Live cell constructs and methods of use for cultured dairy product production - Patent Application 20070122997

The living cell construct with a three-dimensional scaffold and genetic modifications addresses the challenge of replicating milk composition by achieving uniform polarization and compartmentalization of mammary cells, enabling efficient production of cultured dairy products.

JP7759326B2Active Publication Date: 2025-10-23BIOMILQ INC
View PDF 1 Cites 0 Cited by

Patent Information

Application Number
JP2022540761
Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Priority Date
2020-12-10
Filing Date
2020-12-18
Publication Date
2025-10-23
Estimated Expiration
2040-12-18

AI Technical Summary

Technical Problem

Existing methods for producing cultured dairy products using mammary cell cultures face challenges in replicating the molecular profile of milk and dairy products, as fermentation-based processes rely on recombinant expression and purification of individual components, and previous attempts to culture mammary epithelial cells have failed to achieve uniform polarization and compartmentalization for efficient milk production.

Method used

A living cell construct comprising a three-dimensional scaffold with a matrix material and culture medium, supporting a confluent monolayer of polarized mammary cells, which are cultured in a bioreactor to produce and isolate cultured dairy products, utilizing genetic modifications to enhance milk synthesis.

Benefits of technology

The method enables the production of cultured dairy products with a molecular profile similar to natural milk by ensuring uniform polarization and compartmentalization of mammary cells, overcoming the limitations of previous methods.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 0007759326000005
    Figure 0007759326000005
  • Figure 0007759326000006
    Figure 0007759326000006
  • Figure 0007759326000007
    Figure 0007759326000007
Patent Text Reader

Abstract

[Solution] The present invention relates to living cell constructs for producing cultured dairy products from mammary cells in vitro and / or ex vivo, methods for producing isolated cultured dairy products from mammary cells, bioreactors for producing isolated cultured dairy products, and cultured dairy products.
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] cross reference This application claims the benefit of priority to U.S. Provisional Application No. 62 / 958,407, filed January 8, 2020, and U.S. Provisional Application No. 63 / 199,164, filed December 10, 2020, the contents of each of which are incorporated herein by reference in their entirety.

[0002] FIELD OF THE INVENTION The present invention relates to living cell constructs and methods of use thereof for the in vitro and / or ex vivo production of cultured dairy products from cultured mammary cells. [Background technology]

[0003] Milk is a staple in the human diet during infancy and throughout life. The American Academy of Pediatrics and the World Health Organization recommend that infants be exclusively breastfed for the first six months of life. Dairy consumption beyond infancy is a fundamental part of human nutrition and represents a $70 billion industry worldwide. However, because lactation is a physiologically demanding and metabolically demanding process that can present biological and practical challenges to breastfeeding mothers, milk production is associated with agricultural, environmental, social, and animal welfare impacts.

[0004] The potential for food production using mammary cell cultures has attracted considerable interest in recent years, with some pioneering success in producing meat and seafood products from cultured muscle and fat cells (Stephens et al. 2018 Trends Food Sci Technol. 78:155-166). Additionally, efforts are underway to commercialize the production of egg and milk proteins using microbial expression systems. However, these fermentation-based processes rely on the recombinant expression and purification of individual components and cannot fully replicate the molecular profile of milk or dairy products.

[0005] The present invention overcomes deficiencies in the art by providing live cell constructs, and methods of use thereof, for the in vitro and / or ex vivo production of cultured dairy products from cultured mammary cells. Summary of the Invention

[0006]

[0006] Disclosed herein, in certain embodiments, is a living cell construct comprising: (a) a three-dimensional scaffold having an exterior surface, an interior surface defining a lumen / basal chamber, and a plurality of pores extending from the interior surface to the exterior surface; (b) a matrix material disposed on the exterior surface of the three-dimensional scaffold; (c) a culture medium disposed within the lumen / basal chamber and in fluid contact with the interior surface; and (d) a at least 70% confluent monolayer of polarized mammary follicular cells disposed on the matrix material, the mammary follicular cells being selected from the group consisting of live primary mammary epithelial cells, live mammary myoepithelial cells, live mammary progenitor cells, live immortalized mammary epithelial cells, live immortalized mammary myoepithelial cells, and live immortalized mammary progenitor cells. In some embodiments, the polarized mammary follicular cells comprise an apical surface and a basal surface. In some embodiments, the basal surfaces of the polarized mammary follicular cells are in fluid contact with the culture medium. In some embodiments, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or 100% of the polarized mammary cells are polarized in the same orientation. In some embodiments, the polarized mammary cell monolayer is at least 70% confluent, at least 80% confluent, at least 90% confluent, at least 95% confluent, at least 99% confluent, or 100% confluent. In some embodiments, the polarized mammary cells comprise constitutively active prolactin receptor protein. In some embodiments, the culture medium comprises a carbon source, a chemical buffer system, one or more essential amino acids, one or more vitamins and / or cofactors, and one or more inorganic salts. In some embodiments, the culture medium further comprises prolactin. In some embodiments, the matrix material comprises one or more extracellular matrix proteins. In some embodiments, the three-dimensional scaffold comprises a natural polymer, a biocompatible synthetic polymer, a synthetic peptide, a composite derived from any of the foregoing, or any combination thereof. In some embodiments, the natural polymer is collagen, chitosan, cellulose, agarose, alginate, gelatin, elastin, heparan sulfate, chondroitin sulfate, keratan sulfate, and / or hyaluronic acid.In some embodiments, the biocompatible synthetic polymer is polysulfone, polyvinylidene fluoride, polyethylene covinyl acetate, polyvinyl alcohol, sodium polyacrylate, acrylic acid polymers, and / or polyethylene glycol.

[0007] Disclosed herein in certain embodiments is a method for producing an isolated cultured dairy product from mammary cells, the method comprising: (a) culturing a live cell construct in a bioreactor under conditions for producing a cultured dairy product, wherein the live cell construct comprises: (i) a three-dimensional scaffold having an exterior surface, an interior surface defining a lumen / base chamber, and a plurality of pores extending from the interior surface to the exterior surface; (ii) a matrix material disposed on the exterior surface of the three-dimensional scaffold; (iii) a culture medium disposed within the lumen / base chamber and in fluid contact with the interior surface; and (iv) a minimum 70% confluent monolayer of polarized mammary cells disposed on the matrix material, wherein the mammary cells are selected from the group consisting of live primary mammary epithelial cells, live mammary myoepithelial cells, live mammary progenitor cells, live immortalized mammary epithelial cells, live immortalized mammary myoepithelial cells, and live immortalized mammary progenitor cells; and (b) isolating the cultured dairy product. In some embodiments, the polarized mammary cells comprise an apical surface and a basal surface. In some embodiments, the basal surface of the polarized mammary cells is in fluid contact with the culture medium. In some embodiments, the bioreactor is a closed bioreactor. In some embodiments, the bioreactor comprises an apical compartment that is substantially isolated from the luminal / basal chamber of the living cell construct. In some embodiments, the apical compartment is in fluid contact with the apical surface of the mammary cells. In some embodiments, the cultured dairy product is secreted from the apical surface of the mammary cells into the apical compartment. In some embodiments, the culture medium is not in substantial contact with the cultured dairy product. In some embodiments, the total cell density of the mammary cells in the bioreactor is at least 10 11 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least 1.5 m 2In some embodiments, the culture medium comprises a carbon source, a chemical buffer system, one or more essential amino acids, one or more vitamins, and / or cofactors, and one or more inorganic salts. In some embodiments, the matrix material comprises one or more extracellular matrix proteins. In some embodiments, the scaffold comprises a natural polymer, a biocompatible synthetic polymer, a synthetic peptide, a composite derived from any of the foregoing, or any combination thereof. In some embodiments, the natural polymer is collagen, chitosan, cellulose, agarose, alginate, gelatin, elastin, heparan sulfate, chondroitin sulfate, keratan sulfate, and / or hyaluronic acid. In some embodiments, the biocompatible synthetic polymer is polysulfone, polyvinylidene fluoride, polyethylene-co-vinyl acetate, polyvinyl alcohol, sodium polyacrylate, an acrylic acid polymer, and / or polyethylene glycol. In some embodiments, the culturing step is performed at a temperature of about 27°C to about 39°C. In some embodiments, the culturing step is performed at a temperature of about 30°C to about 37°C. In some embodiments, the culturing step is carried out at an atmospheric CO2 concentration of about 4% to about 6%. In some embodiments, the culturing step is carried out at an atmospheric CO2 concentration of about 5%.

[0008]

[0010] Disclosed herein, in certain embodiments, is a bioreactor comprising: (a) an apical compartment containing a cultured dairy product; and (b) at least one live cell construct comprising: (i) a three-dimensional scaffold having an exterior surface, an interior surface defining a lumen / basal chamber, and a plurality of pores extending from the interior surface to the exterior surface; (ii) a matrix material disposed on the exterior surface of the three-dimensional scaffold; (iii) a culture medium disposed within the lumen / basal chamber and in fluid contact with the interior surface; and (iv) a minimum 70% confluent monolayer of polarized mammary cells disposed on the matrix material, wherein the mammary cells are selected from the group consisting of live primary mammary epithelial cells, live mammary myoepithelial cells, live mammary progenitor cells, live immortalized mammary epithelial cells, live immortalized mammary myoepithelial cells, and live immortalized mammary progenitor cells, wherein the apical surface of the mammary cells is in fluid contact with the apical compartment. In some embodiments, the total cell density of the mammary cells in the bioreactor is at least 10 11 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least 1.5 m 2 is.

[0009] In certain embodiments herein, a living cell construct containing mammary cells is disclosed that compartmentalizes the supply of cells and the secretion of cultured dairy products.

[0010] In certain embodiments herein, a living cell construct is provided, comprising: a scaffold having a top surface and a bottom surface; and a continuous monolayer of (a) live primary mammary epithelial cells, (b) a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or (c) live immortalized mammary epithelial cells on the top surface of the scaffold, wherein the (a) live primary mammary epithelial cells, (b) a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or (c) immortalized mammary epithelial cells are present. Disclosed are living cell constructs comprising a continuous monolayer of epithelial cells having an apical surface and a basal surface (e.g., the cells are polarized and form a confluent cell monolayer), the living cell construct comprising: (a) live primary mammary epithelial cells; (b) a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells; and / or (c) an apical compartment above and adjacent to the apical surface of the continuous monolayer of immortalized mammary epithelial cells, and a basal compartment below and adjacent to the bottom surface of the scaffold.

[0011] In certain embodiments, disclosed herein is a method for producing milk in culture, the method comprising culturing a living cell construct of the present invention to produce milk in culture.

[0012]

[0013] In certain embodiments herein, a method of making a live cell construct for producing milk in culture is provided, comprising the steps of: (a) isolating primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells from mammary tissue (e.g., breast tissue, udder tissue, nipple tissue), a biopsy sample, or a mammary explant derived from raw breast milk to produce isolated mammary epithelial cells, myoepithelial cells, and mammary progenitor cells; and (b) culturing the isolated primary mammary epithelial cells, myoepithelial cells, and mammary progenitor cells to produce primary mammary epithelial cells. (c) cultivating the mixed population of (b) on a scaffold having an upper surface and a lower surface to produce a polarized, continuous (i.e., confluent) monolayer of the mixed population of primary mammary epithelial cells, myoepithelial cells, and mammary progenitor cells on the upper surface of the scaffold, thereby producing a living cell construct for producing milk in culture, wherein the polarized, continuous monolayer comprises an apical surface and a basal surface.

