Methods of treating ocular neovascular diseases using AAV2 variants encoding aflibercept

Abstract

Provided are methods for treating an ocular neovascular disease in an individual, comprising administering a unit dose of recombinant adeno‐associated virus (rAAV) particles to an eye of the individual, wherein the rAAV particles comprise: a) a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about 95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs), and b) an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein.

Description

Attorney Docket No.17234.045WO1 METHODS OF TREATING OCULAR NEOVASCULAR DISEASES USING AAV2 VARIANTS ENCODING  AFLIBERCEPT  Cross‐Reference to Related Applications

[0001] This application claims priority under 35 U.S.C. § 119(e) to and benefit of U.S. Provisional  Application No. 63 / 512,025 filed July 5, 2023 and U.S. Provisional Application No. 63 / 550,243 filed February  6, 2024, which are hereby incorporated by reference in their entirety.    Statement Regarding the Sequence Listing

[0002] The official copy of the Sequence Listing is submitted concurrently with the specification as  an WIPO Standard ST.26 formatted XML file with file name “17234‐045WO1”, a creation date of July 2,  2024, and a size of 53,248 bytes.  This Sequence Listing filed via USPTO Patent Center is part of the  specification and is incorporated in its entirety by reference herein.      FIELD

[0003] The present disclosure relates to methods of treating ocular neovascular disease and disorders in  an individual that comprise administering a single unit dose of a recombinant adeno associated virus (rAAV)  particles encoding an anti‐VEGF agent (e.g., aflibercept) to an eye of an individual.   BACKGROUND

[0004] Age‐related macular degeneration (AMD) is a degenerative ocular disease affecting the macula, a  light sensitive, small area in the center of the retina that is responsible for reading and fine vision.   Conditions affecting the macula reduce central vision while leaving peripheral vision intact.  In severe cases,  the disease can lead to central blindness.  AMD is a notable cause of vision loss in the US population among  persons 65 years and older, and the estimated prevalence of any AMD among persons over 40 years of age  is approximately 6.5% (Klein et al., (2011) Arch Ophthalmol, 129(1):75‐80).  Neovascular or exudative or wet  AMD (nAMD, wAMD, or nwAMD) is an advanced form of AMD.  The hallmark of wAMD is choroidal  neovascularization (CNV), which is the infiltration of abnormal blood vessels in the retina from the  underlying choroid layer, resulting in retinal cell damage and central blindness.  This abnormal angiogenic  process is modulated by growth factors, in particular, vascular endothelial growth factor (VEGF). The  standard of care of wAMD is a class of molecules that bind to and sequester VEGF, such as ranibizumab  (Lucentis) and aflibercept (Eylea).  Attorney Docket No.17234.045WO1

[0005] Diabetic retinopathy (DR) is a major complication of diabetes mellitus and is a leading cause of  visual loss in the working age population.  DR may be non‐proliferative (NPDR), with no new blood vessel  growth, or proliferative DR (PDR), with new abnormal blood vessel growth within the retina or choroid.   Diabetic macular edema (DME) is a complication of DR and is another example of an ocular disease affecting  the macula. DME affects up to 10% of people with diabetes and is caused by fluid accumulation in the  macula. DME is the most frequent cause of sight loss in people with DR. Available therapies for treating DME  include laser and anti‐vascular endothelial growth factor (anti‐VEGF) drugs such as aflibercept.

[0006] Aflibercept is a recombinant fusion protein that acts as a decoy receptor for vascular endothelial  growth factor subtypes A and B (VEGF‐A and VEGF‐B) and placental growth factor (PGF). By binding to these  ligands, aflibercept is able to prevent them from binding to vascular endothelial growth factor receptors  (VEGFR), VEGFR‐1 and VEGFR‐2, to suppress neovascularization and decrease vascular permeability.  Aflibercept consists of domain 2 of VEGFR‐1 and domain 3 of VEGFR‐2 fused with the Fc fragment of IgG1.

[0007] Current standard of care anti‐VEGF agents such as aflibercept need to be re‐administered via  intravitreal (IVT) injection every 4 to 8 weeks to achieve optimal therapeutic outcomes and maintain visual  acuity.  Compliance with such a regimen is burdensome to patients, their caregivers, and the healthcare  system, and most patients fall out of compliance with the optimal regimen over time, which is correlated  with vision loss (Khanani AM, et al.).  In addition, there are complications including endophthalmitis, retinal  detachments, traumatic cataract, and elevated intraocular pressure (IOP); the risks of these complications  are likely to increase with repeated IVT injections (Falavarjani et al., (2013) Eye (Lond), 27(7):787‐794).

[0008] Therefore, there is a need in the art for therapies for ocular neovascular diseases such as wAMD,  DR, or DME that are effective, reduce the risk of adverse effects, and are amenable to high long‐term  patient compliance.   SUMMARY OF THE DISCLOSURE

[0009] In one aspect, provided herein is a method for treating an ocular neovascular disease in an  individual, the method comprising administering a unit dose of about 6 × 1011 vector genomes (vg) or less of  recombinant adeno‐associated virus (rAAV) particles to one eye of the individual, wherein the individual is a  human, and wherein the rAAV particles comprise: (a) a nucleic acid encoding a polypeptide comprising an  amino acid sequence with at least about 95% identity to the amino acid sequence of SEQ ID NO: 35 and  flanked by AAV2 inverted terminal repeats (ITRs), and (b) an AAV2 capsid protein comprising, or consisting  of, an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid  protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein.  In some  embodiments, the method comprises reducing retinal fluid in an eye of the individual. Attorney Docket No.17234.045WO1

[0010] In another aspect, provided herein is a method for reducing retinal fluid in an eye of an individual  with an ocular neovascular disease, the method comprising administering a unit dose of rAAV particles to  one eye of the individual, wherein the individual is a human, and wherein the rAAV particles comprise: (a) a  nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about 95% identity to  the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs), and (b) an  AAV2 capsid protein comprising, or consisting of, an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein. In some embodiments, the individual has received at least one  treatment of an anti‐VEGF agent in about the last 12 weeks prior to administration of the unit dose of rAAV  particles. In some embodiments, the amount or presence of retinal fluid in the one eye of the individual is  refractory to prior treatment with an anti‐VEGF agent. In some embodiments, the anti‐VEGF agent is  aflibercept. In some embodiments, the retinal fluid in the one eye is reduced by at least about 60%.  In some  embodiments, the retinal fluid in the one eye is reduced by about 80% compared to the level of retinal fluid  in the one eye of the individual prior to administration of the rAAV to the individual. In some embodiments,  the retinal fluid is subretinal fluid (SRF) or intraretinal fluid (IRF). In some embodiments, the unit dose of  rAAV particles is about 6 × 1011 vector genomes per eye (vg / eye) or less.

[0011] In another aspect, provided herein is a  method for treating an ocular neovascular disease in an  individual, the method comprising: (a) administering an anti‐VEGF agent to one eye of the individual; and (b)  administering a unit dose of about 6 × 1011 vector genomes (vg) or less of recombinant adeno‐associated  virus (rAAV) particles to the one eye of the individual after administration of the anti‐VEGF agent, wherein  the individual is a human, and wherein the rAAV particles comprise: (i) a nucleic acid encoding a polypeptide  comprising an amino acid sequence with at least about 95% identity to the amino acid sequence of SEQ ID  NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs), and (ii) an AAV2 capsid protein comprising an  amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid  protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some  embodiments, the method comprises administering the unit dose of rAAV particles to the one eye of the  individual about 1 week or about 7 days after administration of the anti‐VEGF agent. In some embodiments,  the method comprises administering the unit dose of rAAV particles to the one eye of the individual about 1  week to about 2 weeks after administration of the anti‐VEGF agent. In some embodiments, the method  comprises administering the unit dose of rAAV particles to the one eye of the individual about 1 day, about 2  days, about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days,  about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, or about 15 days after  administration of the anti‐VEGF agent.  In some embodiments, the method comprises administering the Attorney Docket No.17234.045WO1 anti‐VEGF agent to the one eye of the individual on Day 1, and administering the unit dose of rAAV particles  to the one eye of the individual on Day 8. In some embodiments, the anti‐VEGF agent comprises aflibercept.  In some embodiments, the aflibercept is administered at a dose of about 2 mg by intravitreal injection.  In  some embodiments, the method further comprises administering a topical steroid treatment.  In some  embodiments, the topical steroid treatment is a difluprednate treatment. In some embodiments, the topical  steroid treatment comprises about four administrations of topical steroid per day for about four weeks,  followed by about three administrations of topical steroid per day for about one week, followed by about  two administrations of topical steroid per day for about one week, and followed by about one  administration of topical steroid per day for about one week; timing starting with and following  administration of the anti‐VEGF agent. In some embodiments, the topical steroid treatment comprises  about four administrations of topical steroid per day for about one month, followed by about three  administrations of topical steroid per day for about one month, followed by about two administrations of  topical steroid per day for about one month, and followed by about one administration of topical steroid per  day for about one month; timing starting with and following administration of the anti‐VEGF agent. In some  embodiments, the topical steroid treatment comprises about four administrations of topical steroid per day  for about one month, followed by about three administrations of topical steroid per day for about one  month, followed by about two administrations of topical steroid per day for about one month, and followed  by about one administration of topical steroid per day for about one month; timing starting with and  following administration of the rAAV particles. In some embodiments, the topical steroid comprises  difluprednate 0.05% at a dose of about 1µg to about 3 µg. In some embodiments, the topical steroid  comprises difluprednate 0.05% at a dose of about 2.5µg.

[0012] In some embodiments that may be combined with any of the preceding embodiments, the unit  dose of rAAV particles is about 6 × 1010 to about 2 × 1011 vector genomes per eye (vg / eye). In some  embodiments, the unit dose of rAAV particles is about 2 × 1011 or about 6 × 1010 vector genomes per eye  (vg / eye).  In some embodiments that may be combined with any of the preceding embodiments, the unit  dose of rAAV particles is between about 6 × 1010 to about 6 × 1011 vector genomes per eye (vg / eye). In some  embodiments that may be combined with any of the preceding embodiments, the unit dose of rAAV  particles is between about 6 × 1010 to about 2 × 1011 vector genomes per eye (vg / eye). In some  embodiments that may be combined with any of the preceding embodiments, the unit dose of rAAV  particles is between about 2 × 1011 to about 6 × 1011 vector genomes per eye (vg / eye). In some  embodiments, the unit dose of rAAV particles is about 2 × 1011 or about 6 × 1010 vector genomes per eye  (vg / eye). In some embodiments, the unit dose of rAAV particles is about 2 × 1011 vg / eye. In some  embodiments, the unit dose of rAAV particles is about 6 × 1011 vg / eye. Attorney Docket No.17234.045WO1

[0013] In some embodiments that may be combined with any of the preceding embodiments, the  individual has one or more symptoms of an ocular neovascular disease in the contralateral eye.

[0014] In some embodiments that may be combined with any of the preceding embodiments, the  methods provided herein further comprise administering a unit dose of rAAV particles to the contralateral  eye of the individual. In some embodiments, the administering the unit dose of rAAV particles to the  contralateral eye is up to about 2 weeks after administering the unit dose of rAAV particles to the one eye.  In some embodiments, the administering the unit dose of rAAV particles to the contralateral eye is on the  same day as the administering the unit dose of rAAV particles to the one eye; or the administering the unit  dose of rAAV particles to the contralateral eye is between about 1 day to about 14 days after administering  the unit dose of rAAV particles to the one eye. In some embodiments, the unit dose of rAAV particles  administered to the contralateral eye of the individual comprises the same or less vector genomes per eye  (vg / eye) than the unit dose of rAAV particles administered to the one eye of the individual. In some  embodiments, the administering the unit dose of rAAV particles to the contralateral eye is at least about 2  weeks after administering the unit dose of rAAV particles to the one eye. In some embodiments, the unit  dose of rAAV particles administered to the contralateral eye of the individual comprises more vector  genomes per eye (vg / eye) than the unit dose of rAAV particles administered to the one eye of the individual.

