additional therapeutic agent comprises an antibody or antibody fragment. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody may be a humanized antibody, a humanized monoclonal antibody, or a chimeric antibody. In some embodiments, the antibody or antibody fragment specifically binds to a viral antigen. In other embodiments, the antibody or antibody fragment specifically binds to a tumor antigen. In some embodiments, the tumor- or virus-specific antigen activates the administered iPSC-derived hematopoietic lineage cells to enhance their killing capacity. In some embodiments, antibodies suitable for combination therapy as additional therapeutic agents for administered iPSC-derived hematopoietic lineage cells include, but are not limited to, anti-CD20 (retuximab, veltuzumab, ofatumumab, ublituximab, ocaratuzumab, obinutuzumab), anti-Her2 (trastuzumab), anti-CD52 (alemtuzumab), anti-EGFR (certuximab), and anti-CD38 (daratumumab, isatuximab, MOR202), and humanized and Fc-modified variants thereof.
[0140] In some embodiments, the additional therapeutic agent comprises one or more chemotherapeutic agents or radioactive components. Chemotherapeutic agents refer to cytotoxic antitumor agents, i.e., chemicals that preferentially kill tumor cells or disrupt the cell cycle of rapidly proliferating cells, or chemicals that have been found to eradicate stem cancer cells, chemicals that are used therapeutically to prevent or reduce the growth of tumor cells. Chemotherapeutic agents are sometimes referred to as antitumor or cytotoxic drugs or agents, and are well known in the art.
[0141] In some embodiments, chemotherapeutic agents include anthracyclines, alkylating agents, alkylsulfonates, aziridines, ethylenimines, methylmelamine, nitrogen mustards, nitrosoureas, antibiotics, antimetabolites, folic acid analogs, purine analogs, pyrimidine analogs, enzymes, podophyllotoxins, platinum-containing agents, interferons, and interleukins. Exemplary chemotherapeutic agents include alkylating agents (cyclophosphamide, mechlorethamine, mephalin, chlorambucil, heamethylmelamine, thiotepa, busulfan, carmustine, lomustine, semustine), animetabolites (methotrexate, fluorouracil, floxuridine, cytarabine, 6-mercaptopurine, thioguanine, pentostatin), vinca alkaloids, and the like. These include, but are not limited to, steroids (vincristine, vinblastine, vindesine), epipodophyllotoxins (etoposide, etoposide orthoquinone, and teniposide), antibiotics (daunorubicin, doxorubicin, mitoxantrone, bisanthrene, actinomycin D, plicamycin, puromycin, gramicidin D), paclitaxel, colchicine, cytochalasin B, emetine, maytansine, and amsacrine.Additional agents include aminglutethimide, cisplatin, carboplatin, mitomycin, altretamine, cyclophosphamide, lomustine (CCNU), carmustine (BCNU), irinotecan (CPT-11), alemtuzamab, altretamine, anastrozole, L-asparaginase, azacitidine, bevacizumab, bexarotene, bleomycin, bortezomib, busulfan, calcitabine, capecitabine, celecoxib, cetuximab, Cladribine, cloflavine, cytarabine, dacarbazine, denileukin diftitox, diethlstilbestrol, docetaxel, dromostanolone, epirubicin, erlotinib, estramustine, etoposide, ethinyl estradiol, exemestane, floxuridine, 5-fluorouracil, fludarabine, flutamide, fulvestrant, gefitinib, gemcitabine, goserelin, hydroxyurea A, ibritumomab, idarubicin, ifosfamide, imatinib, interferon alpha (2a, 2b), irinotecan, letrozole, leucovorin, leuprolide, levamisole, mechlorethamine, megestrol, melphalin, mercaptopurine, methotrexate, methoxsalen, mitomycin C, mitotane, mitoxantrone, nandrolone, nofetumomab, oxaliplatin, paclitaxel, pamidronate, pemetidine These include Rexed, pegademase, pegaspargase, pentostatin, pipobroman, plicamycin, porifeprosan, porfimer, procarbazine, quinacrine, rituximab, sargramostim, streptozocin, tamoxifen, temozolomide, teniposide, testolactone, thioguanine, thiotepa, topetecan, toremifene, tositumomab, trastuzumab, tretinoin, uracil mustard, valrubicin, vinorelbine, and zoledronate. Other suitable agents are those approved for human use, including those approved as chemotherapeutic or radiotherapeutic agents and known in the art.Such agents can be found in many standard physician and oncologist reference works (e.g., Goodman & Gilman's The Pharmacological Basis of Therapeutics, Ninth Edition, McGraw-Hill, NY, 1995) or through the National Cancer Institute's website (fda.gov / cder / cancer / druglistfrarne.htm), both of which are updated from time to time.
[0142] Immunomodulatory drugs (IMiDs), such as thalidomide, lenalidomide, and pomalidomide, stimulate both NK cells and T cells. As provided herein, IMiDs can be used in conjunction with iPSC-derived therapeutic immune cells for cancer treatment.
[0143] As those skilled in the art will understand, both autologous and allogeneic hematopoietic lineage cells derived from iPSCs based on the methods and compositions herein can be used in the above cell therapy.In the case of autologous transplantation, the isolated population of derived hematopoietic lineage cells is fully or partially HLA-matched with the patient.In another embodiment, the derived hematopoietic lineage cells are not HLA-matched with the subject.