[0013]

[0013] In certain embodiments herein, a method of making a live cell construct for producing milk in culture is provided, comprising the steps of: (a) isolating primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells from mammary tissue (e.g., breast tissue, mammary gland tissue, nipple tissue), a biopsy sample, or a mammary explant derived from raw breast milk to produce isolated mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells; and (b) culturing the isolated primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells to produce the primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells. (c) sorting the mixed population of primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells to produce a population of primary mammary epithelial cells; and (d) culturing the population of primary mammary epithelial cells on a scaffold having an upper and lower surface to produce a polarized, continuous (i.e., confluent) monolayer of primary mammary epithelial cells on the upper surface of the scaffold, thereby producing a living cell construct for producing milk in culture, wherein the polarized, continuous monolayer comprises an apical surface and a basal surface.

[0014] Disclosed herein in certain embodiments is a method for making a living cell construct for producing milk in culture, the method comprising: (a) culturing immortalized mammary epithelial cells to expand the number of immortalized mammary epithelial cells; and (b) culturing the immortalized mammary epithelial cells of (a) on a scaffold having an upper and lower surface to produce a polarized, continuous (i.e., confluent) monolayer of immortalized mammary epithelial cells on the upper surface of the scaffold, thereby producing a living cell construct for producing milk in culture, wherein the polarized, continuous monolayer comprises an apical surface and a basal surface.

[0015]

[0010] In certain embodiments herein, a method of producing milk in culture is provided, comprising: (a) a scaffold comprising an upper surface and a lower surface and comprising a continuous (i.e., confluent) polarized monolayer of live mammary epithelial cells, a continuous polarized monolayer of a mixed population of live mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or a continuous polarized monolayer of live immortalized mammary epithelial cells having an apical surface and a basal surface, wherein the continuous polarized monolayer of live mammary epithelial cells, the continuous polarized monolayer of a mixed population of live mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or the continuous polarized monolayer of live immortalized mammary epithelial cells is located on the upper surface of the scaffold; and (b) a scaffold comprising an upper surface and a lower surface and comprising a continuous polarized monolayer of live mammary epithelial cells, a continuous polarized monolayer of a mixed population of live mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or a continuous polarized monolayer of live immortalized mammary epithelial cells. Disclosed is a method comprising producing milk in culture by culturing a living cell construct comprising a bottom compartment and an apical compartment, wherein the lower surface of the scaffold is adjacent to the basal compartment and the apical surface of the monolayer of live primary mammary epithelial cells, the monolayer of a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or the monolayer of live immortalized mammary epithelial cells is adjacent to the apical compartment, and the monolayer of live primary mammary epithelial cells, the monolayer of a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, or the monolayer of immortalized mammary epithelial cells secretes milk through its apical surface into the apical compartment.

[0016]

[0013] In certain embodiments herein, a method for producing modified primary or immortalized mammary epithelial cells is provided, comprising: introducing into the cells: (a) a polynucleotide encoding a prolactin receptor comprising a modified intracellular signaling domain, optionally wherein the prolactin receptor comprises a truncation in which position 154 of exon 10 is spliced ​​to sequences 3' of exon 11; (b) a polynucleotide encoding a chimeric prolactin receptor that binds to a ligand and is capable of activating milk synthesis in the absence of prolactin; (c) a polynucleotide encoding a constitutively or conditionally active prolactin receptor protein, optionally comprising a constitutively active human prolactin receptor comprising a deletion of amino acids 9-187; (d) a polynucleotide encoding a modified (recombinant) effector of the prolactin receptor comprising (i) a JAK2 tyrosine kinase domain fused to a STAT5 tyrosine kinase domain and / or (ii) a prolactin receptor intracellular domain fused to a JAK2 tyrosine kinase domain; (e) a loss of function mutation in the circadian-related gene PER2 (periodic circadian protein homolog 2); and / or (f) a polynucleotide encoding one or more glucose transporter genes GLUT1 and / or GLUT12, thereby improving the rate of nutrient uptake at the basal surface of a monolayer of cells in modified primary or immortalized mammary epithelial cells. [Brief explanation of the drawings]

[0017] [Figure 1] Figure 1 shows an example of harvesting milk for nutritional purposes from mammary epithelial cells grown as a confluent monolayer in a compartmentalized culture device, in which fresh or recycled medium is provided in the basal compartment and milk is harvested from the apical compartment. TEER is transepithelial electrical resistance. [Figure 2] FIG. 1 shows an example of polarized nutrient uptake and milk secretion across a confluent monolayer of mammary epithelial cells anchored to the basal surface of a scaffold. [Figure 3] FIG. 1 shows an example of a micropatterned scaffold that increases the surface area for compartmentalized nutrient absorption and milk secretion with a confluent monolayer of mammary epithelial cells. [Figure 4] Diagram showing three examples of hollow fiber bioreactors (top), represented as capillary bundles, that can support mammary epithelial cells lining either the outer (top and bottom left) or inner (bottom right) surfaces of the capillaries to provide directed and compartmentalized nutrient absorption and milk secretion. [Figure 5]

[0023] Figure 1 illustrates a cross-section of a three-dimensional living cell construct. The living cell construct is composed of a scaffold having an inner surface and an outer surface that define a lumen / basal chamber. The lumen / basal chamber contains cell culture medium. A matrix material rests on top of the outer surface of the scaffold. Pores extend from the inner surface to the outer surface of the scaffold, allowing cell culture medium to contact the basal surface of cells in a cell monolayer disposed on the matrix material. [Figure 6] 1 illustrates a bioreactor for producing cultured dairy products. The bioreactor is comprised of a living cell construct and an apical chamber. The living cell construct is comprised of a scaffold having an inner surface and an outer surface that define a lumen / basal chamber. The lumen contains cell culture medium. A matrix material rests on top of the outer surface of the scaffold. Pores extend from the inner surface to the outer surface of the scaffold, allowing cell culture medium to contact the basal surface of cells in a cell monolayer disposed on the matrix material. The apical surface of cells in the cell monolayer secretes milk / cultured dairy products into the apical chamber. The apical chamber and the lumen / basal chamber are separated by the cell monolayer. [Figure 7] 1 illustrates a living cell construct. The living cell construct is composed of a scaffold having an inner surface and an outer surface that define a lumen / basal chamber. The lumen / basal chamber contains cell culture medium. A matrix material rests on top of the outer surface of the scaffold. Pores extend from the inner surface to the outer surface of the scaffold, allowing cell culture medium to contact the basal surface of cells in a cell monolayer disposed on the matrix material. DETAILED DESCRIPTION OF THE INVENTION

[0018] Milk is a nutrient-rich liquid food produced by the mammary glands of mammals. Milk is the primary source of nutrition for infant mammals (including breast-fed humans) until they are able to digest other types of food. Human milk is more than just nutrients; rather, it contains a variety of factors with bioactive properties that play a critical role in the survival and health of the infant. Natural milk contains many other macronutrients, including proteins, lipids, polysaccharides, and lactose. Milk consumption occurs in two overall distinct types: as a natural source of nutrition for all infant mammals and as a food product.

[0019] In nearly all mammals, milk is provided to the infant either directly through lactation or by the excretion of milk that is stored and later consumed. Early mammalian milk contains nutrients and growth factors, as well as antibodies that protect the newborn. Human milk is not a uniform, invariant, or constant factory product; it is a biological product produced by women with marked differences in genotype, phenotype, and diet. Adding to this complexity, the composition of human milk is influenced by a myriad of maternal, infant, and environmental factors. Human milk is rich in proteins, carbohydrates, lipids, fatty acids, minerals, and vitamins, but much of its disease-fighting potential comes from the abundance of antibodies, leukocytes, hormones, antimicrobial peptides, cytokines, chemokines, and other bioactive factors.

[0020] Mammary epithelial cells (MECs) in culture have been previously demonstrated to exhibit organization and behavior similar to that observed in vivo (Arevalo et al. 2016 Am J Physiol Cell Physiol. 310(5):C348-3 56; Chen et al. 2019 Curr Protoc Cell Biol. 82(1):e65). Specific biomarkers of MEC populations were detected in immortalized bovine mammary epithelial cells (BME-UV1) and immortalized bovine mammary alveolar cells (MAC-T) cultured on adherent 2-D plates, ultra-low attachment 3-D microplates, and Matrigel-coated 3-D plates. Additionally, Chen et al. detailed protocols for isolating and culturing primary human mammary epithelial stem / progenitor cells from human breast tissue and next-generation mammospheres using 3-D organoid culture on gelatin sponge and Matrigel matrices. However, neither Arevalo nor Chen attempted to stimulate milk production from these MEC cultures.

[0021] Specifically, when cultured bovine mammary epithelial cells are grown on an appropriate extracellular matrix and stimulated with prolactin, they polarize and organize into structures capable of secreting specific milk components (Blatchford et al. 1999 Animal Cell Technology: Basic & Applied Aspects 10:141-145). Blatchford et al. polarized bovine MECs to form mammospheres. Casein and butyrophilin were isolated from the culture medium. However, the cells did not polarize uniformly in one direction. Blatchford et al. noted that milk proteins were distributed between the cells and dispersed throughout the mammosphere. The lack of uniform polarized orientation required Blatchford to isolate secreted proteins from the culture medium.

[0022] Furthermore, in vitro 2D models, such as those used by Blatchford et al., have a low surface area to volume ratio (low density format): the surface area available for cell attachment limits the number of cells that can be grown.

[0023] The only known attempt to culture mouse mammary epithelial cells in a high-density format, such as a hollow fiber bioreactor, failed to achieve the compartmentalization necessary for the production and extraction of cultured milk products (Sharfstein et al. 1992 Biotechnology and Bioengineering 40:672-680). In Sharfstein et al., the growth, long-term functional expression, and metabolism of COMMA-ID (an immortalized mouse mammary epithelial cell line) were investigated in two different systems: extended batch culture and hollow fiber reactor culture. Using COMMA-ID cells plated on Costar Transwell® polycarbonate membrane cell culture inserts, Sharfstein et al. created confluent monolayers capable of forming a barrier between the apical and basolateral sides, polarizing metabolism and maintaining glucose and lactate gradients. However, even using hollow fiber bioreactor culture, Sharfstein et al. were unable to achieve separation of the basal and apical compartments. Furthermore, it was not determined whether nutrient uptake was polarized in hollow fiber culture (Sharfstein et al. 1992). Importantly, previous studies have not been able to culture mammary epithelial cells from humans or other nutritionally relevant species in a high-density, three-dimensional, compartmentalized format.

[0024] Disclosed herein in certain embodiments are living cell constructs, methods of making living cell constructs, and methods of using living cell constructs for the in vitro and / or ex vivo production of cultured dairy products from cultured mammary cells.

[0025] This specification is not intended to be a detailed catalog of all the different ways in which the invention may be practiced or all the features that may be added to the invention. For example, features illustrated with one embodiment may be incorporated into other embodiments, and features illustrated with a particular embodiment may be omitted from that embodiment. Additionally, numerous modifications and additions to the various embodiments suggested herein will be apparent to those skilled in the art in light of this disclosure without departing from the invention. Accordingly, the following detailed description is intended to illustrate some particular embodiments of the invention, but does not exhaustively specify all permutations, combinations, and variations thereof.

[0026] Unless the context clearly indicates otherwise, it is specifically intended that the various features described herein can be used in any combination. Moreover, in some embodiments, any feature or combination thereof described herein can be excluded or omitted. To illustrate, if a composite is described herein as comprising components A, B, and C, it is specifically intended that any of A, B, or C, or combinations thereof, singly or in any combination, can be omitted or discarded.

[0027] definition As used in the description of the present invention and the appended claims, the singular forms "a," "an," and "the" are intended to include the plural forms as well, unless the context clearly dictates otherwise.

[0028] As used herein, "and / or" refers to and encompasses all possible combinations of one or more of the associated listed items, as well as the lack of combinations when interpreted in the alternative ("or").

[0029] Furthermore, any feature or combination of features described herein may be excluded or omitted.