[0015] In some embodiments that may be combined with any of the preceding embodiments, the nucleic  acid comprises the nucleic acid sequence of SEQ ID NO: 40 or a sequence having at least 85% identity  thereto.

[0016] In some embodiments that may be combined with any of the preceding embodiments, the  polypeptide comprises the amino acid sequence of SEQ ID NO: 35. In some embodiments that may be  combined with any of the preceding embodiments, the polypeptide comprises the amino acid sequence of  SEQ ID NO: 41. In some embodiments, the polypeptide is aflibercept.

[0017] In some embodiments that may be combined with any of the preceding embodiments, the nucleic  acid further comprises a first enhancer region, a promoter region, a 5'UTR region, a second enhancer region,  and a polyadenylation site. In some embodiments, the nucleic acid comprises, in the 5’ to 3’ order: (a) a first  enhancer region;  (b) a promoter region; (c) a 5'UTR region; (d) a nucleic acid encoding a polypeptide  comprising an amino acid sequence with at least about 95% identity to the amino acid sequence of SEQ ID  NO: 35; (e) a second enhancer region; and (f) a polyadenylation site; and flanked by AAV2 inverted terminal  repeats (ITRs). In some embodiments, the first enhancer region comprises a CMV sequence comprising the  sequence of SEQ ID NO: 22 or a sequence having at least 85% identity thereto. In some embodiments, the  promoter region comprises a CMV sequence comprising the sequence of SEQ ID NO: 23 or a sequence  having at least 85% identity thereto. In some embodiments, the nucleic acid encoding a polypeptide Attorney Docket No.17234.045WO1 comprises the nucleic acid sequence of SEQ ID NO: 40 or a sequence having at least 85% identity thereto. In  some embodiments, the polypeptide comprises the amino acid sequence of SEQ ID NO: 35 or a sequence  having at least 85% identity thereto. In some embodiments, the polypeptide comprises the amino acid  sequence of SEQ ID NO: 41 or a sequence having at least 85% identity thereto. In some embodiments, the  polypeptide is aflibercept. In some embodiments, the 5'UTR region comprises, in 5' to 3' order, a TPL  sequence comprising the sequence of SEQ ID NO: 24 or a sequence having at least 85% identity thereto, and  an eMLP sequence comprising the sequence of SEQ ID NO: 25 or a sequence having at least 85% identity  thereto. In some embodiments, the second enhancer region comprises a full EES sequence comprising the  sequence of SEQ ID NO: 26 or a sequence having at least 85% identity thereto. In some embodiments, the  polyadenylation site comprises a HGH polyadenylation site comprising the sequence of SEQ ID NO: 27 or a  sequence having at least 85% identity thereto. In some embodiments, the nucleic acid further comprises (a)  a first enhancer region comprising a CMV sequence comprising the sequence of  SEQ ID NO: 22 or a  sequence having at least 85% identity thereto; (b) a promoter region, comprising a CMV sequence  comprising the sequence of SEQ ID NO: 23 or a sequence having at least 85% identity thereto; (c) a 5'UTR  region comprising, in 5' to 3' order, a TPL sequence comprising the sequence of SEQ ID NO: 24 or a sequence  having at least 85% identity thereto, and an eMLP sequence comprising the sequence of SEQ ID NO: 25 or a  sequence having at least 85% identity thereto; (d) a second enhancer region comprising a full EES sequence  comprising the sequence of SEQ ID NO: 26 or a sequence having at least 85% identity thereto; and (e) a HGH  polyadenylation site comprising the sequence of SEQ ID NO: 27 or a sequence having at least 85% identity  thereto.  In some embodiments, the nucleic acid comprises AAV ITRs flanking the elements.

[0018] In some embodiments that may be combined with any of the preceding embodiments, the nucleic  acid comprises the sequence of SEQ ID NO: 39 or a sequence having at least 85% identity thereto.

[0019] In some embodiments that may be combined with any of the preceding embodiments, the rAAV  particles comprise an AAV2 VP1 capsid protein comprising a GH loop that comprises the amino acid  sequence of SEQ ID NO: 38 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO:  38. In some embodiments, the rAAV particles comprise an AAV2 VP1 capsid protein comprising a GH loop  that comprises an amino acid sequence having any of at least 90%, at least 91%, at least 92%, at least 93%,  at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity  to SEQ ID NO: 38.

[0020] In some embodiments that may be combined with any of the preceding embodiments, the rAAV  particles comprise an AAV2 VP1 capsid protein comprising the amino acid sequence of SEQ ID NO: 37 or an  amino acid sequence having at least 90% sequence identity to SEQ ID NO: 37. In some embodiments, the  rAAV particles comprise an AAV2 VP1 capsid protein comprising an amino acid sequence having any of at Attorney Docket No.17234.045WO1 least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at  least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 37.

[0021] In some embodiments that may be combined with any of the preceding embodiments, the AAV2  capsid protein comprises, or consists of, the amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the AAV2 VP1 comprising the sequence of SEQ ID NO: 13. In some  embodiments, the AAV2 capsid protein comprises the amino acid sequence LALGETTRPA (SEQ ID NO: 1)  inserted between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein. In some embodiments, the AAV2 capsid protein comprises the  amino acid sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the AAV2 VP1  comprising the sequence of SEQ ID NO: 13. In some embodiments, the AAV2 capsid protein comprises the  amino acid sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid  protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some  embodiments, the AAV2 capsid protein comprises the amino acid sequence LALGETTRPA (SEQ ID NO: 1)  inserted between positions 587 and 588 of the AAV2 VP1 comprising the sequence of SEQ ID NO: 13.

[0022] In some embodiments that may be combined with any of the preceding embodiments, the  administration of the unit dose of rAAV particles to the one eye and / or the contralateral eye is by  intravitreal administration.

[0023] In some embodiments that may be combined with any of the preceding embodiments, the unit  dose of rAAV particles is in a pharmaceutical formulation. In some embodiments, the pharmaceutical  formulation comprises the rAAV particles, sodium chloride, sodium phosphate and a surfactant. In some  embodiments, the pharmaceutical formulation comprises about 150 to about 200 mM sodium chloride,  about 1 to about 10 mM monobasic sodium phosphate, about 1 to about 10 mM dibasic sodium phosphate,  about 0.0005% (w / v) to about 0.005% (w / v) poloxamer 188, and about 6 × 1013 to about 6 × 1010 vector  genomes (vg) per mL (vg / mL) of the rAAV particles, wherein the pharmaceutical formulation has a pH of  about 7.0 to about 7.5. In some embodiments, the pharmaceutical formulation comprises about 180 mM  sodium chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic sodium phosphate, about  6 ×1012 vg / mL of the rAAV particles, and about 0.001% (w / v) poloxamer 188, wherein the pharmaceutical  formulation has a pH of about 7.3. In some embodiments, the pharmaceutical formulation comprises about  180 mM sodium chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic sodium  phosphate, about 2 ×1012 vg / mL of the rAAV particles, and about 0.001% (w / v) poloxamer 188, wherein the  pharmaceutical formulation has a pH of about 7.3. In some embodiments, the pharmaceutical formulation  comprises about 180 mM sodium chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic Attorney Docket No.17234.045WO1 sodium phosphate, about 6 ×1011 vg / mL of the rAAV particles, and about 0.001% (w / v) poloxamer 188,  wherein the pharmaceutical formulation has a pH of about 7.3.

[0024] In some embodiments that may be combined with any of the preceding embodiments, the unit  dose of rAAV particles comprises a volume of about 25 μL to about 250 μL. In some embodiments, the unit  dose of rAAV particles comprises a volume of about 100μL. In some embodiments, the unit dose of rAAV  particles comprises a volume of about 30μL. In some embodiments that may be combined with any of the  preceding embodiments, the unit dose of rAAV particles administered to the one eye and / or to the  contralateral eye comprises a volume of about 25 μL to about 250 μL. In some embodiments, the unit dose  of rAAV particles administered to the one eye and / or to the contralateral eye comprises a volume of about  100 μL. In some embodiments, the unit dose of rAAV particles administered to the one eye and / or to the  contralateral eye comprises a volume of about 50 μL. In some embodiments, the unit dose of rAAV particles  administered to the one eye and / or to the contralateral eye comprises a volume of about 30 μL.

[0025] In some embodiments that may be combined with any of the preceding embodiments, the  individual received prior treatment for the ocular neovascular disease with an anti‐VEGF agent. In some  embodiments, the individual has received 1 or 2 injections of an anti‐VEGF agent in the one eye and / or in  the contralateral eye prior to administration of the rAAV particles in the one eye and / or in the contralateral  eye. In some embodiments, the individual has not received prior treatment for the ocular neovascular  disease with an anti‐VEGF agent. In some embodiments, the anti‐VEGF agent is aflibercept.

[0026] In some embodiments that may be combined with any of the preceding embodiments, the ocular  neovascular disease is wet age‐related macular degeneration (AMD), retinal neovascularization, choroidal  neovascularization diabetic retinopathy, proliferative diabetic retinopathy, retinal vein occlusion, central  retinal vein occlusion, branched retinal vein occlusion, diabetic macular edema, diabetic retinal ischemia,  ischemic retinopathy, diabetic retinal edema, or any combination thereof.

[0027] In some embodiments that may be combined with any of the preceding embodiments, the unit  dose of rAAV particles is administered in combination with steroid treatment. In some embodiments, the  steroid treatment is a corticosteroid treatment. In some embodiments, the steroid treatment is a systemic  steroid treatment. In some embodiments, the steroid treatment is an oral steroid treatment. In some  embodiments, the steroid treatment is a prednisone treatment. In some embodiments, the oral prednisone  treatment comprises administering prednisone at a dose of about 60 mg per day for a total of 6 days  starting at 3 days before administration of the unit dose of rAAV particles to the one eye and / or to the  contralateral eye, followed by administering prednisone at a dose of about  40 mg per day for a total of 3  days, followed by administering prednisone at a dose of about  20 mg per day for a total of 2 days, and  followed by administering prednisone at a dose of about 10 mg per day for a total of 2 days. In some Attorney Docket No.17234.045WO1 embodiments, the steroid treatment is a topical steroid treatment. In some embodiments, the steroid  treatment is a difluprednate treatment. In some embodiments, the steroid is administered before, during  and / or after administration of the unit dose of rAAV particles.  In some embodiments, the steroid is  administered before, during and / or after administration of the unit dose of rAAV particles to the one eye  and / or to the contralateral eye.

[0028] In some embodiments that may be combined with any of the preceding embodiments, the steroid  treatment is a topical steroid treatment and the topical steroid treatment is a daily steroid treatment for up  to about 4 weeks, up to about 6 weeks, or up to about 8 weeks from administering the unit dose of rAAV  particles.   In some embodiments, the topical steroid treatment comprises about four administrations of  topical steroid on about week 1, about three administrations of topical steroid on about week 2, about two  administrations of topical steroid on about week 3, and about one administration of topical steroid on about  week 4; timing starting with and following administration of the unit dose of rAAV particles. In some  embodiments, the topical steroid treatment comprises about four administrations of topical steroid per day  for about 3 weeks after administration of the unit dose of rAAV particles, followed by about 3  administrations of topical steroid per day for about 1 week, followed by about 2 administrations of topical  steroid per day for about 1 week, and followed by about 1 administration of topical steroid per day for  about 1 week. In some embodiments, the topical steroid treatment comprises about four administrations of  topical steroid per day for about four weeks, followed by about three administrations of topical steroid per  day for about one week, followed by about two administrations of topical steroid per day for about one  week, and followed by about one administration of topical steroid per day for about one week; timing  starting at about one week prior to administration of the unit dose of rAAV particles.  In some embodiments,  the topical steroid treatment comprises about four administrations of topical steroid per day for about one  month, followed by about three administrations of topical steroid per day for about one month, followed by  about two administrations of topical steroid per day for about one month, and followed by about one  administration of topical steroid per day for about one month; timing starting at about the administration of  the unit dose of rAAV particles.  In some embodiments, the topical steroid treatment comprises about four  administrations of topical steroid per day for about one month, followed by about three administrations of  topical steroid per day for about one month, followed by about two administrations of topical steroid per  day for about one month, and followed by about one administration of topical steroid per day for about one  month; timing starting at about one week prior to administration of the unit dose of rAAV particles.  In some  embodiments, the topical steroid comprises difluprednate 0.05% at a dose of about 1µg to about 3 µg. In  some embodiments, the topical steroid comprises difluprednate 0.05% at a dose of about 2.5µg.  Attorney Docket No.17234.045WO1

[0029] In some embodiments, the ocular neovascular disease is wet age‐related macular degeneration  (wAMD).