[0144] In some embodiments, the number of derived hematopoietic lineage cells in the therapeutic composition is at least 0.1 x 10 per dose. 5 Cells, at least 1x10 5 Cells, at least 5x10 5 Cells, at least 1x10 6 Cells, at least 5x10 6 Cells, at least 1x10 7 Cells, at least 5x10 7 Cells, at least 1x10 8 Cells, at least 5x10 8 Cells, at least 1x10 9 cells, or at least 5x10 9 In some embodiments, the number of derived hematopoietic lineage cells in the therapeutic composition is about 0.1 x 10 per dose. 5 cells ~ approx. 1x10 6cells, approximately 0.5 x 10 per dose 6 cells ~ approx. 1 x 10 7 cells, approximately 0.5x10 per dose 7 cells ~ approx. 1x10 8 cells, approximately 0.5x10 per dose 8 cells ~ approx. 1x10 9 cells, approximately 1x10 per dose 9 Cells ~ approx. 5x10 9 cells, approximately 0.5x10 per dose 9 cells ~ approx. 8x10 9 cells, approximately 3x10 per dose 9 cells ~ approx. 3x10 10 cells, or anywhere in between. Typically, for a 60 kg patient, 1x10 8 Cells / dose is 1.67x10 6 Converted to cells / kg.
[0145] In one embodiment, the number of derived hematopoietic lineage cells in the therapeutic composition is the number of immune cells in a fraction of blood or a single cord of blood, or at least 0.1 x 10 5 At least 0.5x10 cells / kg body weight 5 At least 1 x 10 cells / kg body weight 5 At least 5x10 cells / kg body weight 5 Cells / kg body weight, at least 10x10 5 At least 0.75 x 10 cells / kg body weight 6 At least 1.25 x 10 cells / kg body weight 6 At least 1.5x10 cells / kg body weight 6 At least 1.75x10 cells / kg body weight 6 At least 2x10 cells / kg body weight 6 At least 2.5 x 10 cells / kg body weight 6 Cells / kg body weight, at least 3x10 6 Cells / kg body weight, at least 4x10 6 Cells / kg body weight, at least 5x10 6 Cells / kg body weight, at least 10x10 6 Cells / kg body weight, at least 15x10 6Cells / kg body weight, at least 20x10 6 Cells / kg body weight, at least 25x10 6 Cells / kg body weight, at least 30x10 6 cells / kg body weight, 1x10 8 cells / kg body weight, 5x10 8 cells / kg body weight, or 1x10 9 cells / kg body weight.
[0146] In one embodiment, doses of derived hematopoietic lineage cells are delivered to a subject. In one exemplary embodiment, the effective amount of cells provided to a subject is at least 2x10 cells, including all intervening doses of cells. 6 cells / kg, at least 3x10 6 cells / kg, at least 4x10 6 Cells / kg, at least 5x10 6 cells / kg, at least 6x10 6 cells / kg, at least 7x10 6 Cells / kg, at least 8x10 6 Cells / kg, at least 9x10 6 cells / kg, or at least 10x10 6 cells / kg or more cells / kg.
[0147] In another exemplary embodiment, the effective amount of cells provided to a subject is about 2 x 10 cells, including all intervening doses of cells. 6 cells / kg, approximately 3x10 6 cells / kg, approximately 4x10 6 cells / kg, approximately 5x10 6 cells / kg, approximately 6x10 6 cells / kg, approximately 7x10 6 cells / kg, approximately 8x10 6 cells / kg, approximately 9x10 6 cells / kg, or approximately 10x10 6 cells / kg or more cells / kg.
[0148] In another exemplary embodiment, the effective amount of cells provided to a subject is about 2 x 10 cells, including all intervening doses of cells. 6cells / kg ~ approx. 10×10 6 cells / kg, approximately 3×10 6 cells / kg ~ approx. 10×10 6 cells / kg, approximately 4x10 6 cells / kg ~ approx. 10x10 6 cells / kg, approximately 5x10 6 cells / kg ~ approx. 10x10 6 cells / kg, 2x10 6 cells / kg ~ approx. 6x10 6 cells / kg, 2x10 6 cells / kg ~ approx. 7x10 6 cells / kg, 2x10 6 cells / kg ~ approx. 8x10 6 cells / kg, 3x10 6 cells / kg ~ approx. 6x10 6 cells / kg, 3x10 6 cells / kg ~ approx. 7x10 6 cells / kg, 3x10 6 cells / kg ~ approx. 8x10 6 cells / kg, 4x10 6 cells / kg ~ approx. 6x10 6 cells / kg, 4x10 6 cells / kg ~ approx. 7x10 6 cells / kg, 4x10 6 cells / kg ~ approx. 8x10 6 cells / kg, 5x10 6 cells / kg ~ approx. 6x10 6 cells / kg, 5x10 6 cells / kg ~ approx. 7x10 6 cells / kg, 5x10 6 cells / kg ~ approx. 8x10 6 cells / kg, or 6x10 6 cells / kg ~ approx. 8x10 6 cells / kg.