[0030] As used herein, the term "about," when referring to a measurable value such as an amount of a compound or agent, a dose, a time, a temperature, and the like, is intended to include variations of ±10%, ±5%, ±1%, ±0.5%, or ±0.1% of the specified amount.

[0031] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. The terminology used in the description herein is for the purpose of describing particular embodiments and is not intended to be limiting of the embodiments.

[0032] Nucleotide sequences are presented herein in a single strand only, from left to right in 5' to 3' orientation, unless otherwise indicated. Nucleotides and amino acids are represented herein by either the single-letter code (for amino acids) or the three-letter code in accordance with the format recommended by the IUPAC-1UB Biochemical Nomenclature Commission, or in accordance with both 37 C.F.R. § 1.822 and established usage.

[0033] Unless otherwise indicated, standard methods known to those skilled in the art may be used for recombinant and synthetic production of polypeptides, antibodies, or antigen-binding fragments thereof, manipulation of nucleic acid sequences, production of transformed cells, construction of viral vector constructs, and transient and stably transfected packaging cells. Such techniques are known to those skilled in the art. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd Ed. (Cold Spring Harbor, NY, 1989), FMA Usubel et al. Current Protocols In Molecular Biology (Green Publishing Associates, Inc. and John Wiley & Sons, Inc., New York).

[0034] As used herein, the transitional phrase "consisting essentially of" should be construed to include the recited materials or steps, as well as those that do not materially affect the basic and novel characteristics of the claimed invention. Thus, the term "consisting essentially of" as used herein should not be construed as equivalent to "comprising."

[0035] As used herein, the term "polypeptide" encompasses both peptides and proteins, unless otherwise indicated, but does not require any particular amino acid length or tertiary structure.

[0036] The term "polarized," as used herein with respect to cells and / or monolayers thereof, refers to the spatial state of a cell in which there are two distinct surfaces of the cell, e.g., an apical surface and a basal surface, which may be different. In some embodiments, the distinct surfaces of a polarized cell comprise different surface and / or transmembrane receptors and / or other structures. In some embodiments, individual polarized cells in a continuous monolayer have similarly oriented apical and basal surfaces. In some embodiments, individual polarized cells in a continuous monolayer have communication structures (e.g., tight junctions) between individual cells that allow cross-communication between individual cells and create separation (e.g., compartmentalization) of the apical and basal compartments.

[0037] As used herein, "apical surface" means the surface of a cell that faces the external environment or that faces a cavity or chamber, e.g., the cavity of an internal organ. With respect to mammary epithelial cells, the surface from which cultured dairy products are secreted is the apical surface.

[0038] As used herein, "basal surface" means a surface, eg, the surface of cells, that is in contact with the matrix of a bioreactor.

[0039] As used herein, "bioreactor" means a device or system that supports a biologically active environment that allows for the production of the cultured dairy products described herein from the mammary cells described herein.

[0040] As used herein, the term "lactogenic" refers to the ability to stimulate the production and / or secretion of milk. A gene or protein (e.g., prolactin) can be lactogenic, as can any other natural and / or synthetic product. In some embodiments, a lactogenic culture medium contains prolactin to stimulate milk production by cells contacting the culture medium.

[0041] As used herein, "food grade" refers to materials that are recognized as non-toxic and safe for consumption (e.g., by humans and / or other animals), e.g., as regulated by standards established by the U.S. Food and Drug Administration.

[0042] In some embodiments, milk produced by primary mammary epithelial cells (e.g., primary mammary epithelial cells derived from isolated live primary mammary epithelial cells and / or primary mammary epithelial cells derived from a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and / or mammary progenitor cells) or immortalized mammary epithelial cells is secreted through the apical surface of the cells into the apical compartment. In some embodiments, the basal compartment comprises culture medium, and the culture medium is in contact with the basal surface of the live primary mammary epithelial cells, the mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or the immortalized mammary epithelial cells.

[0043] live cell constructs Disclosed herein in certain embodiments is a live cell construct for producing milk in culture, the live cell construct comprising a continuous monolayer of live mammary cells selected from the group consisting of: (a) live primary mammary epithelial cells, (b) live mammary myoepithelial cells, (c) live mammary progenitor cells, and / or (d) live immortalized mammary epithelial cells.

[0044] In some embodiments, the mammary cells include milk-producing mammary epithelial cells, contractile myoepithelial cells, and / or progenitor cells capable of giving rise to both mammary epithelial cells and contractile myoepithelial cells. Mammary epithelial cells are the only cells that produce milk. In some embodiments, the mammary cells include mammary epithelial cells, primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells.

[0045] In some embodiments, the mammary cells are derived from mammalian breast tissue, mammary gland tissue, and / or nipple tissue. In some embodiments, the mammary cells are derived from any mammal, such as a primate (e.g., chimpanzee, orangutan, gorilla, monkey (e.g., Old World monkey, New World monkey), lemur, or human), dog, cat, rabbit, mouse, rat, horse, cow, goat, sheep, ox (e.g., Bos spp.), pig, deer, musk deer, bovid, whale, dolphin, hippopotamus, elephant, rhinoceros, giraffe, zebra, lion, cheetah, tiger, panda, red panda, or otter. In some embodiments, the mammary cells are derived from an endangered species, e.g., a mammal that is at risk of extinction. In some embodiments, the mammary cells are derived from a human. In some embodiments, the mammary cells are derived from a bovine (e.g., dairy cow).

[0046] In some embodiments, a continuous monolayer of viable mammary cells is derived from breast milk-derived stem cells or mammary stem cells derived from a mammary tissue biopsy. The epithelial component of breast milk includes not only mature epithelial cells but also their progenitor and stem cells in culture. A subpopulation of breast milk-derived stem cells exhibits a highly advanced multilineage potential similar to that typical of human embryonic stem cells (hESCs). Mammary stem cells may also be derived from a mammary tissue biopsy and include terminally differentiated MECs. Both breast milk-derived stem cells and mammary stem cells derived from a mammary tissue biopsy are pluripotent cells capable of giving rise to MECs or myoepithelial cells.

[0047] In some embodiments, at least 50% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 55% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 60% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 65% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 70% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 75% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 80% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 85% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 90% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 95% of the mammary cells in the live cell culture are polarized. In some embodiments, at least 100% of the mammary cells in the live cell culture are polarized. In some embodiments, substantially all of the mammary cells of the live cell construct are polarized (i.e., have an apical surface and a basal surface). In some embodiments, substantially all of the mammary cells of the live cell construct are polarized, and substantially all of the polarized cells are oriented in the same direction. For example, in some embodiments, substantially all of the mammary cells have an apical surface and a basal surface, and the apical surfaces of substantially all of the mammary cells are oriented in the same direction and the basal surfaces of substantially all of the mammary cells are oriented in the same direction.

[0048] In some embodiments, the monolayer of mammary epithelial cells has a minimum of 70% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has a minimum of about 75% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has a minimum of about 80% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has a minimum of about 85% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has a minimum of about 90% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has a minimum of about 95% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has a minimum of about 99% confluence across the scaffold. In some embodiments, the monolayer of mammary epithelial cells has 100% confluence across the scaffold.

[0049] Genetic modification of mammary gland cells In some embodiments, the polarized mammary cells comprise a constitutively active prolactin receptor protein. In some embodiments, the mammary cells comprise a constitutively active human prolactin receptor protein. When the primary or immortalized mammary epithelial cells comprise a constitutively active prolactin receptor, the culture medium does not include prolactin.

[0050] In some embodiments, the constitutively active human prolactin receptor protein comprises a deletion of amino acids 9-187, where this numbering is based on the reference amino acid sequence of the human prolactin receptor identified as SEQ ID NO:1.

[0051] SEQ ID NO: 1: Human prolactin receptor (GenBank accession number AAD32032.1)

[0052] [ka]

[0053] In some embodiments, the constitutively active human prolactin receptor protein comprises a deletion of the following amino acids: VFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAA (e.g., amino acids 9-187 of SEQ ID NO: 1).

[0054] In some embodiments, the mammary cells comprise a loss of function mutation introduced into the circadian-related gene PER2. In some embodiments, the loss of function mutation introduced into the circadian-related gene PER2 promotes increased synthesis of a milk component in culture. In some embodiments, the loss of function mutation in the PER2 gene comprises an 87-amino acid deletion from positions 348 to 434 in PER2, where this numbering is based on the reference amino acid sequence of human PER2 identified as SEQ ID NO:2.

[0055] SEQ ID NO: 2: Human periodic circadian protein homolog 2 (GenBank accession number NM022817)

[0056] [ka]

[0057] In some embodiments, the loss of function mutation introduced into PER2 comprises a deletion of the following amino acids: CLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKV (e.g., amino acids 348-434 of SEQ ID NO: 2).

[0058] In some embodiments, the mammary cells comprise a polynucleotide encoding a prolactin receptor comprising a modified intracellular signaling domain. In some embodiments, a loss of function mutation introduced into the circadian-related gene PER2 promotes increased synthesis of individual cultured milk components. In some embodiments, the prolactin receptor comprises a truncation in which position 154 of exon 10 is spliced ​​to the 3' sequence of exon 11. In some embodiments, the prolactin receptor comprises the sequence set forth in SEQ ID NO:3.

[0059] SEQ ID NO: 3: Human isoform 4 of the prolactin receptor (GenBank accession number AF416619; Trott et al. 2003 J. Mol. Endocrinol 3Q(1):31-47)

[0060] [ka]

[0061] In some embodiments, the mammary cells comprise a polynucleotide encoding a modifying (e.g., recombinant) effector of the prolactin protein. In some embodiments, the modifying effector of the prolactin protein comprises a Janus kinase-2 (JAK2) tyrosine kinase domain. In some embodiments, the modifying effector comprises a JAK2 tyrosine kinase domain fused to a signal transducer and activator of transcription 5 (STAT5) tyrosine kinase domain (e.g., a polynucleotide encoding a JAK2 tyrosine kinase domain linked to the 3' end of a polynucleotide encoding a STAT5 tyrosine kinase domain). In some embodiments, the modifying effector of the prolactin protein promotes increased synthesis of individual cultured milk components. In some embodiments, the modifying effector has the sequence set forth in SEQ ID NO:4. The bolded amino acids correspond to the JAK2 kinase domain at amino acids 757-1129 of the reference human JAK2 amino acid sequence.

[0062] SEQ ID NO: 4: STA5A human signal transducer and activator of transcription 5A fused at its 3' end to amino acids 757-1129 of JAK2 human tyrosine-protein kinase

[0063] [ka]

[0064] In some embodiments, the mammary cells are immortalized. In some embodiments, the mammary cells comprise one or more nucleic acids encoding human telomerase reverse transcriptase (hTERT) or simian virus 40 (SV40). In some embodiments, the mammary cells comprise small hairpin RNA (shRNA) against p16 (inhibitor of cyclin-dependent kinase 4) (p16(INK4)) and master regulator of cell cycle entry and proliferative metabolism (c-MYC).

[0065] In some embodiments, the method includes introducing into the cell: (a) a polynucleotide encoding a prolactin receptor comprising a modified intracellular signaling domain, optionally wherein the prolactin receptor comprises a truncation in which position 154 of exon 10 is spliced ​​to sequences 3' of exon 11; (b) a polynucleotide encoding a chimeric prolactin receptor that binds to a ligand and is capable of activating milk synthesis in the absence of prolactin; (c) a polynucleotide encoding a constitutively or conditionally active prolactin receptor protein, optionally comprising a deletion of amino acids 9-187 (e.g., a deletion of amino acids 9-187, where the numbering is based on the reference amino acid sequence of the human prolactin protein identified as SEQ ID NO: 1). (d) introducing polynucleotides encoding modified (recombinant) effectors of prolactin protein, including (i) a Janus kinase-2 (JAK2) tyrosine kinase domain optionally fused to a signal transducer and activator of transcription-5 (STAT5) tyrosine kinase domain (a polynucleotide encoding a JAK2 tyrosine kinase domain linked to the 3' end of a polynucleotide encoding the STAT5 tyrosine kinase domain) and / or (ii) a prolactin receptor intracellular domain fused to a JAK2 tyrosine kinase domain, (e) a loss of function mutation in the circadian-related gene PER2 (periodic circadian protein homolog 2), and / or (f) a polynucleotide encoding one or more glucose transporter genes GLUT1 and / or GLUT12, thereby improving the rate of nutrient uptake at the basal surface of the monolayer.