[0030] In some embodiments that may be combined with any of the preceding embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in maintenance or a decrease of retinal thickness compared to the retinal thickness prior to  administration of the unit dose of rAAV particles. In some embodiments, the maintenance or the decrease  of retinal thickness compared to the retinal thickness prior to administration of the unit dose of rAAV  particles is present at about 30 weeks, about 34 weeks, about 44 weeks, about 6 months, about 1 year,  about 1.5 years, about 2 years, about 3 years, about 5 years, about 10 years, or more after administration of  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease in retinal thickness compared to the retinal thickness prior to  administration of the unit dose of rAAV particles. In some embodiments, the decrease in retinal thickness is  at least about 10% compared to the retinal thickness prior to administration of the unit dose of rAAV  particles. In some embodiments, retinal thickness is central subfield thickness (CST) or central retinal  thickness (CRT).

[0031] In some embodiments that may be combined with any of the preceding embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in maintenance or a decrease in macular volume compared to the macular volume prior to  administration of the unit dose of rAAV particles. In some embodiments, the maintenance or the decrease in  macular volume compared to the macular volume prior to administration of the unit dose of rAAV particles  is present at about 30 weeks, about 34 weeks, about 44 weeks, about 6 months, about 1 year, about 1.5  years, about 2 years, about 3 years, about 5 years, about 10 years, or more after administration of the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease in macular volume compared to the macular volume prior to  administration of the unit dose of rAAV particles. In some embodiments, the decrease in macular volume is  at least about 10% compared to the macular volume prior to administration of the unit dose of rAAV  particles.

[0032] In some embodiments that may be combined with any of the preceding embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in maintenance or an improvement of visual acuity compared to the visual acuity prior to  administration of the unit dose of rAAV particles. In some embodiments, the maintenance or the Attorney Docket No.17234.045WO1 improvement of visual acuity compared to the visual acuity prior to administration of the unit dose of rAAV  particles is present at about 30 weeks, about 34 weeks, about 44 weeks, about 6 months, about 1 year,  about 1.5 years, about 2 years, about 3 years, about 5 years, about 10 years, or more after administration of  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in an improvement of visual acuity compared to the visual acuity prior to  administration of the unit dose of rAAV particles. In some embodiments, visual acuity is best corrected  visual acuity (BCVA).

[0033] In some embodiments that may be combined with any of the preceding embodiments,  administration of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of the  individual provides a therapeutic benefit (e.g., treatment of an ocular neovascular disease, reduction of  retinal fluid, maintenance or a decrease of retinal thickness, maintenance or a decrease in macular volume,  and / or maintenance or an improvement of visual acuity). In some embodiments, administration of a single  unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual provides a  therapeutic benefit that is present at about 30 weeks or more, about 34 weeks or more, about 44 weeks or  more, about 6 months or more, about 1 year or more, about 1.5 years or more, or about 2 years, about 3  years, about 5 years, about 10 years, or more after administration of the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of the individual.

[0034] In some embodiments that may be combined with any of the preceding embodiments,  administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality  of individuals results in at least about 50% of the individuals in the plurality not requiring an anti‐VEGF  rescue treatment. In some embodiments, at least about 50% of the individuals in the plurality do not require  an anti‐VEGF rescue treatment for at least about 20 weeks, at least about 36 weeks, at least about 52  weeks, at least about 56 weeks, or more after administration of the unit dose of rAAV particles.

[0035] In some embodiments that may be combined with any of the preceding embodiments,  administration of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a  plurality of individuals results in at least about 67% of the individuals in the plurality not requiring an anti‐ VEGF rescue treatment. In some embodiments, at least about 67% of the individuals in the plurality do not  require an anti‐VEGF rescue treatment for at least about 20 weeks, at least about 36 weeks, at least about  52 weeks, at least about 60 weeks, at least about 64 weeks, or at least about 66 weeks after administration  of the unit dose of rAAV particles.

[0036] In some embodiments that may be combined with any of the preceding embodiments,  administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality Attorney Docket No.17234.045WO1 of individuals results in at least about 78% of the individuals in the plurality not requiring an anti‐VEGF  rescue treatment. In some embodiments, at least about 78% of the individuals in the plurality do not require  an anti‐VEGF rescue treatment for at least about 20 weeks, at least about 36 weeks, or more after  administration of the unit dose of rAAV particles.

[0037] In some embodiments that may be combined with any of the preceding embodiments,  administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality  of individuals results in 100% of the individuals in the plurality not requiring an anti‐VEGF rescue treatment.  In some embodiments, 100% of the individuals in the plurality do not require an anti‐VEGF rescue treatment  for at least about 64 weeks, at least about 68 weeks, at least about 72 weeks, at least about 76 weeks, at  least about 80 weeks, at least about 84 weeks, or more after administration of the unit dose of rAAV  particles.

[0038] In some embodiments that may be combined with any of the preceding embodiments,  administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality  of individuals results in a reduction in the annualized anti‐VEGF injection rate of at least about 80%, at least  about 85%, at least about 87%, at least about 90%, at least about 95%, at least about 99%, or 100%  compared to the annualized anti‐VEGF injection rate prior to administration of the unit dose of rAAV  particles.

[0039] In some embodiments, the ocular neovascular disease is diabetic macular edema (DME). In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a 2‐step or in a 3‐step improvement in Diabetic Retinopathy Severity Scale  (DRSS). In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a 2‐step improvement in Diabetic Retinopathy Severity Scale  (DRSS). In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a 3‐step improvement in Diabetic Retinopathy Severity Scale  (DRSS).

[0040] In an embodiment, methods for treating an ocular neovascular disease in an individual are  provided.  The methods comprise administering a unit dose of about 2 x 1011 vector genomes (vg) or less of  recombinant adeno‐associated virus (rAAV) particles to one eye of an individual, wherein the individual is  human and wherein the rAAV particles comprise (a) a nucleic acid encoding a polypeptide comprising an  amino acid sequence with at least about 95% identity to the amino acid sequence of claim 35 and flanked by  AAV2 inverted terminal repeats (ITRs) and (b) an AAV2 capsid protein comprising an amino acid sequence  LGETTRP (SEQ ID NO:14) inserted between positions 587 and 588 of the capsid protein, wherein the amino Attorney Docket No.17234.045WO1 acid residue numbering corresponds to an AAV2 VP1 capsid protein.  In various aspects of the methods,  retinal fluid in the eye of an individual with an ocular neovascular disease is reduced.

[0041] In an embodiment, methods for reducing retinal fluid in an eye of an individual with an ocular  neovascular disease are provided.  The methods comprise administering a unit dose of rAAV particles to one  eye of the individual, wherein the individual is human, and wherein the rAAV particles comprise: (a) a  nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about 95% identity to  the amino acid sequence of SEQ ID NO:35 and flanked by AAV2 inverted terminal repeats (ITRs), and (b) an  AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO:14) inserted between  positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering corresponds to an  AAV2 VP1 capsid protein. In aspects of the methods, the individual has received at least one treatment of an  anti‐VEGF agent in about 12 weeks prior to administration of the unit dose of rAAV particles. In aspects of  various methods, the amount or presence of retinal fluid in the one eye of the individual is refactory to prior  treatment with an anti‐VEGF agent. In further aspects of the methods, the anti‐VEGF agent is aflibercept. In  aspects of any of the above methods, the retinal fluid in the one eye is reduced by about 80% compared to  the level of retinal fluid in the one eye of the individual prior to administration of the rAAV to the individual.  In aspects of any of the above methods, the retinal fluid is subretinal fluid (SRF) or intraretinal fluid (IRF).

[0042] Methods for treating an ocular neovascular disease in an individual are provided. The methods  comprise (a) administering an anti‐VEGF agent to one eye of the individual and (b) administering a unit dose  of about 6 x 1011 vector genomes (vg) or less of recombinant adeno‐associated virus (rAAV) particles to the  one eye of the individual after administration of the anti‐VEGF agent, wherein the individual is human, and  wherein the rAAV particles comprise (i) a nucleic acid encoding a polypeptide comprising an amino acid  sequence with at least about 95% identity to the amino acid sequence of SEQ ID NO:35 and flanked by AAV2  inverted terminal repeats (ITRs) and (ii) an AAV capsid protein comprising an amino acid sequence LGETTRP  (SEQ ID NO:14) inserted between positions 587 and 588 of the capsid protein, wherein the amino acid  residue numbering corresponds to an AAV2 VP1 capsid protein.  Aspects of the methods comprise  administering the unit dose of rAAV particles to the one eye of the individual about 1 week or about 7 days  after the administration of the anti‐VEGF agent.  Aspects of the methods comprise administering the anti‐ VEGF agent to the one eye of the individual on Day 1, and administering the unit dose of rAAV particles to  the one eye of the individual on Day 8. In aspects of the methods, the anti‐VEGF agent comprises  aflibercept. In aspects of the method, the aflibercept is administered at a dose of about 2 mg by intravitreal  injection.

[0043] In aspects of the above methods, the unit dose of rAAV particles is between about 6 x 1010 to about  6 x 1011 vector genomes per eye (vg / eye).  In aspects of the above methods, the unit dose of rAAV particles Attorney Docket No.17234.045WO1 is between about 6 x 1010 to about 2 x 1011 vector genomes per eye (vg / eye).  In some aspects of the above  methods, the unit dose of rAAV particles is about  2 x 1011 vector genomes per eye (vg / eye).  In other  aspects of the above methods, the unit dose of rAAV particles is about 6 x 1011 vector genomes per eye  (vg / eye).

[0044] In aspects of any of the above methods, the individual has one or more symptoms of an ocular  neovascular disease in the contralateral eye.  Various aspects of the above methods further comprise  administering a unit dose of rAAV particle to the contralateral eye of the individual. Administering the unit  dose of rAAV particles to the contralateral eye is up to about 2 weeks after administering the unit dose of  rAAV particles to the one eye in some aspects. In some aspects, administering the unit dose of rAAV particle  to the contralateral eye is on the same day as the administering the unit dose of rAAV particles to the one  eye or the administering the unit dose of rAAV particles to the contralateral eye is between about 1 day to  about 14 days after administering the unit dose of rAAV particles to the one eye.  In some aspects, the unit  dose of rAAV particles administered to the contralateral eye of the individual comprises the same or less  vector genomes per eye (vg / eye) than the unit dose of rAAV particles administered to the one eye of the  individual. In some aspects, administering the unit dose of rAAV particles to the contralateral eye is at least  about 2 weeks after administering the unit dose of rAAV particles to the one eye.  In some aspects of the  above methods, the unit dose of rAAV particles administered to the contralateral eye of the individual  comprises more vector genomes per eye (vg / eye) than the unit dose of rAAV particles administered to the  one eye of the individual.