[0149] Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject.
[0150] In some embodiments, the therapeutic use of the derived hematopoietic lineage cells is a single-dose treatment. In some embodiments, the therapeutic use of the derived hematopoietic lineage cells is a multiple-dose treatment. In some embodiments, the multiple-dose treatment is one administration every day, every 3 days, every 7 days, every 10 days, every 15 days, every 20 days, every 25 days, every 30 days, every 35 days, every 40 days, every 45 days, every 50 days, or any number of days in between.
[0151] Compositions comprising populations of derived hematopoietic lineage cells of the present invention can be sterile, suitable for administration to human patients, and ready-to-administer (i.e., can be administered without further processing). A cell-based composition that is ready for administration means that the composition does not require further treatment or manipulation before transplantation or administration to a subject. In other embodiments, the present invention provides isolated populations of derived hematopoietic lineage cells that are expanded and / or regulated with one or more agents prior to administration. For derived hematopoietic lineage cells that have been genetically engineered to express a recombinant TCR or CAR, the cells can be activated and expanded using, for example, the methods described in U.S. Patent No. 6,352,694.
[0152] In certain embodiments, the primary stimulatory signal and the costimulatory signal for the derived hematopoietic lineage cells can be provided by different protocols. For example, the agents providing each signal can be in solution or bound to a surface. If bound to a surface, the agents can be bound to the same surface (i.e., a "cis" configuration) or to separate surfaces (i.e., a "trans" configuration). Alternatively, one agent can be bound to a surface and the other agent can be bound to a solution. In one embodiment, the agent providing the costimulatory signal can be bound to the cell surface, and the agent providing the primary activation signal can be in solution or bound to a surface. In certain embodiments, both agents can be in solution. In another embodiment, the agents can be in soluble form and then crosslinked to a surface, such as cells expressing Fc receptors or antibodies or other binding agents that bind to the agents for artificial antigen-presenting cells (aAPCs) contemplated for use in activating and expanding T lymphocytes in embodiments of the present invention, such as those disclosed in U.S. Patent Application Publication Nos. 20040101519 and 20060034810.
[0153] Therapeutic compositions suitable for administration to a patient can include one or more pharmaceutically acceptable carriers (excipients) and / or diluents (e.g., a pharmaceutically acceptable medium, e.g., cell culture medium), or other pharmaceutically acceptable components. Pharmaceutically acceptable carriers and / or diluents are determined in part by the particular composition being administered, as well as by the particular method used to administer the therapeutic composition. Accordingly, there are a wide variety of suitable formulations of the therapeutic compositions of the present invention (see, e.g., Remington's Pharmaceutical Sciences, 17 th ed. 1985, the disclosure of which is incorporated herein by reference in its entirety).
[0154] In particular embodiments, a therapeutic cell composition comprising an isolated population of iPSC-derived hematopoietic lineage cells also comprises a pharmaceutically acceptable cell culture medium, or a pharmaceutically acceptable carrier and / or diluent. The therapeutic compositions comprising a population of iPSC-derived hematopoietic lineage cells disclosed herein can be administered intravenously, intraperitoneally, enterally, or via tracheal administration, either individually or in combination with other appropriate compounds that achieve a desired therapeutic goal.
[0155] These pharmaceutically acceptable carriers and / or diluents can be present in an amount sufficient to maintain the pH of the therapeutic composition between about 3 and about 10. Thus, the buffering agent can be present in an amount as low as about 5% on a weight-to-weight basis of the total composition. Electrolytes, such as, but not limited to, sodium chloride and potassium chloride, can also be included in the therapeutic composition. In one aspect, the pH of the therapeutic composition is in the range of about 4 to about 10. Alternatively, the pH of the therapeutic composition is in the range of about 5 to about 9, about 6 to about 9, or about 6.5 to about 8. In another embodiment, the therapeutic composition comprises a buffer having a pH within one of the above pH ranges. In another embodiment, the therapeutic composition has a pH of about 7. Alternatively, the therapeutic composition has a pH in the range of about 6.8 to about 7.4. In yet another embodiment, the therapeutic composition has a pH of about 7.4.
[0156] The present invention also provides, in part, the use of pharmaceutically acceptable cell culture media in certain compositions and / or cultures of the invention. Such compositions are suitable for administration to human subjects. Generally speaking, any medium that supports the maintenance, growth, and / or health of iPSC-derived immune cells according to embodiments of the present invention is suitable for use as a pharmaceutical cell culture medium. In particular embodiments, the pharmaceutically acceptable cell culture medium is serum-free and / or feeder-free. In various embodiments, the serum-free medium is animal-free and optionally protein-free. Optionally, the medium can contain biologically acceptable recombinant proteins. Animal-free medium refers to a medium in which components are derived from non-animal sources. Recombinant proteins replace natural animal proteins in animal-free media, and nutrients are obtained from synthetic, plant, or microbial sources. In contrast, protein-free medium is defined as being substantially protein-free. Those skilled in the art will understand that the above examples of media are illustrative and in no way limit the formulation of media suitable for use in the present invention. Sequence Listing SEQ ID NO: 1 Length: 641 Type: PRT Biology: Human herpesvirus 4 MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGRGRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAGAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGGGAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGSGGRGRGGSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPPPGRRPFFHPVGEADYFEYHQEGGPDGEPDVPPGAIEQGPADDPGEGPSTGPRGQGDGGRRKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDEGEEGQE Accession number 2 Length: 422 Type: PRT Organism: Human herpesvirus 4 MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGRGRGGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAGAGGGGRGRGGSGGRGRGGSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPPPGRRPFFHPVGEADYFEYHQEGGPDGEPDVP PGAIEQGPADDPGEGPSTGPRGQGDGGRRKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDEGEEGQE [Example]
[0157] The following examples are offered by way of illustration and not by way of limitation.