[0066] scaffold In some embodiments, the living cell construct further comprises a scaffold having a top / exterior surface and a bottom / interior surface. In some embodiments, the scaffold is a two-dimensional surface or a three-dimensional surface (e.g., a micropatterned three-dimensional surface and / or a cylindrical structure assembled into bundles). A non-limiting example of a two-dimensional surface scaffold is a Transwell® filter. In some embodiments, the scaffold is a three-dimensional surface. Non-limiting examples of micropatterned three-dimensional surfaces include microstructured bioreactors, decellularized tissue (e.g., decellularized breast tissue or decellularized plant tissue), micropatterned scaffolds created by casting or three-dimensional printing with biological or biocompatible materials, and textured surfaces. In some embodiments, the scaffold is produced by electrospinning cellulose nanofibers and / or cylindrical structures (e.g., hollow fiber bioreactors) that can be assembled into bundles. In some embodiments, the scaffold is porous. In some embodiments, the scaffold is a 3D scaffold. In some embodiments, a three-dimensional scaffold is any structure with an enclosed hollow lumen / central cavity. In some embodiments, a three-dimensional scaffold is bonded to one or more surfaces to form an enclosed internal chamber / base compartment. For example, a scaffold can be bonded to one or more walls of a bioreactor to form an internal chamber / base compartment. In some embodiments, a scaffold is a hollow fiber bioreactor. In some embodiments, a 3D scaffold is a tube with a central lumen defined by the inner surface of the scaffold. In some embodiments, a 3D scaffold is a hollow sphere with a central lumen defined by the inner surface of the scaffold.

[0067] For in vitro culture methods of intestinal absorption studies, two-dimensional surface scaffolds such as Transwells® have long been the standard because they provide both apical and basolateral spaces to simulate the blood-gut barrier and allow for active and passive transport of drugs and nutrients. However, cells plated on flat supports present significantly different phenotypes to cells in vivo, due in part to a poor representation of the 3-D extracellular microenvironment.

[0068] Three-dimensional scaffolds allow mammary cells (e.g., MECs) to grow and interact with their surroundings in all three dimensions. Unlike 2D environments, 3D cell culture allows in vitro cells to grow in all directions, approximating the in vivo mammary gland environment. Furthermore, 3D scaffolds allow for a larger surface area for cell culture, metabolism, and gas exchange, as well as the necessary compartmentalization, i.e., allowing cultured dairy products to be secreted into one compartment while cell culture medium contacts mammary cells in another compartment. To date, a confluent monolayer with polarized separation of the basal and apical cell surfaces using mammary epithelial cells on a 3D surface has not been achieved (Sharfstein et al. 1992).

[0069] In some embodiments, the scaffold is porous. In some embodiments, the scaffold is permeable to cell culture media, allowing the cell culture media to contact the cells of the cell monolayer. In some embodiments, the scaffold is perforated with at least one pore that allows the cell culture media to contact the basal surface of the cells of the cell monolayer.

[0070] In some embodiments, the top / external surface of the scaffold is covered with a matrix material. In some embodiments, the matrix is ​​composed of one or more extracellular matrix proteins. Non-limiting examples of extracellular matrix proteins include collagen, laminin, entactin, tenascin, and / or fibronectin. In some embodiments, the scaffold comprises a composite derived from natural polymers, biocompatible synthetic polymers, synthetic peptides, and / or any combination thereof. In some embodiments, natural polymers useful in the present invention include, but are not limited to, collagen, chitosan, cellulose, agarose, alginate, gelatin, elastin, heparan sulfate, chondroitin sulfate, keratan sulfate, and / or hyaluronic acid. In some embodiments, biocompatible synthetic polymers useful in the present invention include, but are not limited to, cellulose, polysulfone, polyvinylidene fluoride, polyethylene-co-vinyl acetate, polyvinyl alcohol, sodium polyacrylate, acrylic acid polymers, and / or polyethylene glycol. In some embodiments, the top of the scaffold is covered with laminin and collagen.

[0071] In some embodiments, the matrix material is porous. In some embodiments, the matrix material is permeable to cell culture medium, allowing the cell culture medium to contact the cells of the cell monolayer. In some embodiments, the matrix material is perforated with at least one pore that allows the cell culture medium to contact the basal surface of the cells in the cell monolayer.

[0072] In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.1 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.2 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.3 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.4 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.5 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.6 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.7 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.8 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 0.9 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.0 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.1 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.2 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.3 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.4 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.5 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.6 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.7 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.8 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 1.9 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.0 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.1 μm, hi some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.2 μm.In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.2 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.3 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.4 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.5 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.6 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.7 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.8 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 2.9 μm. In some embodiments, the pore size of the scaffold and / or matrix material is at least about 3.0 μm.

[0073] In some embodiments, the live cell construct comprises a scaffold having a top / exterior surface and a bottom / interior surface, and a continuous monolayer of (a) live primary mammary epithelial cells, (b) a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or (c) live immortalized mammary epithelial cells on the top surface of the scaffold, wherein the (a) live primary mammary epithelial cells, (b) a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or (c) live The continuous monolayer of live, immortalized mammary epithelial cells has an apical surface and a basal surface (e.g., the cells are polarized and form a confluent cell monolayer), and the live cell construct comprises (a) live primary mammary epithelial cells, (b) a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or (c) an apical compartment above and adjacent to the apical surface of the continuous monolayer of live, immortalized mammary epithelial cells, and a basal compartment below and adjacent to the bottom surface of the scaffold.

[0074] Bioreactor Disclosed herein, in an embodiment, is a bioreactor comprising: (a) an apical compartment containing a cultured dairy product; and (b) at least one living cell construct comprising: (i) a three-dimensional scaffold having an exterior surface, an interior surface defining a lumen / basal chamber, and a plurality of pores extending from the interior surface to the exterior surface; (ii) a matrix material disposed on the exterior surface of the three-dimensional scaffold; (iii) a culture medium disposed within the lumen / basal chamber and in fluid contact with the interior surface; and (iv) a minimum 70% confluent monolayer of polarized mammary cells disposed on the matrix material, wherein the mammary cells are selected from the group consisting of live primary mammary epithelial cells, live mammary myoepithelial cells, live mammary progenitor cells, live immortalized mammary epithelial cells, live immortalized mammary myoepithelial cells, and live immortalized mammary progenitor cells, wherein the apical surface of the mammary cells is in fluid contact with the apical compartment.

[0075] In some embodiments, the bioreactor is a closed bioreactor. In some embodiments, the apical chamber is substantially isolated from the luminal / basal chamber.

[0076] A hollow fiber bioreactor is an exemplary bioreactor for use in the methods disclosed herein. A hollow fiber bioreactor is a high-density, continuous perfusion culture system that closely resembles the environment in which cells grow in vivo. The system consists of thousands of semi-permeable 3D scaffolds (i.e., hollow fibers) in a parallel array within a cartridge shell that fits into inlet and outlet ports. These fiber bundles are potted or sealed at each end, so that any fluid entering the end of the cartridge is forced to flow through the interior of the fibers. Cells are seeded outside the fibers within the cartridge, typically in the excess capillary space (ECS).

[0077] Hollow fiber cell cultures are differentiated from other methods by three fundamental features: (1) cells are attached in vivo to a porous matrix rather than to a plastic dish, microcarrier, or other impermeable support; (2) the molecular weight shed from the support matrix can be controlled; and (3) a very high surface area-to-volume ratio (150 cm per mL). 2 (above) provide a large area for metabolic and gas exchange for efficient growth of the host cells.

[0078] The bioreactor architecture provides a fiber matrix that allows permeation of nutrients, gases, and other basic media components, as well as cell waste products, but is impermeable to the cells, allowing cells to expand. Hollow fiber bioreactor technology has been used to obtain high-density cell expansion by utilizing hollow fibers to create a semi-permeable barrier between the cell growth chamber and the media flow. The large surface area afforded by this design allows for the production of large numbers of cells using the fibers as a culture substrate. Cells growing in a three-dimensional environment within the bioreactor are bathed in fresh media perfused through the hollow fibers.

[0079] To recreate the intestinal topography, Costello et al. developed a 3-D printed bioreactor capable of incorporating both porous villous scaffolds via micromolding (Costello et al. 2017 Scientific Reports 7(12515):1-10). This geometrically complex scaffold separated the apical and basolateral spaces, allowing intestinal epithelial cells to be exposed to physiologically relevant shear stress via fluid flow (Costello et al. 2017). Similarly, Morada et al. demonstrated long-term in vitro culture in a gut-like environment using a hollow fiber bioreactor, which allowed two controlled, separate environments (biphasic) to provide oxygen and nutrients to host cells from the basal layer while simultaneously developing a hypoxic, nutrient-rich environment at the apical surface (Morada et al. 2016 International Journal for Parasitology 26:21-29).

[0080] When configuring a hollow fiber bioreactor, there are design considerations and parameters that can be varied depending on the goals related to cell expansion. One such design consideration is the pore size of the fiber wall. The pore size is designed to generally allow nutrients to pass to the cells, carry away waste products, provide desired products (e.g., growth factors) to the cells, remove desired products from the cells, and exclude certain factors that may prevent them from reaching the cells. Thus, the pore size of the fiber wall can be varied to modify which components pass through the fiber wall. For example, the pore size can allow the passage of large proteinaceous molecules, including growth factors, including, but not limited to, epidermal growth factor and platelet-derived growth factor. Those skilled in the art will understand how to vary the pore size depending on the components desired to pass through the fiber wall to reach the cells or transport materials from the cells.

[0081] In some embodiments, the pore size is about 0.2 μm. In some embodiments, the pore size is about 0.1 μm. In some embodiments, the pore size is about 0.2 μm. In some embodiments, the pore size is about 0.3 μm. In some embodiments, the pore size is about 0.4 μm. In some embodiments, the pore size is about 0.5 μm. In some embodiments, the pore size is about 0.6 μm. In some embodiments, the pore size is about 0.7 μm. In some embodiments, the pore size is about 0.8 μm. In some embodiments, the pore size is about 0.9 μm. In some embodiments, the pore size is about 1.0 μm. In some embodiments, the pore size is about 1.1 μm. In some embodiments, the pore size is about 1.2 μm. In some embodiments, the pore size is about 1.3 μm. In some embodiments, the pore size is about 1.4 μm. In some embodiments, the pore size is about 1.5 μm. In some embodiments, the pore size is about 1.6 μm. In some embodiments, the pore size is about 1.7 μm. In some embodiments, the pore size is about 1.8 μm. In some embodiments, the pore size is about 1.9 μm. In some embodiments, the pore size is about 2.0 μm. In some embodiments, the pore size is about 2.1 μm. In some embodiments, the pore size is about 2.2 μm. In some embodiments, the pore size is about 2.2 μm. In some embodiments, the pore size is about 2.3 μm. In some embodiments, the pore size is about 2.4 μm. In some embodiments, the pore size is about 2.5 μm. In some embodiments, the pore size is about 2.6 μm. In some embodiments, the pore size is about 2.7 μm. In some embodiments, the pore size is about 2.8 μm. In some embodiments, the pore size is about 2.9 μm. In some embodiments, the pore size is about 3.0 μm.