[0045] In aspects of any of the above methods, the nucleic acid comprises the nucleic acid sequence of  SEQ ID NO:40 or a sequence having at least 85% identity thereto.  In aspects of the above methods, the  polypeptide comprises the amino acid sequence of SEQ ID NO:35.  In aspects of any of the above methods,  the polypeptide comprises the amino acid sequence of SEQ ID NO:41.  In aspects of any of the methods, the  polypeptide is aflibercept.   In aspects of the methods, the nucleic acid further comprises a first enhancer  region, a promoter region, a 5’UTR region, a second enhancer region and a polyadenylation site.  In aspects  of the methods, the nucleic acid comprises, in the 5’ to 3’ order: (a) a first enhancer region (b) a promoter  region; (c) a 5’ UTR region; (d) a nucleic acid encoding a polypeptide comprising an amino acid sequence  with at least about 95% identity to the amino acid sequence of SEQ ID NO:35; (e) a second enhancer region;  and (f) a polyadenylation site, and flanked by AAV2 inverted terminal repeats (ITRs).  In some aspects, the  first enhancer region comprises a CMV sequence comprising the sequence of SEQ ID NO:22 or a sequence  having at least 85% identity thereto. In some aspects, the promoter region comprises a CMV sequence  comprising the sequence of SEQ ID NO:23 or a sequence having at least 85% identity thereto. In some  aspects of the methods, the nucleic acid encoding a polypeptide comprises the nucleic acid sequence of SEQ Attorney Docket No.17234.045WO1 ID NO:40 or a sequence having at least 85% identity thereto. In various aspects, the polypeptide comprises  the amino acid sequence of SEQ ID NO:35 or a sequence having at least 95% identity thereto.  In various  aspects, the polypeptide comprises the amino acid sequence of SEQ ID NO:41 or a sequence having at least  95% identity thereto.  In some aspects, the polypeptide is aflibercept.  In various aspects, the 5’UTR region  comprises, in 5’ to 3’ order, a TPL sequence comprising the sequence of SEQ ID NO:24 or a sequence having  at least 85% identity thereto, and an eMLP sequence comprising the sequence of SEQ ID NO:25 or a  sequence having at least 85% identity thereto.  In some aspects of the methods, the second enhancer region  comprises a full EES sequence comprising the sequence of SEQ ID NO:26 or a sequence having at least 85%  identity thereto.  In certain aspects of the methods, the polyadenylation site comprises an HGH  polyadenylation site comprising the sequence of SEQ ID NO:27 or a sequence having at least 85% identity  thereto.

[0046] In an aspect of the methods, the nucleic acid further comprises (a) a first enhancer region  comprising a CMV sequence comprising the sequence set forth in SEQ ID NO:22 or a sequence having at  least 85% identity thereto; (b) a promoter region, comprising a CMV sequence comprising the sequence of  SEQ ID NO:23 or a sequence having at least 85% identity thereto, (c) a 5’ UTR comprising in 5’ to 3’ order, a  TPL sequence comprising the sequence of SEQ ID NO:24 or a sequence having at least 85% identity thereto,  and an eMLP sequence comprising the sequence of SEQ ID NO:25 or a sequence having at leat 85% identity  thereto, (d) a second enhancer region comprising a full EES sequence comprising the sequence of SEQ ID  NO:26 or a sequence having at least 85% identity thereto, and (e) a HGH polyadenylation site comprising the  sequence of SEQ ID NO:27 or a sequence having at least 85% identity thereto.

[0047] In aspects of any of the methods, the nucleic acid comprises the sequence of SEQ ID NO:39 or a  sequence having at least 85% identity thereto.

[0048] In aspects of any of the above methods, the AAV2 capsid protein comprises the amino acid  sequence LGETTRPA (SEQ ID NO:1) inserted between positions 587 and 588 of the capsid protein, wherein  the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein comprising the sequence of  SEQ ID NO:13.  In aspects of any of the above methods, the AAV2 capsid protein comprises the amino acid  sequence LALGETTRPA (SEQ ID NO:1) inserted between positions 587 and 588 of the capsid protein, wherein  the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein comprising the sequence of  SEQ ID NO:13.

[0049] In aspects of any of the above methods, the rAAV particles comprise an AAV2 VP1 capsid protein  comprising a GH loop that comprises the amino acid sequence of SEQ ID NO:38 or an amino acid sequence  having at least 90% sequence identity to SEQ ID NO:38.   Attorney Docket No.17234.045WO1

[0050] Aspects of any of the above methods, wherein the administration of the unit dose of rAAV particles  to the one eye and / or the contralateral eye is by intravitreal administration are provided.

[0051] In aspects of any of the above methods, the unit dose of rAAV particles is in a pharmaceutical  formulation.  In some aspects, the pharmaceutical formulation comprises the rAAV particles, sodium  chloride, sodium phosphate and a surfactant. In an aspect of the above methods, the pharmaceutical  composition comprises about 150 to about 200 mM sodium chloride, about 1 to about 10 mM monobasic  sodium phosphate, about 1 to about 10 mM dibasic sodium phosphate, about 0.0005% (w / v) to about  0.0005% (w / v) poloxamer 188 and about 6 x 1013 to about 6 x 1010 vector genomes (vg) per mL (vg / ml) of  the rAAV particles wherein the pharmaceutical formulation has a pH of about 7.0 to about 7.5.  In some  aspects, the pharmaceutical composition comprises about 180 mM sodium chloride, about 5 mM monobasic  sodium phosphate, about 5 mM dibasic sodium phosphate, about 6 x 1012 vg / ml of the rAAV particles and  about 0.001% (w / v) poloxamer 188, wherein the pharmaceutical formulation has a pH of about 7.3. In some  aspects, the pharmaceutical composition comprises about 180 mM sodium chloride, about 5 mM monobasic  sodium phosphate, about 5 mM dibasic sodium phosphate, about 6 x 1011 vg / ml of the rAAV particles and  about 0.001% (w / v) poloxamer 188, wherein the pharmaceutical formulation has a pH of about 7.3.

[0052] In aspects of any of the above methods, the unit dose of rAAV particles administered to the one  eye and or to the contralateral eye is in a volume of about 25 µl to about 250 µl.  In some aspects, the unit  dose of rAAV particles administered to one eye and / or to the contralateral eye comprises a volume of about  100 µl.  In some aspects, the unit dose of rAAV particles administered to one eye and / or to the contralateral  eye comprises a volume of about 30 µl.

[0053] In aspects of the above methods, the individual received prior treatment for the ocular neovascular  disease with an anti‐VEGF agent.  In some aspects, the individual has received 1 or 2 injections of an anti‐ VEGF agent in the one eye and / or in the contralateral eye prior to administration of the rAAV particles in the  one eye and / or in the contralateral eye.

[0054] In aspects of some of the above methods, the individual has not received prior treatment for the  ocular neovascular disease with an anti‐VEGF agent.

[0055] In aspects of any one of the above methods, the anti‐VEGF agent is aflibercept.

[0056] In aspects of any one of the above methods, the ocular neovascular disease is wet age‐related  macular degeneration (AMD), retinal neovascularization, choroidal neovascularization diabetic retinopathy,  proliferative diabetic retinopathy, retinal vein occlusion, central retinal vein occlusion, branched retinal vein  occlusion, diabetic macular edema, diabetic retinal ischemia, ischemia retinopathy, diabetic retinal edema  or any combination thereof.  Attorney Docket No.17234.045WO1

[0057] In aspects of the above methods, the unit dose of rAAV particles is administered in combination  with steroid treatment. In certain aspects, the steroid treatment is a corticosteroid treatment.  In some  aspects, the steroid treatment is a systemic steroid treatment.  In various aspects, the steroid treatment is  an oral steroid treatment.  In some aspects, the steroid treatment is a prednisone treatment.  In certain  aspects of the methods, the steroid treatment is a topical steroid treatment.  In aspects of the methods, the  steroid treatment is a difluprednate treatment.  In aspects of the above methods, the steroid is  administered before, during and / or after administration of the unit dose of rAAV particles to the one eye  and / or to the contralateral eye.

[0058] In aspects of some methods, the steroid treatment is a topical steroid treatment and the topical  steroid treatment is a daily steroid treatment for up to about 4 weeks, up to about 6 weeks, or up to about 8  weeks from administering the unit dose of rAAV particles.  In some aspects of the above method, the topical  steroid treatment comprises about four administrations of a topical steroid per day on about week 1, about  three administrations of topical steroid per day on about week 2, about two administrations of topical  steroid per day on about week 3, and about one administration per day of topical steroid on about week 4;  timing starting with and following administration of the unit dose of rAAV particles. In some aspects of the  methods, the topical steroid treatment comprises about four administrations of topical steroid per day for  about three weeks after administration of the unit dose of rAAV particles, followed by about 3  administrations of topical steroid per day for about 1 week, followed by about 2 administrations of topical  steroid per day for about 1 week and followed by about 1 administration of topical steroid per day for about  1 week.  In some aspects of the methods, the topical steroid treatment comprises about four  administrations of topical steroid per day for about four weeks, followed by about three administrations of  topical steroid per day for about one week, followed by about two administrations of topical steroid per day  for about one week, followed by about one administration of topical steroid per day for about one week;  timing starting at about one week prior to administration of the unit dose of rAAV particles.

[0059] In some aspects of the methods, the methods further comprise administering a topical steroid  treatment.  In aspects of the methods, the topical steroid treatment is a difluprednate treatment.  In aspects  of the above methods, the topical steroid treatment comprises about four administrations of topical steroid  per day for about four weeks, followed by about three administrations of topical steroid per day for about  one week, followed by about two administrations of topical steroid per day for about one week, followed by  about one administration of topical steroid per day for about one week; timing starting with and following  administration of an anti‐VEGF agent. In aspects of the above methods, the topical steroid comprises  difluprednate 0.05% at a dose of about 1 µg to about 3 µg. In some aspects of the above methods, the  topical steroid comprises difluprednate 0.05% at a dose of about 2.5µg.   Attorney Docket No.17234.045WO1

[0060] In aspects of any of the above methods administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in maintenance of or a decrease of retinal  thickness compared to the retinal thickness prior to administration of the unit dose of rAAV particles. In  some aspects, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease in retinal thickness compared to the retinal thickness prior to  administration of the unit dose of rAAV particles. In certain aspects of the methods, the decrease in retinal  thickness is at least about 10% compared to the retinal thickness prior to administration of the unit dose of  rAAV particles.  In aspects of certain methods, the retinal thickness is central subfield thickness (CST) or  central retinal thickness (CRT).

[0061] In aspects of any of the above methods, administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in maintenance or a decrease in macular volume  compared to the macular volume prior to administration of the unit dose of rAAV particles.  In an aspect of  the methods, administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of  the individual results in a decrease in macular volume compared to the macular volume prior to  administration of the unit dose of rAAV particles. In aspect of the methods, the decrease in macular volume  is at least about 10% compared to the macular volume prior to administration of the unit dose of rAAV  particles.

[0062] In aspects of any of the above methods, the administering the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of the individual results in maintenance or an improvement of visual  acuity compared to the visual acuity prior to administration of the unit dose of rAAV particles.  In some  aspects of the methods, administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in an improvement of visual acuity compared to the visual acuity  prior to administration of the unit dose of rAAV particles.  In aspects of the methods, visual acuity is best  corrected visual acuity (BCVA).

[0063] In aspects of any of the above methods, administration of the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of a plurality of individuals results in at least about 50% of the  individuals in the plurality not requiring an anti‐VEGF rescue treatment.  In some aspects of the methods, at  least about 50% of the individuals in the plurality do not require an anti‐VEGF rescue treatment for at least  about 20 weeks, at least about 36 weeks, at least about 52 weeks, at least about 56 weeks or more after  administration of the unit dose of rAAV particles.

[0064] In aspects of any of the above methods, administration of the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of a plurality of individuals results in at least about 67% of the  individuals in the plurality not requiring an anti‐VEGF rescue treatment.  In some aspects of the methods, at Attorney Docket No.17234.045WO1 least about 67% of the individuals in the plurality do not require an anti‐VEGF rescue treatment for at least  about 20 weeks, at least about 36 weeks, at least about 52 weeks, at least about 60 weeks, at least about 64  weeks or at least about 66 weeks after administration of the unit dose of rAAV particles.