[0158] Example 1 - Materials and Methods Single Cell Dissociation All reprogramming cultures were switched to FMM on day 14 post-transfection. Once in FMM, all reprogramming cultures were maintained and dissociated using Accutase. Single cells were then passaged on Matrigel- or vitronectin-coated surfaces. Dissociated single cells were then expanded in FMM and maintained until sorting by flow cytometry.
[0159] Flow cytometry analysis and sorting. Single-cell dissociated reprogramming pools were resuspended in chilled staining buffer. Conjugated primary antibodies, including SSEA4-FITC, TRA181-Alexa Fluor-647, and CD30-PE (BD Biosciences), were added to the cell solution and incubated on ice for 15 minutes. All antibodies were used at 7–10 μL per million cells in 100 μL of staining buffer. The resuspended dissociated single cells in staining buffer were spun down and resuspended in staining buffer containing ROCK inhibitor, this time kept on ice for flow cytometry sorting. Flow cytometry sorting was performed on a FACS Aria II (BD Biosciences) using the gating strategy described in the "Results" section. Sorted cells were directly ejected into 96-well plates at concentrations of 3 and 9 events per well. Each well was pre-filled with FMM. Once sorting was complete, the 96-well plates were incubated for colony formation and expansion. Cells were passaged 7–10 days after sorting. Subsequent passages in FMM were performed periodically at 75–90% confluency. Flow cytometry analysis was performed using a Guava EasyCyte 8 HT (Millipore) and analyzed using FCS Express 4 (De Novo Software).
[0160] Testing for the Presence of Transgenes Genomic DNA was isolated using the QIAamp® DNA Mini Kit and proteinase K digestion (Qiagen). 100 ng of genomic DNA was amplified using a Taq PCR Master Mix Kit (Qiagen) with primer sets specific to the transgenes, including the reprogramming factors and EBNA1. The PCR reaction was performed for 35 cycles as follows: 94°C for 30 seconds (denaturation), 60–64°C for 30 seconds (annealing), and 72°C for 1 minute (extension). Genomic DNA from fibroblasts and hiPSCs generated using the lentiviral method was used as a negative control. DNA from the episomal construct was used as a positive control.
[0161] Alkaline phosphatase staining: Cells were fixed with 4% v / v paraformaldehyde (Alfa Aesar), washed three times with PBS, and stained with an alkaline phosphatase staining kit (Millipore). Briefly, 2 parts fastlet violet, 1 part naphthol AS-BI phosphate (Phosphaste), and 1 part water were mixed and added to the fixed cells. The cells were incubated at 25°C for 15 minutes and then washed with PBS.
[0162] Karyotype Analysis Cytogenetic analysis was performed on G-banded metaphase cells by WiCell Research Institute (Madison, WI). Each karyotype analysis included a minimum of 20 spreads, and if nonclonal abnormalities were identified in the first 20, the analysis was expanded to 40 spreads.
[0163] Teratoma formation. Single-cell dissociated hiPSCs were injected subcutaneously into NOD / SCID / γ-null mice at concentrations of 0.5 million and 3 million cells per 200 μL solution (100 μL FMM and 100 μL Matrigel). After 5–6 weeks (injection of 3 million cells) and 7–8 weeks (injection of 0.5 million cells), teratomas were harvested, fixed, and maintained for processing. Samples were submitted to the UCSD Histology Core Facility for sectioning, staining, and examination.
[0164] Statistical Analysis At least three independent experiments were performed. Values are reported as mean + SEM. Statistical analysis was performed by ANOVA, and p<0.05 was considered significant.
[0165] Conventional hESC culture media contains DMEM / F12 medium supplemented with 20% knockout serum replacement, 0.1 mM (or 1% v / v) non-essential amino acids, 1–2 mM L-glutamine, 0.1 mM β-mercaptoethanol, and 10–100 ng / ml bFGF. In contrast, multi-stage culture media further contains a ROCK inhibitor, as well as one or more of a GSK3 inhibitor, MEK inhibitor, and TGFβ inhibitor. This stage-specific culture platform also supports feeder-free reprogramming and maintenance.
[0166] In certain applications, in addition to conventional culture components, the reprogramming medium (FRM) contains a combination of an SMC4:ROCK inhibitor, a GSK3 inhibitor, a MEK inhibitor, and a TGFβ inhibitor, and the maintenance medium (FMM) contains a combination of an SMC3:ROCK inhibitor, a GSK3 inhibitor, and a MEK inhibitor.