[0082] Method for producing living cell constructs In certain embodiments disclosed herein are methods for producing living cell constructs for producing cultured dairy products. In some embodiments, the method comprises: (a) isolating primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells from mammary tissue (e.g., breast tissue, mammary gland tissue, nipple tissue), a biopsy sample, or a mammary explant derived from raw breast milk to produce isolated mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells; (b) culturing the isolated primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells to produce a mixed population of primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells; and (c) culturing the mixed population of (b) on a scaffold having an upper and lower surface to produce a polarized monolayer of the mixed population of primary mammary epithelial cells, myoepithelial cells, and mammary progenitor cells on the upper surface of the scaffold, thereby producing a living cell construct for producing a cultured dairy product, wherein the polarized monolayer comprises an apical surface and a basal surface.

[0083] In some embodiments, the method comprises (a) isolating primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells from mammary tissue (e.g., breast tissue, mammary gland tissue, nipple tissue), a biopsy sample, or a mammary explant derived from raw breast milk to produce isolated mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells; and (b) culturing the isolated primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells to produce a mixed population of primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells. (c) sorting the mixed population of primary mammary epithelial cells, myoepithelial cells, and / or mammary progenitor cells (e.g., selecting primary mammary epithelial cells) to produce a population of primary mammary epithelial cells; and (d) culturing the population of primary mammary epithelial cells on a scaffold having an upper and lower surface to produce a polarized monolayer of primary mammary epithelial cells on the upper surface of the scaffold, thereby producing a live cell construct for producing a dairy product in culture, wherein the polarized monolayer comprises an apical surface and a basal surface.

[0084] In some embodiments, the method comprises: (a) culturing immortalized mammary epithelial cells to expand the number of immortalized mammary epithelial cells; and (b) culturing the immortalized mammary epithelial cells of (a) on a scaffold having an upper and lower surface to produce a polarized monolayer of immortalized mammary epithelial cells on the upper surface of the scaffold, thereby producing a living cell construct for producing a cultured dairy product, wherein the polarized monolayer comprises an apical surface and a basal surface.

[0085] In some embodiments, culturing and / or growing the mammary cells to obtain live cell constructs is carried out at a temperature of about 35°C to about 39°C (e.g., about 35°C, 35.5°C, 36°C, 36.5°C, 37°C, 37.5°C, 38°C, 38.5°C, or about 39°C, or any value or range therein, e.g., a temperature of about 35°C to about 38°C, about 36°C to about 39°C, about 36.5°C to about 39°C, about 36.5°C to about 37.5°C, or about 36.5°C to about 38°C). In some embodiments, culturing and / or growing is carried out at a temperature of about 37°C.

[0086] In some embodiments, culturing and / or culturing the mammary cells to obtain live cell constructs is performed at an atmospheric CO concentration of about 4% to about 6%, e.g., about 4%, 4.25%, 4.5%, 4.75%, 5%, 5.25%, 5.5%, 5.75%, or 6%, or any value or range therein, e.g., about 4% to about 5.5%, about 4.5% to about 6%, about 4.5% to about 5.5%, or about 5% to about 6%. In some embodiments, culturing and / or culturing is performed at an atmospheric CO concentration of about 5%.

[0087] In some embodiments, culturing and / or culturing mammary cells to obtain live cell constructs comprises culturing and / or culturing in culture medium that is changed about every day to about every 10 days (e.g., every 1 day, every 2 days, every 3 days, every 4 days, every 5 days, every 6 days, every 7 days, every 8 days, every 9 days, every 10 days, or any value or range therein, e.g., about every day to every 3 days, about every 3 days to every 10 days, about every 2 days to every 5 days). In some embodiments, culturing and / or growing further comprises culturing in a culture medium that is changed about every day to about every few hours to about every 10 days, e.g., about every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 hours to about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, or any value or range therein. For example, in some embodiments, culturing and / or growing further comprises culturing in a culture medium that is changed about every 12 hours to about every 10 days, about every 10 hours to about every 5 days, or about every 5 hours to about every 3 days.

[0088] In some embodiments, the living cell constructs are stored in a freezer or liquid nitrogen. The storage temperature depends on the desired storage period. For example, freezer temperatures (e.g., from about 0°C to about -80°C or lower, e.g., about 0°C, -10°C, -20°C, -30°C, -40°C, -50°C, -60°C, -70°C, -80°C, -90°C, -100°C, or any value or range therein) may be used if the cells are to be used within 6 months (e.g., within 1, 2, 3, 4, 5, or 6 months). For example, liquid nitrogen may be used at temperatures below -100°C (e.g., below about -100°C, -110°C, -120°C, -130, -140, -150, -160, -170, -180, -190°C, -200°C) for long-term storage (e.g., 6 months or more, e.g., 6, 7, 8, 9, 10, 11, or 12 months, or 1, 2, 3, 4, 5, 6 years or more).

[0089] In some embodiments, mammary cells are isolated and sorted by fluorescence-activated cell sorting, magnetic-activated cell sorting, and / or microfluidic cell sorting.

[0090] Basal culture medium and lactogenic medium In some embodiments, the culture medium comprises a carbon source, a chemical buffer system, one or more essential amino acids, one or more vitamins, and / or cofactors, and one or more inorganic salts, hi some embodiments, the carbon source, the chemical buffer system, the one or more essential amino acids, one or more vitamins, and / or cofactors, and / or one or more inorganic salts are food grade.

[0091] In some embodiments, the culture medium is a lactogenic culture medium. In some embodiments, the culture medium further comprises prolactin (e.g., mammalian prolactin, e.g., human prolactin), linoleic acid, α-linoleic acid, estrogen, and / or progesterone. For example, in some embodiments, the culture medium comprises (or is supplemented with) prolactin in an amount of about 20 ng / mL to about 200 ng / L of culture medium, e.g., about 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 ng / mL, or any value or range therein. In some embodiments, the culture medium contains (or is supplemented with) prolactin in an amount of about 20 ng / mL to about 195 ng / L, about 50 ng / mL to about 150 ng / mL, about 25 ng / mL to about 175 ng / mL, about 45 ng / mL to about 200 ng / L, or about 75 ng / mL to about 190 ng / L of culture medium. In some embodiments, the culture medium further contains other factors, including but not limited to, insulin, epidermal growth factor, and / or hydrocortisone, to improve efficiency.

[0092] In some embodiments, the culture medium comprises a carbon source in an amount of about 1 g / L to about 15 g / L of culture medium (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 g / L, or any value or range therein), or in an amount of about 1, 2, 3, 4, 5, or 6 g / L to about 7, 8, 9, 10, 11, 12, 13, 14, or 15 g / L of culture medium. Non-limiting examples of carbon sources include glucose and / or pyruvate. For example, in some embodiments, the culture medium comprises glucose in an amount of about 1 g / L to about 12 g / L of culture medium, e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 g / L, or any value or range therein. In some embodiments, the culture medium comprises glucose in an amount of about 1 g / L to about 6 g / L, about 4 g / L to about 12 g / L, about 2.5 g / L to about 10.5 g / L, about 1.5 g / L to about 11.5 g / L, or about 2 g / L to about 10 g / L of culture medium. In some embodiments, the culture medium comprises glucose in an amount of about 1, 2, 3, or 4 g / L to about 5, 6, 7, 8, 9, 10, 11, or 12 g / L, or about 1, 2, 3, 4, 5, or 6 g / L to about 7, 8, 9, 10, 11, or 12 g / L. In some embodiments, the culture medium comprises pyruvate in an amount of about 5 g / L to about 15 g / L of culture medium, e.g., about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 g / L, or any value or range therein. In some embodiments, the culture medium comprises pyruvate in an amount of about 5 g / L to about 14.5 g / L, about 10 g / L to about 15 g / L, about 7.5 g / L to about 10.5 g / L, about 5.5 g / L to about 14.5 g / L, or about 8 g / L to about 10 g / L of culture medium. In some embodiments, the culture medium comprises pyruvate in an amount of about 5, 6, 7, or 8 g / L to about 9, 10, 11, 12, 13, 14, or 15 g / L, or about 5, 6, 7, 8, 9, or 10 g / L to about 11, 12, 13, 14, or 15 g / L.

[0093] In some embodiments, the culture medium comprises a chemical buffer system in an amount of about 1 g / L to about 4 g / L (e.g., about 1, 1.5, 2, 2.5, 3, 3.5, or 4 g / L, or any value or range therein), or about 10 mM to about 25 mM (e.g., about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 mM, or any value or range therein) of culture medium. In some embodiments, the chemical buffer system includes, but is not limited to, sodium bicarbonate and / or 4-(2-hydroxyethyl)-l-piperazineethanesulfonic acid (HEPES). For example, in some embodiments, the culture medium comprises sodium bicarbonate in an amount of about 1 g / L to about 4 g / L of culture medium, e.g., about 1, 1.5, 2, 2.5, 3, 3.5, or 4 g / L, or any value or range therein. In some embodiments, the culture medium comprises sodium bicarbonate in an amount of about 1 g / L to about 3.75 g / L, about 1.25 g / L to about 4 g / L, about 2.5 g / L to about 3 g / L, about 1.5 g / L to about 4 g / L, or about 2 g / L to about 3.5 g / L of culture medium. In some embodiments, the culture medium comprises HEPES in an amount of about 10 mM to about 25 mM, e.g., about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 mM, or any value or range therein. In some embodiments, the culture medium comprises HEPES in an amount of about 11 mM to about 25 mM, about 10 mM to about 20 mM, about 12.5 mM to about 22.5 mM, about 15 mM to about 20.75 mM, or about 10 mM to about 20 mM.

[0094] In some embodiments, the culture medium comprises one or more essential amino acids in an amount of about 0.5 mM to about 5 mM (e.g., about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM, or any value or range therein), or about 0.5, 1, 1.5, 2 mM to about 2.5, 3, 3.5, 4, 4.5, or 5 mM. In some embodiments, the one or more essential amino acids are histidine, isoleucine, leucine, lysine, methionine, phenylalanine, threonine, tryptophan, valine, and / or arginine. For example, in some embodiments, the culture medium comprises arginine in an amount of about 0.5 mM to about 5 mM, e.g., about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM, or any value or range therein. In some embodiments, the culture medium comprises an essential amino acid in an amount of about 0.5 mM to about 4.75 mM, about 2 mM to about 3.5 mM, about 0.5 mM to about 3.5 mM, about 1 mM to about 5 mM, or about 3.5 mM to about 5 mM.

[0095] In some embodiments, the culture medium comprises a soluble ... 50 μM, or any value or range therein), or about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 3, 4, 5, 6 μM, or about 0.02, 0.025, 0.05, 0.075, 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10 μM to about 12.5, 15, 17.5, 20, 25, 30, 35, 40, 45, 46, 47, 48, 49, 49.025, 49.05, 49.075, or 50 μM. In some embodiments, the one or more vitamins and / or cofactors include, but are not limited to, thiamine and / or riboflavin. For example, in some embodiments, the culture medium contains thiamine in an amount of about 0.025 μM to about 50 μM, e.g., about 0.025, 0.05, 0.075, 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12.5, 15, 17.5, 20, 25, 30, 35, 40, 45, 46, 47, 48, 49, 49.025, 49.05, 49.075, or 50 μM, or any value or range therein. In some embodiments, the culture medium comprises thiamine in an amount of about 0.025 μM to about 45.075 μM, about 1 μM to about 40 μM, about 5 μM to about 35.075 μM, about 10 μM to about 50 μM, or about 0.05 μM to about 45.5 μM.In some embodiments, the culture medium comprises riboflavin in an amount from about 0.01 μM to about 3 μM, e.g., about 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 μM, or any value or range therein. In some embodiments, the culture medium comprises riboflavin in an amount of about 0.01 μM to about 2.05 μM, about 1 μM to about 2.95 μM, about 0.05 μM to about 3 μM, about 0.08 μM to about 1.55 μM, or about 0.05 μM to about 2.9 μM.