[0065] In aspects of the above methods, administration of the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of a plurality of individuals results in at least about 78% of the individuals in  the plurality not requiring an anti‐VEGF rescue treatment. In various aspects at least about 78% of the  individuals in the plurality do not require an anti‐VEGF rescue treatment for at least about 20 weeks, at least  about 36 weeks or mor after administration of the unit dose of rAAV particles.

[0066] In aspects of the above methods, administration of the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of a plurality of individuals results in 100% of the individuals in the plurality  not requiring an anti‐VEGF rescue treatment.  In aspects of the methods, 100% of the individuals in the  plurality do not require an anti‐VEGF rescue treatment for at least about 64 weeks, at least about 68 weeks,  at least about 72 weeks, at least about 76 weeks, at least about 80 weeks, at least about 84 weeks or more  after administration of the unit dose of rAAV particles.

[0067] Aspects of any of the above methods provide administration of the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of a plurality of individuals that results in a reduction in the  annualized anti‐VEFG injection rate of at least about 80%, at least about 85%, at least about 87%, at least  about 90%, at least about 95% at least about 99% or 100% compared to the annualized anti‐VEGF injection  rate prior to administration of the unit dose of rAAV particles.

[0068] In aspects of various methods, the ocular neovascular disease is wet age‐related macular  degeneration (AMD).

[0069] In aspects of various methods, the ocular neovascular disease is diabetic macular edema (DME).  In  various aspects, administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye  of the individual results in a 2‐step or in a 3‐step improvement in Diabetic Retinopathy Severity Score  (DRSS).

[0070] Embodiments of the application provide a unit dose of about 6 x 1011 vector genomes (vg) or less  of recombinant adeno‐associated virus (rAAV) particles for use in a method for treating an ocular  neovascular disease in an individual, the method comprising administering the unit dose to one eye of the  individual, wherein the individual is a human and wherein the rAAV particle comprise (a) a nucleic acid  encoding a polypeptide comprising an amino acid sequence with at least about 95% identity to the amino  acid sequence of SEQ ID NO:35 and flanked by AAV2 inverted terminal repeats (ITRs) and (b) an AAV2 capsid  protein comprising an amino acid sequence LGETTRP (SEQ ID NO:14) inserted between positions 587 and Attorney Docket No.17234.045WO1 588 of the capsid protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid  protein.

[0071] An embodiment of the application provides a unit dose of rAAV particles for use in a method of  reducing retinal fluid in an eye of an individual with an ocular neovascular disease, the method comprising  administering the unit dose to one eye of the individual, wherein the individual is human and wherein the  rAAV particles comprise (a) a nucleic acid encoding a polypeptide comprising an amino acid sequence with  at least about 95% identity to the amino acid sequence of SEQ ID NO:35 and flanked by AAV2 inverted  terminal repeats (ITRs) and (b) an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID  NO:14) inserted between positions 587 and 588 of the capsid protein, wherein the amino acid residue  numbering corresponds to an AAV2 VP1 capsid protein.  Aspects of the above unit doses for use in an  indicated method wherein the method further comprises administering an anti‐VEGF agent to one eye of  the individual before administration of the unit dose.    INCORPORATION BY REFERENCE

[0072] All references cited herein, including patent applications and publications, are incorporated by  reference in their entirety.  BRIEF DESCRIPTION OF THE DRAWINGS

[0073] Figure 1 provides a summary of collection eyes utilized In Life Humor Collections at the indicated  time points (30 days, 60 days and 98 days) in the aqueous humor (AH) or vitreous humor (VH).  The eye or  eyes from which the collection was made is indicated. “OD” signifies the ocular dexter or right eye.  “OS”  signifies the ocular sinister or left eye.  “OU” signifies oculus uterque or both eyes. The subject animal  identifier and group number are also indicated.

[0074] Figure 2 provides a table summarizing aflibercept levels obtained in the Vitreous Humor at the  indicated time points and in the indicated eye or eyes of the subject. BLOQ signifies “below the level of  quantitation”. Dosing is indicated in vg / eye. Eyes were treated with either 3E10 or 1E11 viral genomes  (vg) / treated eye. Subject animals are identified.

[0075] Figure 3 provides a table summarizing aflibercept levels obtained in the aqueous humor at the  indicated time points and in the indicated eye or eyes of the subject. BLOQ signifies “below the level of  quantitation”. Dosing is indicated in vg / eye. Eyes were treated with either 3E10 or 1E11 viral genomes  (vg) / treated eye. Subject animals are identified.

[0076] Figure 4 provides charts summarizing aqueous aflibercept concentrations in either the aqueous  humor or the vitreous humor. Peak aqueous Aflibercept values exceeded or approached 500 ng / mL after a  dose of 3.00E10 vg / mL. Animals were treated with a dose of 3.00E10 (gray) or 1.00E11 (black) vg / mL. Attorney Docket No.17234.045WO1 Aqueous and vitreous humor were collected at Days 30, 60, and 90 post‐dose. Aflibercept levels were  measured using an Aflibercept ELISA. The peak Aflibercept value detected in aqueous and vitreous humors  for each animal is represented here. Black horizonal bars denote group mean, black vertical bars denote  SEM, and asterisks denote outlier samples which are hypothesized to be the result of anti‐drug antibodies.

[0077] Figure 5 provides charts summarizing historical data of aqueous humor shows a flat dose response  over 3 logs of dosing levels. The chart on the right is in logarithmic scale.

[0078] Figure 6 provides graphs summarizing the distribution of ADVM‐022 vector genomes (vg) in tissues  of non‐human primates (NHPs) dosed with ADVM‐022 at 3x1010 (left) and 1x1011 vg / eye (right).  Tissues  were collected on Day 97 post‐dose.  “*” denotes data from right (R) and left (L) organs combined; LN  denotes lymph node; LGN denotes lateral geniculate nucleus.  Horizontal bars correspond to geometric  means. Dosing impacts the distribution of ADVM‐022 vg in some tissues more than other tissues.

[0079] Figure 7 provides graphs summarizing the distribution of ADVM‐022 expressed mRNA in tissues of  non‐human primates (NHPs) dosed with ADVM‐022 at 3x1010 (left) and 1x1011 vg / eye (right).  Tissues were  collected on Day 97 post‐does.  “*” denotes data from right (R) and left (L) organs combined; LN denotes  lymph node; LGN denotes lateral geniculate nucleus.  Horizontal bars correspond to geometric means.  Altered doses impact the expression of ADVM‐022 mRNA in certain tissues.

[0080] Figure 8 provides graphs summarizing the distribution of ADVM‐022 vector genomes (vg) in whole  blood of non‐human primates (NHPs) dosed with ADVM‐022 at 3x1010 (left) and 1x1011 vg / eye (right). The  time of the whole blood collection is indicate on the x‐axis.  Whole blood was collected at BL (Baseline), 8 h  (0.33 days), 48 h (2 days), 144 h (6 days), 336 h (14 days), 43 and 87 days post‐dose.

[0081] Figure 9 provides a visual representation of ADVM‐022 vector genome biodistribution in the NHP  eye dosed with 3E10 vg / eye.  Arrowheads point to some of ADVM‐022 DNA ‐ positive cells and extracellular  particles in photomicrographs of samples obtained from the indicated region. In the Macula (region A),  intracellular vector DNA is detected in the macular retinal ganglion cells and in the nuclear cell layer. In the  Mid‐retina (region B), no intracellular vector DNA is detected; vector DNA is detected as particles associated  with inner limiting membrane. In the Peripheral retina (region C), intracellular vector DNA is detected in the  retinal ganglion cell layer and in the nuclear cell layer. In the Ciliary body (region D), intracellular vector DNA  is detected in some nonpigmented epithelial cells of ciliary processes.

[0082] Figure 10 provides a visual representation of ADVM‐022 transgene mRNA biodistribution in the NHP  eye dosed with 3E10 vg / eye.  Arrowheads point to some of ADVM‐022 positive cells in photomicrographs of  samples obtained from the indicated region. In the Macula (region A), transgene mRNA is detected in the  macular retinal ganglion cells and in the nuclear cell layer. In the Peripheral retina (region b), transgene  mRNA is detected in the retinal ganglion cell layer and in the nuclear cell layer. In the Ciliary body (region c), Attorney Docket No.17234.045WO1 transgene mRNA is detected in some nonpigmented epithelial cells of ciliary processes and in the area of  ciliary muscle.

[0083] Figure 11 is a diagram depicting the design of the Phase 2 study of AAV2.7m8‐aflibercept in anti‐ VEGF treatment‐experienced patients with neovascular (wet) age‐related macular degeneration (nAMD) as  described in Example 1 herein. This study includes 8 study arms (Arms 1A, 1B, 2A, 2B, 3A, 3B, 4A, and 4B),  with participants in each arm receiving a single dose of AAV2.7m8‐aflibercept at a unit dose of 2×1011 vg / eye  or 6×1010 vg / eye, accompanied by a prophylactic corticosteroid treatment regimen (topical; IVT; topical +  oral; or IVT + oral). The study includes a screening period (14‐21 days), and a 50‐week study period following  dosing with AAV2.7m8‐aflibercept. IVT = intravitreal; nAb = neutralizing antibody; AFL = aflibercept; D = Day;  W = Week; q4W = every four weeks; CST = central subfield thickness; SD‐OCT = spectral domain optical  coherence tomography; CRC = central reading center; SOC = standard of care; mos = months; QID = 4 times  per day; TID = 3 times per day; BID = twice per day; QD = once per day; QOD = once every other day; wk =  week; PI = principal investigator.

[0084] Figures 12A and 12B provide graphs summarizing optimization of prophylaxis for IVT gene therapy.  Fig. 12A: Subjects received either ozurdex and oral prednisone or ozurdex, oral prednisone and  difluprednate.  The highest inflammatory anterior chamber (AC) cell grade was determined for subjects in  each cohort. In the absence of difluprednate, subjects were evenly distributed between Grade 0.5+ and  Grade 1+ to 2+.  One participant exhibited Grade 0, and one participant exhibited Grade 3+ inflammation.  In  the presence of difluprednate, significantly more participants exhibited Grade 0 AC inflammation than Grade  0.5+, Grade 1+ to 2+, or both Grade 0.5+ and Grade 1+ to 2+.  Fig. 12B: Subjects received either local  corticosteroids or local corticosteroids and oral prednisone. The highest inflammatory anterior cell grade  was determined for participants in each cohort. Approximately 79% of the local corticosteroid cohort  exhibited Grade 0 (79.4%), approximately 9% exhibited Grade 0.5+ (8.8%), and approximately 12% exhibited  Grade 1+‐2+ (11.8%).  Approximately 65% of the local corticosteroid plus oral prednisone cohort exhibited  Grade 0 (65%), approximately 25% exhibited Grade 0.5+ (25%), and approximately 10% exhibited Grade 1+‐ 2+ (10%). The addition of oral prednisone provided no additional benefit over local corticosteroids alone.

[0085] Figure 13 presents a swim lane plot summarizing data obtained from patients that previously  received Faricimab. Ten of ten patients previously receiving bispecific antibody faricimab remained free of  injection after a single ivt Ixo‐vec treatment out to 34 weeks post treatment.  These patients previously  received an average of more than 10 annualized injections. The Ixo‐vec treatment time is indicated.      Attorney Docket No.17234.045WO1 DETAILED DESCRIPTION

[0086] Several aspects are described below with reference to example applications for illustration. It  should be understood that numerous specific details, relationships, and methods are set forth to provide a  full understanding of the features described herein. One having ordinary skill in the relevant art, however,  will readily recognize that the features described herein can be practiced without one or more of the specific  details or with other methods. The features described herein are not limited by the illustrated ordering of  acts or events, as some acts can occur in different orders and / or concurrently with other acts or events.  Furthermore, not all illustrated acts or events are required to implement a methodology in accordance with  the features described herein.  Definitions

[0087] Unless otherwise defined, all technical terms used herein have the same meaning as commonly  understood by one of ordinary skill in the art.