[0167] Example 2 - Reprogramming using a transient and temporary reprogramming system Both plasmid and episomal vectors are non-integrated extrachromosomal DNA. Standard plasmids contain only a promoter and the polynucleotide(s) to be expressed and cannot replicate autonomously or with the host cell chromosome. Therefore, plasmid-mediated transgene expression is neither continuous nor stable; rather, it is transient (cytoplasmic) and short-term, dependent on surviving input vector DNA, which is susceptible to transfection efficiency, copy number, and plasmid loss rate. It has been shown that reprogramming can be achieved only by repeated daily transfection of plasmid vectors, yet with unacceptably low efficiency (Okita et al., Science (2008); 322:949-953).
[0168] Compared to plasmid vectors, episomal vectors can exist and replicate autonomously in the cytoplasm or as part of a chromosome. Therefore, transgene expression mediated by episomal vectors is continuous and stable due to vector replication. For example, in addition to the transgene(s) of interest, EBV-based episomal vectors encode both the Epstein-Barr nuclear antigen-1 (EBNA1) protein and an EBV-derived origin of replication (oriP), which replicate and maintain the episomal vector in the nuclei of dividing cells. EBNA expressed in the episomal vector binds to oriP and recruits cellular DNA replication complex components, enabling oriP to initiate replication of the vector DNA along with host cell chromosome replication. EBNA-1 then tethers daughter episomes generated during S phase to the host chromosome via oriP, maintaining the episome's intranuclear retention and thus maintaining continuous transgene(s) and EBNA expression (Gil et al., Gene Ther 2010, p. 17(10):1288-1293). EBNA-mediated episomal tethering confers episomal segregation to each daughter cell during mitosis, ensuring a consistent number of episomes per cell (Gil et al., 2010). Episomal plasmids containing both oriP and an EBNA-1 expression cassette can sustain replication in cultured human cells with approximately 95% episome retention per cell cycle without selection (Gil et al., 2010). EBV-based episomal vectors continuously express exogenous reprogramming factors for at least 12 days (the period required to establish a self-sustaining pluripotent state; see Okita et al., Science (2008); 322:949-953, or at least 8 days to at least 30 days as described in U.S. Patent No. 8,5546,140).
[0169] To perform reprogramming using the transient and temporal reprogramming system of this application, several vectors were constructed, as shown in Table 1 and Figure 1. Vector 1 (V1) is a plasmid vector containing a promoter and oriP to drive the expression of selected reprogramming factor (RF)(s). Vector 1 lacks an EBNA coding sequence, resulting in a shortened retention time in host cells. Vector 1 is also referred to as an oriP / RF plasmid. When Vector 1 encodes more than one reprogramming factor, the factors can be separated by a self-cleaving 2A peptide or an IRES. Multiple V1s can be used for co-transfections in which different combinations of reprogramming factors are desired, and the stoichiometry of the reprogramming factors can be predetermined by controlling the relative copy number of each reprogramming factor in the V1 combination. Vector 2 (V2) is a plasmid containing a promoter and EBNA coding sequence, with expression driven by the promoter. More importantly, V2 lacks oriP, significantly shortening V2 retention time in transfected host cell populations. Vector 2 is also referred to as an EBNA plasmid. V2 can also be replaced with EBNA mRNA or protein / peptide. Methods and materials for mRNA-mediated reprogramming are described, for example, in Warren et al. (Cell Stem Cell (2010): 7, 618-630), while recombinant protein-mediated reprogramming is described, for example, in Zhou et al. (Cell Stem Cell (2009): 4, 381-384), both of which are incorporated herein by reference. Vector 3 (V3) is a vector that expresses both oriP and EBNA, but does not contain reprogramming factor coding sequences. To examine whether these vectors support reprogramming, V1, V2, and V3 were transduced into human fibroblasts, either alone or in different combinations (see Table 2). Table 1 - Vector constructs [Table 2]
[0170] The first combination tested was V1, V2, and V3 (an EmTTR- and EBNA-mediated transient reprogramming system), which induced long-term EBNA expression, sustained transgene retention, and effective reprogramming. The reprogramming factors used in this combination included OCT4, NANOG, and SOX2 (V1A and V1B). At 15 days post-transfection (D15), the reprogramming pool of cells expressing both SSEA4 and TRA181, indicative of a pluripotent state, was sorted by flow cytometry. A remarkable 21.4% of the cells were double-positive for these pluripotency markers (Figure 2). At 30 days post-transfection (D30), the reprogramming pool was stained for iPSC pluripotency markers TRA181, SSEA4, and CD30 (a surrogate marker for NANOG) (Figure 3). Immunofluorescence staining for OCT4 and NANOG confirmed the appearance of colonies expressing iPSC pluripotency markers, indicating successful reprogramming.