[0096] In some embodiments, the culture medium comprises one or more inorganic salts in an amount of about 100 mg / L to about 150 mg / L of culture medium (e.g., about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg / L, or any value or range therein), or about 100 mg / L to about 150 mg / L of culture medium (e.g., about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg / L, or any value or range therein). In some embodiments, the one or more inorganic salts include, but are not limited to, calcium and / or magnesium. For example, in some embodiments, the culture medium comprises calcium in an amount of about 100 mg / L to about 150 mg / L of culture medium, e.g., about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg / L, or any value or range therein. In some embodiments, the culture medium comprises arginine in an amount of about 100 mg / L to about 125 mg / L, about 105 mg / L to about 150 mg / L, about 120 mg / L to about 130 mg / L, or about 100 mg / L to about 145 mg / L of culture medium. In some embodiments, the culture medium comprises magnesium in an amount of about 0.01 mM to about 1 mM, e.g., about 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 0.91, 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99, or 1 mM, or any value or range therein. In some embodiments, the culture medium comprises magnesium in an amount of about 0.05 mM to about 1 mM, about 0.01 mM to about 0.78 mM, about 0.5 mM to about 1 mM, about 0.03 mM to about 0.75 mM, or about 0.25 mM to about 0.95 mM.

[0097] In some embodiments, the culture medium comprises a carbon source in an amount of about 1 g / L to about 15 g / L of culture medium (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 g / L, or any value or range therein), or in an amount of about 1, 2, 3, 4, 5, or 6 g / L to about 7, 8, 9, 10, 11, 12, 13, 14, or 15 g / L of culture medium. In some embodiments, the carbon source includes, but is not limited to, glucose and / or pyruvate. For example, in some embodiments, the culture medium comprises glucose in an amount of about 1 g / L to about 12 g / L of culture medium, e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 g / L, or any value or range therein. In some embodiments, the culture medium comprises glucose in an amount between about 1 g / L and about 6 g / L, between about 4 g / L and about 12 g / L, between about 2.5 g / L and about 10.5 g / L, between about 1.5 g / L and about 11.5 g / L, or between about 2 g / L and about 10 g / L of culture medium. In some embodiments, the culture medium comprises pyruvate in an amount between about 5 g / L and about 15 g / L of culture medium, e.g., about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 g / L, or any value or range therein. In some embodiments, the culture medium comprises pyruvate in an amount of about 5 g / L to about 14.5 g / L, about 10 g / L to about 15 g / L, about 7.5 g / L to about 10.5 g / L, about 5.5 g / L to about 14.5 g / L, or about 8 g / L to about 10 g / L of culture medium.

[0098] In some embodiments, the culture medium comprises a chemical buffer system in an amount of about 1 g / L to about 4 g / L of culture medium (e.g., about 1, 1.5, 2, 2.5, 3, 3.5, or 4 g / L, or any value or range therein), or about 10 mM to about 25 mM (e.g., about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 mM, or any value or range therein). In some embodiments, the chemical buffer system includes, but is not limited to, sodium bicarbonate and / or HEPES. For example, in some embodiments, the culture medium comprises sodium bicarbonate in an amount of about 1 g / L to about 4 g / L of culture medium, e.g., about 1, 1.5, 2, 2.5, 3, 3.5, or 4 g / L, or any value or range therein. In some embodiments, the culture medium comprises sodium bicarbonate in an amount of about 1 g / L to about 3.75 g / L, about 1.25 g / L to about 4 g / L, about 2.5 g / L to about 3 g / L, about 1.5 g / L to about 4 g / L, or about 2 g / L to about 3.5 g / L of culture medium. In some embodiments, the culture medium comprises HEPES in an amount of about 10 mM to about 25 mM, e.g., about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 mM, or any value or range therein. In some embodiments, the culture medium comprises HEPES in an amount of about 1 mM to about 25 mM, about 10 mM to about 20 mM, about 12.5 mM to about 22.5 mM, about 15 mM to about 20.75 mM, or about 10 mM to about 20 mM.

[0099] In some embodiments, the culture medium comprises one or more essential amino acids in an amount of about 0.5 mM to about 5 mM (e.g., about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM, or any value or range therein), or about 0.5, 1, 1.5, 2 mM to about 2.5, 3, 3.5, 4, 4.5, or 5 mM. In some embodiments, the one or more essential amino acids are arginine and / or cysteine. For example, in some embodiments, the culture medium comprises arginine in an amount of about 0.5 mM to about 5 mM, e.g., about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM, or any value or range therein. In some embodiments, the culture medium contains arginine in an amount of about 0.5 mM to about 4.75 mM, about 2 mM to about 3.5 mM, about 0.5 mM to about 3.5 mM, about 1 mM to about 5 mM, or about 3.5 mM to about 5 mM. For example, in some embodiments, the culture medium contains cysteine ​​in an amount of about 0.5 mM to about 5 mM, e.g., about 0.5, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, or 5 mM, or any value or range therein. In some embodiments, the culture medium contains cysteine ​​in an amount of about 0.5 mM to about 4.75 mM, about 2 mM to about 3.5 mM, about 0.5 mM to about 3.5 mM, about 1 mM to about 5 mM, or about 3.5 mM to about 5 mM.

[0100] In some embodiments, the culture medium comprises a soluble ... 50 μM, or any value or range therein), or about 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 3, 4, 5, 6 μM, or about 0.02, 0.025, 0.05, 0.075, 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10 μM to about 12.5, 15, 17.5, 20, 25, 30, 35, 40, 45, 46, 47, 48, 49, 49.025, 49.05, 49.075, or 50 μM. In some embodiments, the one or more vitamins and / or cofactors include, but are not limited to, thiamine and / or riboflavin. For example, in some embodiments, the culture medium contains thiamine in an amount of about 0.025 μM to about 50 μM, e.g., 0.025, 0.05, 0.075, 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12.5, 15, 17.5, 20, 25, 30, 35, 40, 45, 46, 47, 48, 49, 49.025, 49.05, 49.075, or 50 μM, or any value or range therein. In some embodiments, the culture medium comprises thiamine in an amount of about 0.025 μM to about 45.075 μM, about 1 μM to about 40 μM, about 5 μM to about 35.075 μM, about 10 μM to about 50 μM, or about 0.05 μM to about 45.5 μM.In some embodiments, the culture medium comprises riboflavin in an amount of about 0.01 μM to about 3 μM, e.g., 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, or 3 μM, or any value or range therein. In some embodiments, the culture medium comprises riboflavin in an amount of about 0.01 μM to about 2.05 μM, about 1 μM to about 2.95 μM, about 0.05 μM to about 3 μM, about 0.08 μM to about 1.55 μM, or about 0.05 μM to about 2.9 μM.

[0101] In some embodiments, the culture medium comprises one or more inorganic salts in an amount of about 100 mg / L to about 150 mg / L of culture medium (e.g., about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg / L, or any value or range therein), or about 100 mg / L to about 150 mg / L of culture medium (e.g., about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg / L, or any value or range therein). In some embodiments, an exemplary one or more inorganic salts is calcium and / or magnesium. For example, in some embodiments, the culture medium comprises calcium in an amount of about 100 mg / L to about 150 mg / L of culture medium, e.g., about 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg / L, or any value or range therein. In some embodiments, the culture medium comprises arginine in an amount of about 100 mg / L to about 125 mg / L, about 105 mg / L to about 150 mg / L, about 120 mg / L to about 130 mg / L, or about 100 mg / L to about 145 mg / L of culture medium. In some embodiments, the culture medium comprises magnesium in an amount of about 0.01 mM to about 1 mM, e.g., about 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 0.91, 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99, or 1 mM, or any value or range therein. In some embodiments, the culture medium comprises magnesium in an amount of about 0.05 mM to about 1 mM, about 0.01 mM to about 0.78 mM, about 0.5 mM to about 1 mM, about 0.03 mM to about 0.75 mM, or about 0.25 mM to about 0.95 mM.

[0102] In some embodiments, the carbon source, chemical buffer system, one or more essential amino acids, one or more vitamins and / or cofactors, and / or one or more inorganic salts are food grade.

[0103] In some embodiments, the culture medium is a lactogenic culture medium, e.g., the culture medium further comprises prolactin (e.g., mammalian prolactin, e.g., human prolactin). For example, in some embodiments, the culture medium comprises (or is supplemented with) prolactin in an amount of about 20 ng / mL to about 200 ng / L of culture medium, e.g., about 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 ng / mL, or any value or range therein. In some embodiments, the culture medium contains (or is supplemented with) prolactin in an amount of about 20 ng / mL to about 195 ng / L, about 50 ng / mL to about 150 ng / mL, about 25 ng / mL to about 175 ng / mL, about 45 ng / mL to about 200 ng / L, or about 75 ng / mL to about 190 ng / L of culture medium. In some embodiments, the method further comprises providing a lactogenic culture medium by supplementing the culture medium with prolactin. In some embodiments, the prolactin is produced by microbial cells and / or human cells expressing recombinant prolactin (e.g., prolactin comprising a substitution of aspartate for serine at position 179 of the prolactin gene (S179D), e.g., S179D-prolactin). In some embodiments, adding prolactin to the culture medium comprises conditioning the culture medium by culturing cells that express and secrete prolactin, and applying the conditioned culture medium containing prolactin to the basal surface of primary mammary epithelial cells, the basal surface of a monolayer of a mixed population, or the basal surface of a monolayer of live immortalized mammary epithelial cells.

[0104] In some embodiments, the culture medium further comprises other factors, including but not limited to, insulin, epidermal growth factor, and / or hydrocortisone, to improve efficiency. In some embodiments, the methods of the invention further comprise applying other factors (e.g., insulin, epidermal growth factor, and / or hydrocortisone) to the culture medium, e.g., to improve efficiency.

[0105] Methods for producing cultured dairy products Disclosed herein in certain embodiments are methods for producing a cultured dairy product. In some embodiments, the methods comprise culturing the living cell constructs disclosed herein in a bioreactor comprising a basal compartment and an apical compartment, wherein the basal compartment comprises a culture medium and the mammary cells secrete the cultured dairy product into the apical compartment.

[0106] In some embodiments, the live cell construct comprises a scaffold comprising an upper surface and a lower surface, a polarized continuous monolayer of live primary mammary epithelial cells, a polarized continuous monolayer of a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or a polarized continuous monolayer of live immortalized mammary epithelial cells having an apical surface and a basal surface, wherein the polarized continuous monolayer of live primary mammary epithelial cells, the polarized continuous monolayer of a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or the polarized continuous monolayer of live immortalized mammary epithelial cells is located on the upper surface of the scaffold.

[0107] In some embodiments, the lower surface of the scaffold is adjacent to the basal compartment. In some embodiments, the apical surface of the polarized continuous monolayer of live primary mammary epithelial cells, the polarized continuous monolayer of a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, and / or the polarized continuous monolayer of live immortalized mammary epithelial cells is adjacent to the apical compartment. In some embodiments, the polarized continuous monolayer of live primary mammary epithelial cells, the polarized continuous monolayer of a mixed population of live primary mammary epithelial cells, mammary myoepithelial cells, and mammary progenitor cells, or the polarized continuous monolayer of immortalized mammary epithelial cells secretes milk into the apical compartment via its apical surface, thereby producing milk in culture.

[0108] In some embodiments, a polarized monolayer of mammary epithelial cells forms a barrier dividing the apical and basal compartments, with the basal surfaces of the mammary cells attached to the scaffold and the apical surfaces oriented towards the apical compartment.

[0109] In some embodiments, the basal compartment is adjacent to the lower surface of the scaffold. In some embodiments, the basal compartment comprises culture medium in fluid contact with the basal surface of a polarized monolayer of mammary epithelial cells (e.g., a polarized monolayer of primary mammary epithelial cells, a polarized monolayer of a mixed population, or a polarized monolayer of live immortalized mammary epithelial cells).