[0088] The terminology used herein is for the purpose of describing particular examples only and is not  intended to be limiting. As used herein, the singular forms “a”, “an” and “the” are intended to include the  plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the  terms “including”, “includes”, “having”, “has”, “with”, or variants thereof are used in either the detailed  description and / or the claims, such terms are intended to be inclusive in a manner similar to the term  “comprising”.  The term “comprising” as used herein is synonymous with “including” or “containing”, and is  inclusive or open‐ended.

[0089] Any reference to “or” herein is intended to encompass “and / or” unless otherwise stated. As used  herein, the term “about” a number refers to that number plus or minus 10% of that number. The term  “about” a range refers to that range minus 10% of its lowest value and plus 10% of its greatest value.  Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed  to that value or parameter per se.

[0090] The term “subject”, “patient”, or “individual” refers to primates, such as humans and non‐human  primates, e.g., African green monkeys and rhesus monkeys. In some embodiments, the subject is a human.

[0091] The terms “treat,” “treating”, “treatment,” “ameliorate” or “ameliorating”  and other grammatical  equivalents as used herein, refer to alleviating, abating or ameliorating an ocular neovascular disease or  disorder, or symptoms of the ocular neovascular disease or disorder, preventing additional symptoms of the  ocular neovascular disease or disorder, ameliorating or preventing the underlying metabolic causes of  symptoms, inhibiting the ocular neovascular disease or disorder, e.g., arresting the development of the  ocular neovascular disease or disorder, relieving the ocular neovascular disease or disorder, causing Attorney Docket No.17234.045WO1 regression of the ocular neovascular disease or disorder, or stopping the symptoms of the ocular  neovascular disease or disorder, and are intended to include prophylaxis. The terms further include  achieving a therapeutic benefit and / or a prophylactic benefit. The term “therapeutic benefit” refers to  eradication or amelioration of the ocular neovascular disease or disorder being treated. Also, a therapeutic  benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms  associated with the ocular neovascular disease or disorder such that an improvement is observed in the  subject, notwithstanding that, in some embodiments, the subject is still afflicted with the ocular neovascular  disease or disorder. For prophylactic benefit, the pharmaceutical compositions are administered to a subject  at risk of developing the ocular neovascular disease or disorder, or to a subject reporting one or more of the  physiological symptoms of the ocular neovascular disease or disorder, even if a diagnosis of the disease or  disorder has not been made.

[0092] The terms “administer,” “administering”, “administration,” and the like, as used herein, can refer  to the methods that are used to enable delivery of therapeutics or pharmaceutical compositions to the  desired site of biological action. These methods include intravitreal or subretinal injection to an eye.

[0093] The terms “effective amount”, “therapeutically effective amount” or “pharmaceutically effective  amount” as used herein, can refer to a sufficient amount of at least one pharmaceutical composition or  compound being administered which will relieve to some extent one or more of the symptoms of the ocular  disease or disorder being treated.  An “effective amount”, “therapeutically effective amount” or  “pharmaceutically effective amount” of a pharmaceutical composition may be administered to a subject in  need thereof as a unit dose (as described in further detail elsewhere herein).

[0094] The term “pharmaceutically acceptable” as used herein, can refer to a material, such as a carrier or  diluent, which does not abrogate the biological activity or properties of a compound disclosed herein, and is  relatively nontoxic (i.e., when the material is administered to an individual it does not cause undesirable  biological effects nor does it interact in a deleterious manner with any of the components of the  composition in which it is contained).

[0095] The term “pharmaceutical composition,” or simply “composition” as used herein, can refer to a  biologically active compound, optionally mixed with at least one pharmaceutically acceptable chemical  component, such as, though not limited to carriers, stabilizers, diluents, dispersing agents, suspending  agents, thickening agents, excipients and the like.

[0096] An “AAV vector” or “rAAV vector” as used herein refers to an adeno‐associated virus (AAV) vector  or a recombinant AAV (rAAV) vector comprising a polynucleotide sequence not of AAV origin (e.g., a  polynucleotide heterologous to AAV such as a nucleic acid sequence that encodes a therapeutic transgene,  e.g., aflibercept) for transduction into a target cell or to a target tissue.  In general, the heterologous Attorney Docket No.17234.045WO1 polynucleotide is flanked by at least one, and generally by two, AAV inverted terminal repeat sequences  (ITRs). The term rAAV vector encompasses both rAAV vector particles and rAAV vector plasmids. A rAAV  vector may be either single‐stranded (ssAAV) or self‐complementary (scAAV).

[0097] An “AAV virus” or “AAV viral particle” or “rAAV vector particle” or “rAAV particle” refers to a viral  particle comprising at least one AAV capsid protein and a polynucleotide rAAV vector. In some cases, the at  least one AAV capsid protein is from a wild type AAV or is a variant AAV capsid protein (e.g., an AAV capsid  protein with an insertion, e.g., an insertion of the 7m8 amino sequence as set forth below). If the particle  comprises a heterologous polynucleotide (e.g., a polynucleotide other than a wild‐type AAV genome such as  a transgene to be delivered to a target cell or target tissue), it is referred to as a “rAAV particle”, “rAAV  vector particle” or a “rAAV vector”.  Thus, production of rAAV particles necessarily includes production of a  rAAV vector, as such a vector contained within a rAAV particle.

[0098] The term “packaging” as used herein can refer to a series of intracellular events that can result in  the assembly and encapsidation of a rAAV particle.

[0099] AAV “rep” and “cap” genes refer to polynucleotide sequences encoding replication and  encapsidation proteins of adeno‐associated virus. AAV rep and cap are referred to herein as AAV “packaging  genes.”

[0100] The term “polypeptide” can encompass both naturally occurring and non‐naturally occurring  proteins (e.g., a fusion protein), peptides, fragments, mutants, derivatives and analogs thereof. A  polypeptide may be monomeric, dimeric, trimeric, or polymeric. Further, a polypeptide may comprise a  number of different domains, each of which has one or more distinct activities. For the avoidance of doubt,  a “polypeptide” may be any length greater two amino acids.

[0101] As used herein, “polypeptide variant” or simply “variant” refers to a polypeptide whose sequence  contains an amino acid modification.  In some embodiments, the modification is an insertion, duplication,  deletion, rearrangement or substitution of one or more amino acids compared to the amino acid sequence  of a reference protein or polypeptide, such as a native or wild type protein. A variant may have one or more  amino acid point substitutions, in which a single amino acid at a position has been changed to another  amino acid, one or more insertions and / or deletions, in which one or more amino acids are inserted or  deleted, respectively, in the sequence of the reference protein, and / or truncations of the amino acid  sequence at either or both the amino or carboxy termini. A variant can have the same or a different  biological activity compared to the reference protein, or the unmodified protein.

[0102] In some embodiments, a variant can have, for example, at least about 80%, 85%, 90%, 91%, 92%,  93%, 94%, 95%, 96%, 97%, 98%, or 99% overall sequence homology to its counterpart reference protein. In  some embodiments, a variant can have at least about 90% overall sequence homology to the wild‐type Attorney Docket No.17234.045WO1 protein. In some embodiments, a variant exhibits at least about 95%, at least about 98%, at least about 99%,  at least about 99.5%, or at least about 99.9% overall sequence identity.

[0103] As used herein, “recombinant” can refer to a biomolecule, e.g., a gene or protein, that (1) has been  removed from its naturally occurring environment, (2) is not associated with all or a portion of a  polynucleotide in which the gene is found in nature, (3) is operatively linked to a polynucleotide which it is  not linked to in nature, or (4) does not occur in nature. The term “recombinant” can be used in reference to  cloned DNA isolates, chemically synthesized polynucleotide analogs, or polynucleotide analogs that are  biologically synthesized by heterologous systems, as well as proteins and / or mRNAs encoded by such nucleic  acids. Thus, for example, a protein synthesized by a microorganism is recombinant, for example, if it is  synthesized from an mRNA synthesized from a recombinant gene present in the cell.

[0104] The term “anti‐VEGF agent” includes any therapeutic agent, including proteins, polypeptides,  peptides, fusion protein, multimeric proteins, gene products, antibody, human monoclonal antibody,  antibody fragment, aptamer, small molecule, kinase inhibitor, receptor or receptor fragment, or nucleic acid  molecule, that can reduce, interfere with, disrupt, block and / or inhibit the activity or function of an  endogenous VEGF and / or an endogenous VEGF receptor (VEGFR), or the VEGF‐VEGFR interaction or  pathway in vivo. An anti‐VEGF agent can be any one of the known therapeutic agents that can reduce new  blood vessel growth or formation and / or oedem, or swelling, when delivered into a cell, tissue, or a subject  in vivo, e.g., ranibizumab, brolucizumab, or bevacizumab. In some embodiments, an anti‐VEGF agent can be  naturally occurring, non‐naturally occurring, or synthetic. In some embodiments, an anti‐VEGF agent can be  derived from a naturally occurring molecule that was subsequently modified or mutated to confer an anti‐  VEGF activity. In some embodiments, an anti‐VEGF agent is a fusion or chimeric protein. In such proteins,  functional domains or polypeptides are artificially fused to a moiety or a polypeptide to make a fusion or  chimeric protein that can sequester VEGF in vivo or function as a VEGFR decoy. In some embodiments, an  anti‐VEGF agent is a fusion or chimeric protein that blocks endogenous VEGFR from interacting with its  ligands.

[0105] As used herein, “VEGF” can refer to any isoform of VEGF, unless required otherwise, including, but  not limited to, VEGF‐A, VEGF‐B, VEGF‐C, VEGF‐D, VEGF‐E, VEGF‐F, or any combination, or any functional  fragment or variant thereof. Unless required otherwise, “VEGF” can refer to any member of the VEGF family,  including members: VEGF‐A, placenta growth factor (PGF), VEGF‐B, VEGF‐C, and VEGF‐D, or any  combination, functional fragment, or variant thereof.  As used herein, “VEGF receptor” or “VEGFR” or  “VEGF‐R” can be used to refer to any one of the receptors of VEGF, including, but not limited to, VEGFR‐1 (or  Flt‐1), VEGFR‐2 (or Flk‐1 / KDR), and VEGFR‐3 (or Flt‐4). VEGFR can be a membrane bound or soluble form, or Attorney Docket No.17234.045WO1 a functional fragment or truncation of a receptor.  Examples of anti‐VEGF agents include, but are not limited  to, ranibizumab, bevacizumab, brolucizumab, or any combination, variant, or functional fragment thereof.

[0106] “Operatively linked” or “operably linked” or “coupled” can refer to a juxtaposition of genetic  elements, wherein the elements are in a relationship permitting them to operate in an expected manner.  For instance, a promoter can be operatively linked to a coding region if the promoter helps initiate  transcription of the coding sequence. There may be intervening residues between the promoter and coding  region so long as this functional relationship is maintained.

[0107] The term “expression vector” or “expression construct” or “cassette” or “plasmid” or simply  “vector” can include any type of genetic construct, including AAV or rAAV vectors, containing a nucleic acid  or polynucleotide coding for a gene product in which part or all of the nucleic acid encoding sequence is  capable of being transcribed and is adapted for gene therapy. The transcript can be translated into a  protein. In some embodiments, the transcript is partially translated or not translated. In certain aspects,  expression includes both transcription of a gene and translation of mRNA into a gene product. In other  aspects, expression only includes transcription of the nucleic acid encoding genes of interest. An expression  vector can also comprise control elements operatively linked to the encoding region to facilitate expression  of the protein in target cells. The combination of control elements and a gene or genes to which they are  operably linked for expression can sometimes be referred to as an “expression cassette,” a large number of  which are known and available in the art or can be readily constructed from components that are available  in the art.