[0171] To rule out the possibility that V3 in trans creates supraphysiological amounts of transgene expression in the EmTTR system, creating cells overly dependent on transgene expression rather than timely transition to endogenous pluripotency factors to drive reprogramming, we removed V3 from the combination and transfected fibroblasts with V1 (V1A + V1B) and V2 alone, a system termed STTR (short-lived transient and transient reprogramming). Surprisingly, the combination of V1 and V2 not only resulted in reprogramming but also achieved reasonable efficiency without the need for repeated transfection of V1 and V2. At D15 post-transfection, there were 2.35% SSEA / TRA181 double-positive cells (Figure 4). 27 days after transfection, the reprogramming pool was stained with iPSC pluripotency markers TRA181, SSEA4, and CD30. Immunofluorescence staining confirmed the appearance of colonies expressing iPSC pluripotency markers, indicating successful reprogramming using the STTR system (V1 and V2 only) (Figure 5).
[0172] This was a completely unexpected result: the STTR system was not expected to support reprogramming because it was assumed that short-lived transgene expression was not sufficient in either duration or timing. Table 2 - Vector combinations for reprogramming [Table 3] 1 Yu et al., Science (2009); 324 (5928): 797-801 (Transfer of seven reprogramming factors by co-transfection of three episomal vectors and reprogramming using feeders conditioned with conventional hESC medium yielded 3-6 colonies / 10 6 acquisition of input cells). 2 :AP staining is less stringent than double positivity in estimating reprogramming efficiency
[0173] Furthermore, while initial reprogramming with the EmTTR system appears much more efficient than STTR reprogramming based on the percentage of double-positive cells, STTR better supports cell reprogramming toward the generation of iPSCs with self-sustaining pluripotency and long-term maintenance. Fibroblasts induced for reprogramming using the EmTTR and STTR systems were maintained for 25 days, respectively, and assessed for the expression of pluripotency markers SSEA4, TRA181, and CD30. As shown in Figure 6, the majority of the STTR-induced population at D25 maintained the expression of all three markers of pluripotency, while the EmTTR-induced population at D25 appeared to lose pluripotency as indicated by a significant decrease in CD30 expression, indicating reversion associated with an unsustainable or unstable pluripotent state. Both populations were then passaged, and the morphology of iPSC colonies and differentiation clusters in culture was subsequently observed and compared at D28 (Figure 7A). As initially noted with the maintenance of coexpression of SSEA4, TRA181, and CD30, the STTR population was maintained primarily as iPSC colonies with minimal spontaneous differentiation, whereas the EmTTR population showed high levels of spontaneous differentiation ( Figure 7B ).
[0174] To analyze the transient and transient nature of the STTR system, we used quantitative RT-PCR to analyze EBNA expression in the cell populations after transfection. We also monitored endogenous OCT4 expression, which indicates the emergence of a pluripotent state in the cell population. As shown in Figure 8, EBNA expression appeared after transfection, reached a peak at D2, and began to rapidly decline to less than 1% at D4, reflecting a loss rate of over 90% of the V2 plasmid per cell division (compared to the approximately 5% loss rate of EBV-based episomal vectors). Conventional assays eliminate plasmid selection at the beginning of the experiment and screen for the emergence of plasmid-free cells during long-term population expansion. By D6, EBNA expression in the population was essentially undetectable, characterizing a transient expression system. This rapid loss of EBNA expression confirms the extremely short-lived and transient nature of the system, most likely due to transient retention of the V2 plasmid in the cytoplasm without the benefit of nuclear uptake and chromosomal tethering or genomic integration. More importantly, EBNA was lost before the emergence of iPSC morphology during culture and before the formation of a robust self-sustaining pluripotent state. The methods provided herein shortened the EBNA-mediated plasmid maintenance time, in sharp contrast to the requirement for stable EBNA expression in episome-mediated reprogramming (see constitutive expression in host cells in US 8,546,140 or Mazda et al., 1997, where stable EBNA expression is required for at least 8 days to at least 30 days).
[0175] Howden et al., 2006 (Human Gene Therapy; 17:833-844) showed that cotransfection of EBNA mRNA with an EBV-based episomal vector increased nuclear uptake and chromosomal tethering of the EBV-based episomal vector, resulting in a 10-fold increase in transfection efficiency. Here, we demonstrate that the transient spike in EBNA expression upon V2 plasmid transfection in the STTR system may resemble the shape of EBNA mRNA. However, our V1 plasmid, which contains only oriP and does not express EBNA, lacks the EBV-based episomal tethering mechanism that relies on continuous EBNA expression for long-term maintenance and replication of vector DNA, significantly affecting transfection rates. Even though the cytoplasmic-to-nuclear transport of oriP-containing plasmids such as V1 is increased by transiently expressed EBNA plasmid V2 upon cotransfection of the two plasmids, V1 still does not support long-term expression of reprogramming factor transgenes, as indicated by the similar loss rates between V1 and V2.
[0176] Thus, STTR reprogramming using V1 and V2 relies on a plasmid mechanism characterized as truly transient (extrachromosomal and cytoplasmic) and transient (very short duration), unlike episomal reprogramming, which is nuclear and long-term in comparison. V1- and V2-mediated plasmid reprogramming is surprisingly efficient, without the need for multiple transfections. Furthermore, plasmid reprogramming appears to lose all EBNA plasmids by D6, at which point iPSCs or a pluripotent state has not been formed. Through EBNA detection, the STTR system demonstrated that transgene loss is rapid and significant, generally before the establishment of a pluripotent state around D21–D32, using elevated endogenous OCT4 expression levels as one of the markers.