[0110] In some embodiments, the culture medium comprises a carbon source, a chemical buffer system, one or more essential amino acids, one or more vitamins and / or cofactors, and one or more inorganic salts.

[0111] In some embodiments, the bioreactor comprises an apical compartment adjacent to the apical surface of the monolayer, hi some embodiments, the apical compartment is adjacent to the upper surface of the scaffold.

[0112] In some embodiments, the total cell density of the mammary cells in the bioreactor is at least 10 11 In some embodiments, the total cell density of the mammary gland cells in the bioreactor is at least 10 12 In some embodiments, the total cell density of the mammary gland cells in the bioreactor is at least 10 13 are mammary gland cells.

[0113] In some embodiments, the total cell density of the mammary cells in the bioreactor is 100 μm 2 In some embodiments, the total cell density of the mammary gland cells in the bioreactor is about 20-55 cells per 100 μm. 2 In some embodiments, the total cell density of the mammary cells in the bioreactor is about 20 cells per 100 μm. 2 In some embodiments, the total cell density of the mammary cells in the bioreactor is 25 cells per 100 μm. 2 In some embodiments, the total cell density of the mammary cells in the bioreactor is about 30 cells per 100 μm. 2 In some embodiments, the total cell density of the mammary cells in the bioreactor is about 35 cells per 100 μm. 2In some embodiments, the total cell density of the mammary cells in the bioreactor is about 40 cells per 100 μm. 2 In some embodiments, the total cell density of the mammary cells in the bioreactor is about 45 cells per 100 μm. 2 In some embodiments, the total cell density of the mammary cells in the bioreactor is about 50 cells per 100 μm. 2 Approximately 55 cells per

[0114] In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 1.5 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 2 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 2.5 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 3 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 4 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 5 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 10 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 15 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 20 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 25 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 50 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 100 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 250 m 2 In some embodiments, the total surface area of ​​the mammary cells in the bioreactor is at least about 500 m2 is.

[0115] In some embodiments, the bioreactor maintains a temperature of about 27°C to about 39°C (e.g., about 27°C, 28°C, 29°C, 30°C, 31°C, 32°C, 33°C, 34°C, 35°C, 35°C, 35.5°C, 36°C, 36.5°C, 37°C, 37.5°C, 38°C, 38.5°C, or about 39°C, or any value or range therein, e.g., about 27°C to about 38°C, about 36°C to about 39°C, about 36.5°C to about 39°C, about 36.5°C to about 37.5°C, or about 36.5°C to about 38°C). In some embodiments, the bioreactor maintains a temperature of about 37°C.

[0116] In some embodiments, the bioreactor has an atmospheric CO2 concentration of about 4% to about 6%, e.g., the atmospheric CO2 concentration is about 4%, 4.25%, 4.5%, 4.75%, 5%, 5.25%, 5.5%, 5.75%, or 6%, or any value or range therein, e.g., about 4% to about 5.5%, about 4.5% to about 6%, about 4.5% to about 5.5%, or about 5% to about 6%. In some embodiments, the bioreactor has an atmospheric CO2 concentration of about 5%.

[0117] In some embodiments, the bioreactor has an atmospheric CO2 concentration of about 4% to about 6%, e.g., the atmospheric CO2 concentration is about 4%, 4.25%, 4.5%, 4.75%, 5%, 5.25%, 5.5%, 5.75%, or 6%, or any value or range therein, e.g., about 4% to about 5.5%, about 4.5% to about 6%, about 4.5% to about 5.5%, or about 5% to about 6%. In some embodiments, the bioreactor has an atmospheric CO2 concentration of about 5%.

[0118] In some embodiments, the method includes monitoring the concentrations of dissolved O and CO. In some embodiments, the concentration of dissolved O is maintained between about 10% and about 25%, or any value or range therein (e.g., about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25%). For example, in some embodiments, the concentration of dissolved O is maintained between about 12% and about 25%, between about 15% and about 22%, between about 10% and about 20%, about 15%, about 20%, or about 22%. In some embodiments, the CO2 concentration is maintained between about 4% and about 6%, e.g., the CO2 concentration is about 4%, 4.25%, 4.5%, 4.75%, 5%, 5.25%, 5.5%, 5.75%, or 6%, or any value or range therein, e.g., about 4% to about 5.5%, about 4.5% to about 6%, about 4.5% to about 5.5%, or about 5% to about 6%. In some embodiments, the CO2 concentration is maintained at about 5%.

[0119] In some embodiments, the culture medium is changed about every day to about every 10 days (e.g., every 1 day, every 2 days, every 3 days, every 4 days, every 5 days, every 6 days, every 7 days, every 8 days, every 9 days, every 10 days, or any value or range therein, e.g., about every day to every 3 days, about every 3 days to every 10 days, about every 2 days to every 5 days). In some embodiments, the culture medium is changed about every day to about every few hours to about every 10 days, e.g., about every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 hours to about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days, or any value or range therein. For example, in some embodiments, the culture medium is changed about every 12 hours to about every 10 days, about every 10 hours to about every 5 days, or about every 5 hours to about every 3 days.

[0120] In some embodiments, the method includes monitoring the glucose concentration and / or glucose consumption rate in the culture medium and / or lactogenic culture medium. In some embodiments, prolactin is added when the glucose consumption rate in the culture medium is at steady state.

[0121] In some embodiments, the method further comprises applying transepithelial electrical resistance (TEER) to measure the maintenance of the epithelial cell monolayer. TEER measures the voltage difference between fluids (e.g., medium) in two compartments (e.g., between the apical and basal compartments); if the barrier between the compartments loses integrity, the fluids in the two compartments may mix. When the fluids mix, the voltage difference will be reduced or eliminated. This voltage difference indicates that the barrier is intact. In some embodiments, upon detection of a loss of voltage by TEER, the scaffold (e.g., Transwell® filter, microstructured bioreactor, decellularized tissue, hollow fiber bioreactor, etc.) is reseeded with additional cells to reestablish the barrier (e.g., monolayer) before cultured dairy production (e.g., milk production) can resume.

[0122] In some embodiments, the method further comprises harvesting the cultured dairy product from the apical compartment to produce the cultured dairy product. In some embodiments, harvesting is via a port, via gravity, and / or via vacuum. In some embodiments, the vacuum is attached to the port.

[0123] In some embodiments, the method further comprises freezing the harvested cultured dairy product to produce a frozen cultured dairy product and / or freeze-drying the harvested cultured dairy product to produce a freeze-dried cultured dairy product.

[0124] In some embodiments, the method further comprises packaging the harvested cultured dairy product, frozen cultured dairy product, and / or freeze-dried cultured dairy product in a container.

[0125] In some embodiments, the method further comprises extracting one or more components from the recovered cultured dairy product. Non-limiting examples of components extracted from the recovered cultured dairy product include milk protein, lipid, carbohydrate, vitamin, and / or mineral content. In some embodiments, the components extracted from the recovered cultured dairy product are freeze-dried and / or concentrated to produce a freeze-dried or concentrated cultured dairy component product. In some embodiments, the components extracted from the recovered cultured dairy product are concentrated, for example, by membrane filtration and / or reverse osmosis. In some embodiments, the freeze-dried or concentrated cultured dairy component product is packaged in a container, optionally a sterilizing-grade and / or food-grade container. In some embodiments, the container is vacuum-sealed. In some embodiments, the container is a canister, a jar, a bottle, a bag, a box, or a pouch.

[0126] cultured dairy products In embodiments herein, a cultured dairy product is disclosed. In some embodiments, the cultured dairy product is a standardized, sterile cultured dairy product. In some embodiments, the cultured dairy product is for nutritional uses.

[0127] In some embodiments, the cultured dairy product is produced by any of the methods disclosed herein.

[0128] Breast milk contains low but measurable concentrations of environmental pollutants, health-hazardous chemicals produced by industrial manufacturing, and manufacturing products widely distributed in the environment. Some environmental pollutants are secreted in breast milk. Contaminant levels in breast milk reflect those in the maternal body, making it ideal for monitoring exposure levels. Toxic environmental pollutants can be transferred from mother to infant through breastfeeding. Persistent organic pollutants (POPs) are a family of stable, lipophilic chemicals that bioaccumulate in adipose tissue, creating a persistent, toxic body burden. Breastfeeding provides an important source of exposure to POPs during the first stages of human life, but the effects are unknown.

[0129] In some embodiments, the cultured dairy products are free or substantially free of one or more environmental contaminants. In some embodiments, the cultured dairy products are free or substantially free of persistent organic pollutants (POPs). In some embodiments, the cultured dairy products are free or substantially free of pesticides, such as polychlorinated dibenzo-p-dioxins (PCDDs), polychlorinated dibenzofurans (PCDFs), polychlorinated biphenyls (PCBs), and DDT.

[0130] Environmental heavy metals, such as mercury, lead, arsenic, cadmium, nickel, chromium, cobalt, zinc, and other potentially toxic metals, are also of concern for nursing infants due to their bioaccumulation properties, which are known to lead to accumulation in human milk. Metals in breast milk arise from exogenous sources, i.e., uptake via polluted air, food, and drinking water, and endogenous release of essential trace elements. For example, lead and mercury are distributed evenly throughout the human food chain, and their effects on fetal development are largely determined by the mother's diet and nutritional status. Exposure to toxic metals has significant public health implications, even at low concentrations and for short periods of exposure, and these metals remain toxic to humans. Breastfeeding infants may be exposed to toxic metals during their most sensitive period. Breastfeeding infants are exposed to higher-than-normal amounts of heavy metals through breast milk, and this exposure may affect the infant's health. Particularly in young children, these exposures can adversely affect the developing central nervous system and result in lifelong deficits in cognitive abilities.

[0131] In some embodiments, cultured dairy products are free or substantially free of one or more heavy metals, such as arsenic, lead, cadmium, nickel, mercury, chromium, cobalt, and zinc. In some embodiments, cultured dairy products are free or substantially free of arsenic. In some embodiments, cultured dairy products are free or substantially free of lead. In some embodiments, cultured dairy products are free or substantially free of cadmium. In some embodiments, cultured dairy products are free or substantially free of nickel. In some embodiments, cultured dairy products are free or substantially free of mercury. In some embodiments, cultured dairy products are free or substantially free of chromium. In some embodiments, cultured dairy products are free or substantially free of cobalt. In some embodiments, cultured dairy products are free or substantially free of zinc. In some embodiments, cultured dairy products are free or substantially free of arsenic, lead, cadmium, nickel, mercury, chromium, cobalt, and zinc.

[0132] Exogenous allergenic proteins can be difficult to distinguish from endogenous human milk proteins. Food proteins that may be allergens found in human milk include chicken egg and peanut proteins. In the United States, eight major food allergens are responsible for the majority of serious food allergic reactions, known as the "big 8." The "big 8" consists of allergens from cow's milk, eggs, fish, shellfish, tree nuts, peanuts, wheat, and soy. Proteins known to cause egg allergy include ovomucoid, ovalbumin, and conalbumin. Peanut proteins include aratin 6, aratin 3, conaratin, and the major allergens Ara1 and Ara2. As an example of maternal food protein transfer to milk, it has been shown that consuming one egg per day results in higher concentrations of the chicken egg allergen ovalbumin (OVA) in human milk compared to mothers who do not consume eggs.

[0133] In some embodiments, the cultured dairy products are free or substantially free of one or more food allergens. In some embodiments, the cultured dairy products are free or substantially free of egg, fish, shellfish, tree nut, peanut, wheat, and soy allergens. In some embodiments, the cultured dairy products are free or substantially free of egg allergens. In some embodiments, the cultured dairy products are free or substantially free of fish allergens. In some embodiments, the cultured dairy products are free or substantially free of Crustacean allergens. In some embodiments, the cultured dairy products are free or substantially free of tree nut allergens. In some embodiments, the cultured dairy products are free or substantially free of peanut allergens. In some embodiments, the cultured dairy products are free or substantially free of wheat allergens. In some embodiments, the cultured dairy products are free or substantially free of soy allergens.