[0108] The term “heterologous” can refer to an entity that is genotypically distinct from that of the rest of  the entity to which it is being compared. For example, a polynucleotide introduced by genetic engineering  techniques into a plasmid or vector derived from a different species can be a heterologous polynucleotide. A  promoter removed from its native coding sequence and operatively linked to a coding sequence with which  it is not naturally found linked can be a heterologous promoter.

[0109] As used herein, “7m8” refers to the amino acid sequence LALGETTRPA (SEQ ID NO: 1).

[0110] “7m8 variant” refers to a rAAV, which can be of any serotype, with the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) inserted in the solvent exposed GH loop of the capsid protein.

[0111] When 7m8 is inserted in a rAAV2 (also referred to as AAV2.7m8), the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) is inserted into the GH loop within amino acids 570‐611 of the AAV2 capsid  protein, e.g., between positions 587 and 588 of the AAV2 capsid protein, VP1. In some cases, when 7m8 is  inserted in a rAAV2 (also referred to as AAV2.7m8), the amino acid sequence LALGETTRPA (SEQ ID NO: 1) is  inserted into the GH loop of the AAV2 capsid protein, e.g., between positions 587 and 588 of AAV2 VP1  comprising the sequence of SEQ ID NO: 13. When 7m8 is inserted in a rAAV1 (also referred to as AAV1.7m8), Attorney Docket No.17234.045WO1 the amino acid sequence LALGETTRPA (SEQ ID NO: 1) is inserted into the GH loop within amino acids 571‐ 612 of the AAV1 capsid protein, e.g., between amino acids 590 and 591 of the AAV1 capsid protein. When  7m8 is inserted in a rAAV5 (also referred to as AAV5.7m8), the amino acid sequence LALGETTRPA (SEQ ID  NO: 1) is inserted into the GH loop within amino acids 560‐601 of the AAV5 capsid protein, e.g., between  amino acids 575 and 576 of the AAV5 capsid protein. When 7m8 is inserted in a rAAV6 (also referred to as  AAV6.7m8), the amino acid sequence LALGETTRPA (SEQ ID NO: 1) is inserted into the GH loop within amino  acids 571 to 612 of the AAV6 capsid protein, e.g., between amino acids 590 and 591 of the AAV6 capsid  protein. When 7m8 is inserted in a rAAV7 (also referred to as AAV7.7m8), the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) is inserted into the GH loop within amino acids 572 to 613 of the AAV7 capsid  protein, e.g., between amino acids 589 and 590 of the AAV7 capsid protein. When 7m8 is inserted in a  rAAV8 (also referred to as AAV8.7m8), the amino acid sequence LALGETTRPA (SEQ ID NO: 1) is inserted into  the GH loop within amino acids 573 to 614 of the AAV8 capsid protein, e.g., between amino acids 590 and  591 of the AAV8 capsid protein. When 7m8 is inserted in a rAAV9 (also referred to as AAV9.7m8), the amino  acid sequence LALGETTRPA (SEQ ID NO: 1) is inserted into the GH loop of the AAV9 capsid protein, e.g.,  between amino acids 588 and 589 of the AAV9 capsid protein. When 7m8 is inserted in a rAAV10 (also  referred to as AAV10.7m8), the amino acid sequence LALGETTRPA (SEQ ID NO: 1) is inserted into the GH  loop within amino acids 573 to 614 of the AAV10 capsid protein, e.g., between amino acids 589 and 590 of  the AAV10 capsid protein.   Overview

[0112] Current therapies (e.g., aflibercept recombinant protein, ranibizumab recombinant protein) for  ocular neovascular diseases such as wAMD require lifelong IVT administration approximately every 4‐8  weeks. This can increase the risk of inflammation, infection, and other adverse effects in some patients.  Further, current therapies create compliance challenges due to repeated and / or frequent trips to medical  offices for administration of the therapy, especially in elderly patients, who are most affected with wAMD.  Reduction in frequency of administration is associated with vision loss and deterioration of the eye disease  or condition. The ability of AAV vectors to efficiently transduce target retinal cells following IVT injection has  been exploited to successfully transfer therapeutic genes into photoreceptors, retinal pigment epithelium,  and the inner retina to treat a variety of retinal diseases. Thus, administration of rAAV particles encoding an  anti‐VEGF agent (e.g., aflibercept) can provide prolonged and / or sustained release of the anti‐VEGF agent in  vivo.

[0113] Surprisingly, administration of a single low unit dose of 6 × 1011 vector genomes (vg) per eye of  rAAV particles encoding aflibercept to the eyes of individuals with an ocular neovascular disease led to Attorney Docket No.17234.045WO1 stabilization of the disease and a robust anatomical response in all treated individuals (See Example 1). In  addition, visual acuity was stabilized in all treated individuals and none of the individuals required rescue  anti‐VEGF treatment (e.g., aflibercept IVT injections) after administration of the single low unit dose of 6 ×  1011 vg / eye of rAAV particles encoding aflibercept. Moreover, administration of the single unit dose of rAAV  particles encoding aflibercept to the eyes of individuals with an ocular neovascular disease unexpectedly  caused a reduction (e.g., resolution) of symptoms, including intraretinal and subretinal fluid that were  refractory to prior anti‐VEGF treatments (e.g., chronic IVT injections of aflibercept, ranibizumab, or  bevacizumab).

[0114] Accordingly, the present disclosure provides methods of treating an ocular neovascular disease in  an individual by administering a single unit dose of 6 × 1011 vg / eye or less of rAAV particles encoding an anti‐ VEGF agent (e.g., aflibercept). In addition, the present disclosure provides methods for reducing retinal fluid  in the eye of an individual with an ocular neovascular disease by administering a single unit dose of rAAV  particles encoding an anti‐VEGF agent (e.g., aflibercept). The methods disclosed herein reduce or eliminate  the need for repeated IVT injections while providing long‐term efficacy, thereby addressing the non‐ compliance and non‐adherence problem. In addition, the methods provided herein reduce the adverse  effects associated with multiple IVT injections.     Methods of Treatment

[0115] Provided herein is a method for treating an ocular neovascular disease in an individual, the method  comprising administering a unit dose of recombinant adeno‐associated virus (rAAV) particles to an eye of  the individual.

[0116] Also provided herein is a method for reducing retinal fluid in the eye of an individual with an ocular  neovascular disease, the method comprising administering a unit dose of rAAV particles to an eye of the  individual.

[0117] Also provided herein is a method for treating an ocular neovascular disease in an individual, the  method comprising administering an anti‐VEGF agent (e.g., aflibercept) to an eye of the individual, and  administering a unit dose of recombinant adeno‐associated virus (rAAV) particles to the eye of the individual  after administration of the anti‐VEGF agent.

[0118] In some embodiments, the ocular neovascular disease is wet age‐related macular degeneration  (wAMD), retinal neovascularization, choroidal neovascularization diabetic retinopathy, proliferative diabetic  retinopathy, retinal vein occlusion, central retinal vein occlusion, branched retinal vein occlusion, diabetic  macular edema, diabetic retinal ischemia, ischemic retinopathy, diabetic retinal edema, or any combination  thereof. Attorney Docket No.17234.045WO1

[0119] In some embodiments, the term ocular neovascular disease also encompasses VEGF‐driven pre‐ neovascular diseases which, if left untreated, progress to a neovascular form.  In some embodiments, the  ocular neovascular disease is the pre‐neovascular disease, non‐proliferative diabetic retinopathy.

[0120] In some embodiments, the individual is a human. In some embodiments, the individual received at  least one prior treatment (e.g., at least one, at least two, at least three, at least four, at least 5 or more  treatments) for the ocular neovascular disease with an anti‐VEGF agent (e.g., bevacizumab, brolucizumab,  ranibizumab, faricimab, abicipar pegol, conbercept, OPT‐302, KSI‐301, injectable sunitinib maleate (GB‐102),  PAN‐90806 (PanOptica), and / or aflibercept) in about the last 8 weeks, about the last 9 weeks, about the last  10 weeks, about the last 11 weeks, about the last 12 weeks, about the last 13 weeks, about the last 14  weeks, about the last 15 weeks, or about the last 16 weeks prior to administration of the unit dose of rAAV  particles. In some embodiments, the individual demonstrated a meaningful response to a prior treatment  with anti‐VEGF agent (e.g., bevacizumab, brolucizumab, ranibizumab, faricimab, abicipar pegol, conbercept,  OPT‐302, KSI‐301, injectable sunitinib maleate (GB‐102), PAN‐90806 (PanOptica), and / or aflibercept). In  some embodiments, the anti‐VEGF agent is aflibercept, a functional variant thereof, or a functional fragment  thereof. In some embodiments, the anti‐VEGF agent comprises a polypeptide comprising an amino acid  sequence with at least about 95% identity to the amino acid sequence of SEQ ID NO: 35. In some  embodiments, the retinal fluid in the eye of an individual is intraretinal fluid (IRF) and / or subretinal fluid  (SRF). In some embodiments, the amount or presence of retinal fluid in the eye of the individual is refractory  to prior treatment with an anti‐VEGF agent (e.g., bevacizumab, brolucizumab, ranibizumab, faricimab,  abicipar pegol, conbercept, OPT‐302, KSI‐301, injectable sunitinib maleate (GB‐102), PAN‐90806  (PanOptica), and / or aflibercept). In some embodiments, the anti‐VEGF agent is aflibercept, a functional  variant thereof, or a functional fragment thereof. In some embodiments, the anti‐VEGF agent comprises a  polypeptide comprising an amino acid sequence with at least about 95% identity to the amino acid  sequence of SEQ ID NO: 35.