[0177] Interestingly, although the reprogramming efficiency using the STTR system was lower than that of the EmTTR system (approximately 2% vs. 21%), unlike the EmTTR system, we did not detect pluripotency reversion and / or spontaneous differentiation of iPSCs in the STTR system, as the majority of iPSCs generated in the STTR system maintained their iPSC status and were able to differentiate into all three germ layers: endoderm, mesoderm, and ectoderm (Figure 9). This may be due, in part, to the short period of transgene exposure to the cell population, such that reprogramming is more likely to utilize induced endogenous developmental systems and dynamics rather than being largely driven by exogenous reprogramming factors, whose presence can be maintained by long-term expression of EBNA, as seen with EmTTR.
[0178] To provide further evidence that newly formed iPSCs lack V1 DNA, we performed functionality testing on multiple iPSC lines (D25–D30) for survival in the presence of hygromycin. All tested hiPSC lines demonstrated a complete absence of STTR genetic elements and were resistant to hygromycin, further evidence of the complete loss of V1 DNA in the STTR system. Selected clones were passaged as single cells in a feeder-free environment and demonstrated the ability to efficiently differentiate into three somatic cell lineages while maintaining a homogenous population of undifferentiated cells. Karyotype and copy number variation analysis revealed genomically stable hiPSC lines during long-term culture maintained in FMM. Furthermore, selected clones demonstrated the ability to generate cells of three germ layers and, when directed, differentiated uniformly into hematopoietic cells, including CD34+ cells, NK cells, and T cells.
[0179] Furthermore, the STTR system was shown to be effective in initiating reprogramming regardless of the combination of different reprogramming factors carried out by individual V1 vectors (Figure 10 and Table 3). Table 3 - Novel reprogramming factor combinations applicable to STTR system-mediated reprogramming [Table 4]
[0180] Reprogramming using the present STTR system and reprogramming using EBV-based episomal vectors generates iPSCs that differ in terms of exogenous DNA content. EBV-based episomal reprogramming has been highly praised for generating footprint-free iPSCs, but it is highly dependent on a slow rate of episomal DNA loss of approximately 3–5% per cell division (Leight et al., Mol Cell Biol (2001); 21:4149–4161). Therefore, when using episomal vectors for reprogramming, footprint-free iPSC populations are only possible after multiple passagings of iPSCs. It has been shown that initially obtained iPSCs must be passaged for at least 12–15 times (each culture split every 4–7 days counts as one passage) to obtain essentially footprint-free pluripotent stem cell populations without selection (Cheng et al., Cell Stem Cell (2012); 10:337–344). Until now, iPSC populations generated in this way have been highly heterogeneous in terms of exogenous DNA content. One study showed that approximately two-thirds of the iPSCs in a population contained oriP / EBNA episomal vectors approximately 20 days after transfection (Leight et al., Mol Cell Biol (2001); 21:4149-4161; Yu et al., Science (2009); 324(5928):797-801). For reprogrammed cells with significant or high spontaneous differentiation rates, obtaining footprint-free iPSCs through a long-term natural passaging process is even more difficult.
[0181] Taken together, the data demonstrate that footprint-free hiPSCs can be readily generated by transiently and temporarily expressing reprogramming genes using the combination of short-lived plasmid vectors provided herein, and the platform supports the efficient and rapid generation of substantially homogeneous footprint-free iPSC populations. In some embodiments, footprint-free iPSC populations are generated without the need for extensive passaging, optionally in a completely feeder-free environment.
[0182] Example 3 - Transient and temporary reprogramming system for generating single cell-derived iPSC banks as a source of derived cells for therapeutic use The STTR reprogramming composition and method have been used to generate clonal master iPSC lines for use as a renewable and reliable cell source for commercial immunotherapy. Donor-consented fibroblasts were transfected with the disclosed plasmid combination. Reprogrammed cells were sorted at clonal density into 96-well plates, and single-cell-derived iPSC clones were expanded and screened for desirable attributes, including pluripotency, loss of the reprogramming plasmid, genomic stability, and differentiation potential. Selected clonal iPSC lines were produced and cryopreserved under strict manufacturing and process quality control. The lines underwent extensive characterization and testing to qualify as "master cell banks" as required under relevant regulations. The produced iPSC bank was differentiated into clinically relevant natural killer (NK) cells in accordance with current good manufacturing practices. The derived cells underwent further extensive characterization and testing to qualify as "drug substances and medicinal products" as required under relevant regulations. iPSC-derived NK cells were cryopreserved at approximately 1 x 10 for use in adoptive cell therapy for hematological and solid cancers, either as monotherapy or in combination with immune checkpoint inhibitors. 8 Multiple doses were generated in cells / dose. Typically, for a 60 kg patient, 1x10 8 Cells / dose is 1.67x10 6The dosage form, route of administration, and dosing schedule for each indication were designed and determined according to preclinical data from both in vitro and in vivo GLP (Good Laboratory Practice) and non-GLP studies.
[0183] In addition to supporting iPSC-derived immune cells to treat cancer and immune disorders, footprint-free and feeder-cell-free master iPSC lines generated by the STTR reprogramming platform have the potential to enable off-the-shelf cell therapies for degenerative diseases ranging from macular degeneration, diabetes, Parkinson's disease, blood disorders, and cardiovascular diseases.