[0134] In some embodiments, the cultured dairy product is free or substantially free of aratin 6, aratin 3, conaratin, Arahl, and Arahl2.

[0135] In some embodiments, the cultured dairy product is free or substantially free of ovalbumin (OVA).

[0136] Having now described the present invention, the same will be more particularly described in the following examples, which are included herein for illustrative purposes only and are not intended to limit the invention. [Example]

[0137] Example 1: Cell culture systems designed for milk recovery must support compartmentalized secretion of the product, preventing exposure of the milk to the medium that provides nutrients to the cells. In vivo, milk-producing epithelial cells line the interior surface of the mammary gland as a continuous monolayer. This monolayer is oriented so that milk is secreted apically and stored in the luminal compartment of the gland or alveoli until removed during milking or lactation, while its basal surface is attached to the underlying basement membrane. Tight junctions along the lateral surfaces of the cells provide a barrier between the underlying tissue and the milk in the alveolar compartment. Thus, in vivo, mammary tissue is arranged such that milk secretion is compartmentalized, and the mammary epithelial cells themselves establish interfaces to maintain directional nutrient absorption and milk secretion.

[0138] This disclosure describes a cell culture device that recapitulates the compartmentalization of the mammary gland, which can be used to harvest milk from in vitro-grown mammary epithelial cells. Such a device can include a scaffold that supports the growth of mammary cells at the interface between the two compartments, resulting in an epithelial monolayer that provides a physical boundary between the nutrient medium and the secreted milk. In addition to providing a surface for growth, the scaffold provides spatial cues that guide cell polarization and ensure directionality of absorption and secretion. The present invention describes the preparation, cultivation, and stimulation of mammary epithelial cells in a compartmentalized cell culture device for the production and harvest of milk for nutritional uses (e.g., Figure 1).

[0139] Mammary epithelial cell preparation: Mammary epithelial cells are obtained from excised mammary tissue (e.g., breast, mammary gland, nipple), biopsy samples, or surgical explants of raw breast milk. Following surgical excision of the entire mammary tissue, any fat or stromal tissue is manually removed under sterile conditions. The remaining mammary tissue is then enzymatically digested with collagenase and / or hyaluronidase in a chemically defined nutrient medium, which should consist of generally recognized as safe (GRAS) ingredients. The sample is maintained at 37°C with gentle agitation. After digestion, a suspension of single cells or organoids is collected by centrifugation or by straining the sample through a sterile nylon cell strainer. The cell suspension is then transferred to tissue culture plates coated with the appropriate extracellular matrix components (e.g., collagen, laminin, fibronectin).

[0140] Alternatively, the explant specimen may be processed into small pieces, e.g., by mincing with a sterile scalpel, and the tissue pieces are plated onto a suitable surface, such as a gelatin sponge or plastic tissue culture plate coated with a suitable extracellular matrix.

[0141] The seeded cells are maintained at 37°C in a humidified incubator in a 5% CO atmosphere. During incubation, the medium is changed approximately every 1–3 days, and the cells are subcultured until a sufficient number of viable cells is achieved for further processing, including preparation for storage in liquid nitrogen; development of immortalized cell lines by stable transfection with SV40, TERT, or other senescence-associated genes; isolation of mammary epithelial, myoepithelial, and stem / progenitor cell types, for example, by fluorescence-activated cell sorting; and / or introduction into compartmentalized tissue culture devices for the production and collection of milk for human consumption.

[0142] Cultivation of Mammary Epithelial Cells for Milk Production. Milk for nutritional use is produced from mammary epithelial cells isolated as described above and cultured in a manner that supports compartmentalized secretion, maintaining separation between nutrient medium and product. This system relies on the ability of mammary epithelial cells to establish a continuous monolayer with apical-basal polarity when plated on an appropriate scaffold located at the interface between the apical compartment, into which milk is secreted, and the basal compartment, into which nutrient medium is provided throughout (see, e.g., Figure 2). For example, Transwell® filters placed in tissue culture plates, as well as bioreactors based on hollow fibers or microstructured scaffolds, are used to support these properties.

[0143] Following isolation and expansion of mammary epithelial cells, they are suspended in a chemically defined nutrient medium composed of food-grade ingredients and seeded onto a pre-coated culture device containing a mixture of extracellular matrix proteins, such as collagen, laminin, and / or fibronectin. This cell culture device can be any design that allows for compartmentalized absorption of nutrients and secretion of products from a polarized, confluent epithelial monolayer. Examples include hollow fiber bioreactors and microstructured scaffold bioreactors (see, for example, Figures 3 and 4, respectively). Alternatives include the preparation of decellularized mammary glands as scaffolds, repopulation with stem cells to produce functional organs in vitro, and the recovery of milk from the lumen of mammary epithelial cell organoids or "mammospheres" grown in either a hydrogel matrix or suspension.

[0144] The device features a sealed housing that maintains a temperature of approximately 37°C in a humidified atmosphere of approximately 5% CO2. Glucose uptake is monitored to assess culture growth as cells grow within the bioreactor. Stabilization of glucose consumption indicates that cells have reached contact-inhibited confluence. Transepithelial electrical resistance is used to ensure monolayer integrity. Sensors monitor dissolved O2 and CO2 concentrations at multiple locations in the medium. A computerized pump circulates the medium through the bioreactor at a rate that maintains balanced nutrient delivery and removes metabolic waste products such as ammonia and lactate. The medium can be reused through the system after waste removal using lactate supplementation and adaptation techniques (Freund et al. 2018 Int J Mol Sci. 19(2)) or by passing it through a zeolite-packed chamber.

[0145] Stimulation of Milk Production. Prolactin stimulates milk production and secretion in vivo and in cultured mammary epithelial cells. In culture, prolactin can be exogenously supplied in nutrient media at concentrations close to those observed in vivo during lactation, e.g., about 20 ng / mL to about 200 ng / mL. Purified prolactin is commercially available. However, alternative methods for providing prolactin or stimulating lactation have been utilized, including expression and purification of recombinant protein from microorganisms or mammary cell cultures. Alternatively, conditioned medium prepared by culturing cells that express and secrete prolactin can be applied to mammary epithelial cell cultures to stimulate lactation. Bioreactors can be configured in series to condition the medium through which prolactin-expressing cells are cultured, or other key media supplements, are then exposed to mammary cells growing in the compartmentalized culture device described above.

[0146] Other approaches to upregulate milk production and / or forgo the use of exogenous prolactin include molecular manipulation of signaling pathways regulated by the binding of prolactin to its receptor on the surface of mammary epithelial cells, such as (a) expression of constructs that target post-translational modifications of prolactin, (b) expression of alternative isotypes of the prolactin receptor, (c) expression of chimeric prolactin receptors in which the extracellular domain is exchanged for the binding site of a different ligand, (d) introduction of genes encoding constitutively or conditionally active prolactin receptors or modified versions of their downstream effectors such as STAT5 or Akt, (e) knockout or modification of the PER2 circadian gene, and / or (f) molecular approaches aimed at increasing the rate of nutrient uptake at the basal surface of mammary epithelial monolayers.

[0147] Milk Collection. Secreted milk is collected, for example, continuously or at intervals, through a port located in the apical compartment of the culture device. Application of a vacuum to the port facilitates collection and helps stimulate further production. The collected milk is packaged in sterile containers, sealed for distribution, frozen or lyophilized for storage, or processed for extraction of specific components.

[0148] The present invention provides mammary epithelial cell cultures for the production of milk for nutritional uses. In addition to human breast milk, the methods may be used to produce milk from other mammalian species, for example, for human consumption or veterinary use. Because milk production in vitro has not previously been possible, this technology may offer alternative production modes for existing products as well as novel commercial objectives. The societal and economic impacts of commercial development of this technology are significant and far-reaching. Producing human breast milk from cultured cells could provide a means to address infant malnutrition in food-insecure communities, provide essential nutrients to premature infants who cannot be breastfed, and offer mothers new options for providing optimal nutrition to their infants with the convenience of infant formula. The production of cow's milk and goat's milk offers opportunities to reduce the environmental, social, and animal welfare impacts of animal agriculture. The process described herein addresses a critical gap in the emerging field of cellular agriculture and introduces an opportunity to dramatically improve the human food supply without compromising humans' biological and cultural commitment to their most basic nutritional sources.

[0149] The foregoing examples are illustrative of the present invention and should not be construed as limiting thereof. Although the present invention has been described in detail with reference to preferred embodiments, variations and modifications exist within the scope and spirit of the invention as set forth and defined in the following claims.

Claims

1. 1. A method for producing a cultured dairy product isolated from mammary cells, comprising: (a) culturing a living cell construct in a bioreactor under conditions to produce the cultured dairy product, wherein the living cell construct comprises: (i) a three-dimensional scaffold having an outer surface, an inner surface defining a lumen / base chamber, and a plurality of pores extending from said inner surface to said outer surface; (ii) a matrix material disposed on the exterior surface of the three-dimensional scaffold; (iii) a culture medium disposed within the lumen and in fluid contact with the interior surface; and (iv) a confluent monolayer of polarized mammary gland cells disposed on said matrix material, said polarized mammary gland cells being selected from the group consisting of live primary mammary epithelial cells, live mammary myoepithelial cells, live mammary progenitor cells, live immortalized mammary epithelial cells, live immortalized mammary myoepithelial cells, and live immortalized mammary progenitor cells, said monolayer comprising an apical surface from which said cultured dairy product is secreted, and a basal surface. wherein the bioreactor comprises an apical compartment, the apical compartment being in fluid contact with the apical surface of the polarized mammary cells, substantially isolated from the lumen of the live cell construct, and substantially free of culture medium; (b) isolating the cultured dairy product secreted from the apical surface of the polarized mammary cells into the apical compartment; A method comprising:

2. The total cell density of the mammary gland cells in the bioreactor is at least 10 per 1.5 m 2 11 The method of claim 1, wherein the cells are cells.

3. The total surface area of ​​the mammary cells in the bioreactor is at least 1.5 m 2 The method of claim 1, wherein

4. 10. The method of claim 1, wherein the culture medium comprises a carbon source, a chemical buffer system, one or more essential amino acids, one or more vitamins and / or cofactors, and one or more inorganic salts.

5. The method of claim 1 , wherein the matrix material comprises one or more extracellular matrix proteins.

6. 10. The method of claim 1, wherein the scaffold comprises a natural polymer, a biocompatible synthetic polymer, a synthetic peptide, a composite derived from any of the foregoing, or any combination thereof.

7. The method of claim 6, wherein the natural polymer is collagen, chitosan, cellulose, agarose, alginate, gelatin, elastin, heparan sulfate, chondroitin sulfate, keratan sulfate, and / or hyaluronic acid.

8. 7. The method of claim 6, wherein the biocompatible synthetic polymer is polysulfone, polyvinylidene fluoride, polyethylene covinyl acetate, polyvinyl alcohol, sodium polyacrylate, acrylic acid polymer, and / or polyethylene glycol.

9. 10. The method of claim 1, wherein the culturing step is carried out at a temperature of 27°C to 39°C.

10. 10. The method of claim 9, wherein the culturing step is carried out at a temperature of 30°C to 37°C.

11. The culturing step is carried out in an atmosphere of 4% to 6% CO 2 The method of claim 1 , wherein the concentration is

12. The culturing step is carried out in an atmosphere of 5% CO 2 The method of claim 11 , wherein the concentration is

Citation Information

Patent Citations

  • Three-Dimensional Hydrogels that Support Growth of Physiologically Relevant Tissue and Methods of Use Thereof

    US20170267970A1