[0184] Those skilled in the art will readily appreciate that the methods, compositions, and products described herein represent exemplary embodiments and are not intended to limit the scope of the invention. It will be readily apparent to those skilled in the art that various substitutions and modifications can be made to the disclosure disclosed herein without departing from the scope and spirit of the invention.
[0185] All patents and publications mentioned in this specification are indicative of the levels of those skilled in the art to which this disclosure pertains. All patents and publications are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.
[0186] The present disclosure illustratively described herein can be suitably practiced in the absence of any element or elements, or any limitation, not specifically disclosed herein. Thus, for example, in each example herein, any of the terms "comprising," "consisting essentially of," and "consisting of" can be replaced with either of the other two terms. The terms and expressions used are used as terms of description and not of limitation, and the use of such terms and expressions is not intended to exclude equivalents of the features shown and described, or portions thereof, but recognizes that various modifications are possible within the scope of the claimed disclosure. Thus, while the present disclosure has been specifically disclosed by preferred embodiments and optional features, it should be understood that modifications and variations of the concepts disclosed herein may be made by those skilled in the art, and that such modifications and variations are considered to be within the scope of the present invention, as defined by the appended claims.
Claims
1. 1. An in vitro system for initiating reprogramming in non-pluripotent cells, said system comprising: one or more first plasmids, the first plasmids comprising an origin of replication comprising an Epstein-Barr virus nuclear antigen (EBNA) binding site and a polynucleotide encoding one or more reprogramming factors but not EBNA, wherein at least one of the one or more first plasmids comprises a polynucleotide encoding OCT4; (1) a second plasmid comprising a nucleotide sequence encoding EBNA, the second plasmid not comprising a replication origin comprising an EBNA binding site or a polynucleotide encoding a reprogramming factor; (2) EBNA mRNA and (3) an EBNA protein; The in vitro system does not include a plasmid containing both (i) an origin of replication containing an EBNA binding site and (ii) a polynucleotide encoding EBNA.
2. The system of claim 1 , wherein the expression of EBNA is transient and temporary.
3. The system of claim 1 , wherein the system does not provide EBNA replication and / or continuous expression in the nucleus.
4. The system of claim 1 , wherein the system allows for transient / cytoplasmic expression of EBNA prior to the appearance of pluripotent cell morphology and the inducible expression of endogenous pluripotency genes.
5. 10. The system of claim 1, wherein the system allows for transient / cytoplasmic expression of one or more reprogramming factors contained in a first plasmid prior to the emergence of pluripotent cell morphology and inducible expression of endogenous pluripotency genes.
6. The system of claim 1 , wherein the origin of replication comprises a wild-type origin of replication of EBV.
7. The system of claim 1 , wherein the EBNA is EBV-based.
8. 2. The system of claim 1, wherein the one or more first plasmids collectively comprise polynucleotides encoding reprogramming factors comprising one or more of SOX2, NANOG, KLF, LIN28, c-MYC, ECAT1, UTF1, ESRRB, HESRG, CDH1, TDGF1, DPPA4, DNMT3B, ZIC3, and L1TD1.
9. The system of claim 1 , wherein the polynucleotide encoding the reprogramming factor is contained in a polycistronic or non-polycistronic construct.
10. The system of claim 9 , wherein the polycistronic construct comprises a single open reading frame or multiple open reading frames.
11. 2. The system of claim 1, wherein the system comprises two or more first plasmids, each first plasmid comprising the same or different reprogramming factors encoded by at least one copy of a polynucleotide.
12. 2. The system of claim 1, wherein the first plasmid comprises two or more polynucleotides encoding reprogramming factors, wherein adjacent polynucleotides are operably linked by a linker sequence encoding a self-cleaving peptide or an IRES.
13. 13. The system of claim 12, wherein the self-cleaving peptide is a 2A peptide, and the 2A peptide is F2A, E2A, P2A, or T2A.
14. The system described in claim 13, wherein the first plasmid encodes (i) two 2A peptides that are the same, or (ii) two different 2A peptides.
15. The system described in claim 13, wherein the two 2A peptides encoded at adjacent positions in the first plasmid are different.
16. 2. The system of claim 1, wherein the one or more first plasmids and the second plasmid each comprise one or more promoters for expression of a reprogramming factor or EBNA, and the one or more promoters comprise at least one of a CMV promoter, an EF1α promoter, a PGK promoter, a CAG promoter, a UBC promoter, a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a cell type-specific promoter.
17. The system of claim 1 , wherein the first and second plasmids each contain a CAG promoter.
18. A kit comprising the system described in any one of claims 1 to 17, wherein (i) the kit comprises one or more first plasmids, (ii) the kit comprises one or more second plasmids, EBNA mRNA, or EBNA protein, and (iii) the kit does not comprise a plasmid comprising both (a) an origin of replication comprising an EBNA binding site and (b) a polynucleotide encoding EBNA.
Citation Information
Patent Citations
Methods and vectors to produce vector free induced pluripotent stem cells
WO2017123789A1