[0121] In some embodiments, the ocular neovascular disease is diabetic macular edema (DME). In some  embodiments, the individual is a human. In some embodiments, the individual has type 1 or type 2 diabetes  mellitus. In some embodiments, the individual has vision impairment that is due to center involving diabetic  macular edema. In some embodiments, the individual has visual acuity (BCVA) of  between about 78 to 50  ETDRS letters (e.g., any of 50, 51, 52, 53 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71,  72, 73, 74, 75, 76, 77, or 78 ETDRS letters) in the eye administered the rAAV particles prior to administration  of the unit dose of rAAV particles. In some embodiments, the individual has visual acuity (Snellen  equivalent) of between about 20 / 32 to about 20 / 100 in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual has a central subfield Attorney Docket No.17234.045WO1 thickness (CST) of ≥ 325μm using Heidelberg Spectralis® with center‐involving IRF (center 1 mm) in the eye  administered the rAAV particles prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual has a decrease in vision in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles that is primarily due to diabetic macular edema. In some  embodiments, the individual was diagnosed with diabetic macular edema in the eye administered the rAAV  particles about 6 months or less prior to administration of the unit dose of rAAV particles, e.g., any of about  6 months, about 5 months, about 4 months, about 3 months, about 2 months, about 1 month, or less, prior  to administration of the unit dose of rAAV particles. In some embodiments, the individual received 0, 1, or 2  prior treatments for DME in the eye administered the rAAV particles, e.g., 0, 1, or 2 intravitreal injections  with an anti‐VEGF agent, e.g., aflibercept, prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual received the prior treatments with an anti‐VEGF agent in the eye administered  the rAAV particles at least about 60 days (i.e., about 2 months) prior to administration of the unit dose of  rAAV particles. In some embodiments, the individual exhibited a meaningful response in central subfield  thickness to the prior treatments with an anti‐VEGF agent in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles, for example, at least a 10% reduction in central subfield  thickness. In some embodiments, the individual did not experience an adverse reaction to the prior  treatments with an anti‐VEGF agent prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have neutralizing antibodies to AAV2.7m8 prior to administration of  the unit dose of rAAV particles. In some embodiments, the individual does not have an anti‐AAV2.7m8  neutralizing antibody titer of greater than 1:125 prior to administration of the unit dose of rAAV particles,  e.g., within about 6 months prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have a history of allergy to aflibercept, corticosteroids, or fluorescein  dye or sodium fluorescein (e.g., used in angiography) prior to administration of the unit dose of rAAV  particles. In some embodiments, the individual has a history of mild allergy to aflibercept, corticosteroid, or  fluorescein dye or sodium fluorescein (e.g., used in angiography) prior to administration of the unit dose of  rAAV particles, wherein the allergy is amenable to treatment. In some embodiments, the individual does not  have uncontrolled diabetes, e.g., HbA1C of greater than 10%, prior to administration of the unit dose of  rAAV particles. In some embodiments, the individual does not have a history of diabetic ketoacidosis within  about 3 months prior to administration of the unit dose of rAAV particles. In some embodiments, the  individual has not initiated intensive insulin treatment, e.g., with an insulin pump or multiple daily insulin  injections, prior to administration of the unit dose of rAAV particles. In some embodiments, the individual  does not plan to initiate intensive insulin treatment, e.g., with an insulin pump or multiple daily insulin  injections, within about 3 months after administration of the unit dose of rAAV particles. In some Attorney Docket No.17234.045WO1 embodiments, the individual does not have a history of systemic autoimmune disease that requires  treatment with systemic steroids or immunosuppressive treatments, e.g., methotrexate or adalimumab,  prior to administration of the unit dose of rAAV particles. In some embodiments, the individual is not being  administered a systemic drug known to cause macular edema, such as fingolimod, tamoxifen, chloroquine,  or hydroxychloroquine, prior to administration of the unit dose of rAAV particles. In some embodiments, the  individual is not being administered a systemic anti‐VEGF treatment prior to administration of the unit dose  of rAAV particles. In some embodiments, the individual does not have high‐risk proliferative diabetic  retinopathy (PDR) in the eye administered the rAAV particles prior to administration of the unit dose of  rAAV particles. In some embodiments, PDR is defined as any vitreous or preretinal hemorrhage,  neovascularization elsewhere >1 / 2‐disc area within an area equivalent to standard ETDRS 7‐field on clinical  examination, or neovascularization of disc > 1 / 3‐disc area on clinical examination. In some embodiments,  the individual does not have focal or grid laser photocoagulation in the eye administered the rAAV particles  prior to administration of the unit dose of rAAV particles. In some embodiments, the individual does not  have any prior pan retinal photocoagulation (PRP) in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual has not received an  anti‐VEGF therapy (e.g., aflibercept IVT injections) in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual has not received an  anti‐VEGF therapy (e.g., aflibercept IVT injections) in the eye administered the rAAV particles for at least 60  days prior to administration of the unit dose of rAAV particles. In some embodiments, the individual has not  received more than two anti‐VEGF treatments (e.g., aflibercept IVT injections) in the eye administered the  rAAV particles prior to administration of the unit dose of rAAV particles. In some embodiments, the  individual does not have a history of any of anterior segment neovascularization (e.g., neovascularization of  the iris [NVI] or neovascular glaucoma [NVG]), significant vitreous hemorrhage, fibrovascular proliferation,  or tractional retinal detachment in the eye administered the rAAV particles prior to administration of the  unit dose of rAAV particles. In some embodiments, the individual does not have structural abnormalities at  the fovea (e.g., any of dense hard exudates, pigment abnormalities, foveal atrophy, vitreomacular traction  or epiretinal membrane) in the eye administered the rAAV particles that contribute to macular edema or  visual impairment prior to administration of the unit dose of rAAV particles.  In some embodiments,  structural abnormalities at the fovea are assessed on clinical examination or OCT. In some embodiments,  the individual does not have a history of retinal disease other than diabetic retinopathy (e.g., age‐related  macular degeneration (in either eye), retinal vein occlusion, retinal arterial occlusion, or pathologic myopia)  in the eye administered the rAAV particles prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have history of ocular disease other than diabetic macular edema in Attorney Docket No.17234.045WO1 the eye administered the rAAV particles, e.g., a significant cataract or macular traction, or evidence of  posterior subcapsular cataract, prior to administration of the unit dose of rAAV particles.  In some  embodiments, the individual does not have history of cataract extraction or Yttrium Aluminum Garnet (YAG)  capsulotomy in the eye administered the rAAV particles within at least about 3 months prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual does not have a  history of retinal detachment (with or without repair) in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual does not have a  history of any of trabeculectomy, glaucoma shunt, or minimally invasive glaucoma surgery (MIGS) in the eye  administered the rAAV particles prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have a history of vitrectomy or other filtration surgery in the eye  administered the rAAV particles prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have aphakia or presence of an anterior chamber intraocular lens in  the eye administered the rAAV particles prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have uncontrolled ocular hypertension or glaucoma in the eye  administered the rAAV particles, e.g., IOP >22 mmHg despite treatment with anti‐glaucoma medication or  current use of >2 IOP lowering medications, prior to administration of the unit dose of rAAV particles. In  some embodiments, the individual does not have a history of intraocular or periocular steroid treatment for  any ocular condition (e.g., IVT Triesence, Iluvien or Ozurdex) in the eye administered the rAAV particles prior  to administration of the unit dose of rAAV particles. In some embodiments, the individual has not had  refractive surgery in the eye administered the rAAV particles within at least about 90 days prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual does not have  previous penetrating keratoplasty, endothelial keratoplasty, or ocular radiation in the eye administered the  rAAV particles prior to administration of the unit dose of rAAV particles. In some embodiments, the  individual has not had any prior vitreoretinal surgery in the eye administered the rAAV particles prior to  administration of the unit dose of rAAV particles. In some embodiments, the individual does not have a  history of uveitis or intraocular inflammation, e.g., grade trace or above except mild anticipated post‐ operative inflammation that resolved, prior to administration of the unit dose of rAAV particles. In some  embodiments, the individual does not have a history of IOP elevation that is related to topical steroid  administration prior to administration of the unit dose of rAAV particles. In some embodiments, the  individual does not have a history of ocular Herpes Simplex Virus (HSV), Varicella‐zoster virus (VZV), or  Cytomegalovirus (CMV), including viral uveitis, retinitis or keratitis prior to administration of the unit dose of  rAAV particles. In some embodiments, the individual does not have evidence of any of external ocular  infection, including conjunctivitis, chalazion, or significant blepharitis prior to administration of the unit dose Attorney Docket No.17234.045WO1 of rAAV particles. In some embodiments, the individual does not have history of ocular toxoplasmosis prior  to administration of the unit dose of rAAV particles.

[0122] In some embodiments, the unit dose is expressed as the number of vector genomes (vg). In some  embodiments, the unit dose is about 6 × 1011 vector genomes (vg) or less of the rAAV particles. In some  embodiments, the unit dose is expressed as the number of vector genomes (vg) per eye (vg / eye). In some  embodiments, the unit dose is about 6 × 1011 vg / eye or less of the rAAV particles, e.g., 1 × 1011 vg / eye. In  some embodiments, the unit dose of rAAV particles is about 6 × 1010 to about 2 × 1011 vg / eye. In some  embodiments the unit dose is 3 × 1011 vg / eye.  In some embodiments, the unit dose of rAAV particles is  about 2 × 1011 or about 6 × 1010 vg / eye.

[0123] In some embodiments, the unit dose of rAAV particles is administered to one eye of the individual.  In some embodiments, the one eye of the individual is the right eye or the left eye. In some embodiments,  the one eye of the individual is the right eye. In some embodiments, the one eye of the individual is the left  eye. In some embodiments, the methods provided herein further comprise administering a unit dose of  rAAV particles to the contralateral eye of the individual. In some embodiments, the one eye of the individual  is the right eye and the contralateral eye is the left eye.  In some embodiments, the one eye of the individual  is the left eye and the contralateral eye is the right eye.

[0124] In some embodiments, the administering the unit dose of rAAV particles to the contralateral eye of  the individual is up to about 2 weeks (e.g., about 0 days, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days,  8 days, 9 days, 10 days, 11 days, 12 days, 13 days, or 14 days) after administering the unit dose of rAAV  particles to the one eye. In some embodiments, the unit dose of rAAV particles administered to the  contralateral eye of the individual is about the same as (e.g., less than 1% higher or lower, less than 5%  higher or lower, less than 10% higher or lower, or less than 20% higher or lower) or lower (e.g., about 5%,  about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, or about 90%  lower) than the unit dose of rAAV particles administered to the one eye of the individual.

[0125] In some embodiments, the administering the unit dose of rAAV particles to the contralateral eye is  at least about 2 weeks (e.g., at least about 2 weeks, at least about 3 weeks, at least about 4 weeks, at least  about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5  months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months,  at least about 10 months, at least about 11 months, at least about 12 months, at least about 1 year, at least  about 2 years, at least about 3 years, at least about 4 years, at least about 5 years, or more) after  administering the unit dose of rAAV particles to the one eye. In some embodiments, the unit dose of rAAV  particles administered to the contralateral eye of the individual is higher (e.g., any of about 5%, about 10%,  about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 100%, Attorney Docket No.17234.045WO1 about 125%, about 150%, about 175%, about 200%, about 225%, about 250%, about 275%, about 300%, or  more, higher) than the unit dose of rAAV particles administered to the one eye of the individual.

[0126] In some embodiments, the rAAV particles comprise a) a nucleic acid encoding a polypeptide  comprising an amino acid sequence with at least about 95%, at least about 96%, at least about 97%, at least  about 98%, at least about 99%, at least about 99.99%, or 100% identity to the amino acid sequence of SEQ  ID NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs), and b) an AAV2 capsid protein comprising  an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid  protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. The  sequence of SEQ ID NO: 35 is provided below:    SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLY KTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTI DGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPG (SEQ ID NO: 35)

[0127] In some embodiments, the rAAV particles comprise a) a nucleic acid encoding a polypeptide  comprising an amino acid sequence with at least about 95% identity to the amino acid sequence of SEQ ID  NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs), and b) an AAV2 capsid protein comprising an  amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid  protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein.

[0128] In some embodiments, the rAAV particles comprise a nucleic acid encoding a polypeptide  comprising an amino acid sequence with at least about 80%, at least about 85%, at least about 90%, at least  about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about  99.99%, or 100% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted  terminal repeats (ITRs). In some embodiments, the rAAV particles comprise a nucleic acid encoding a  polypeptide comprising an amino acid sequence with at least about 95% identity to the amino acid  sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs). In some embodiments, the  polypeptide comprises the amino acid sequence of SEQ ID NO: 35. In some embodiments, the polypeptide is  aflibercept or a functional variant thereof or functional fragment thereof.

[0129] In some embodiments, the rAAV particles comprise a nucleic acid comprising a codon‐optimized  sequence encoding an amino acid sequence with at least about 80%, at least about 85%, at least about 90%, Attorney Docket No.17234.045WO1 at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least  about 99.99%, or 100% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted  terminal repeats (ITRs). In some embodiments, the rAAV particles comprise a nucleic acid comprising a  codon‐optimized sequence encoding an amino acid sequence with at least about 95% identity to the amino  acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs). In some  embodiments, the rAAV particles comprise a nucleic acid comprising a codon‐optimized sequence encoding  an amino acid sequence with 100% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by  AAV2 inverted terminal repeats (ITRs).

[0130] In some embodiments, the rAAV particles comprise a nucleic acid comprising the cDNA sequence  of aflibercept or a functional variant thereof or functional fragment thereof and flanked by AAV2 inverted  terminal repeats (ITRs). In some embodiments, the rAAV particles comprise a nucleic acid comprising a  codon‐optimized cDNA sequence of aflibercept or a functional variant thereof or functional fragment  thereof and flanked by AAV2 inverted terminal repeats (ITRs). In some embodiments, the rAAV particles  comprise a nucleic acid comprising the nucleic acid sequence of SEQ ID NO: 36.

[0131] In some embodiments, the nucleic acid further comprises (a) a first enhancer region comprising a  CMV sequence; (b) a promoter region comprising a CMV sequence; (c) a 5'UTR region comprising, in the 5'  to 3' order, a TPL sequence and an eMLP sequence; (d) a second enhancer region comprising a full EES  sequence; and (e) a HGH polyadenylation site. In some embodiments, the enhancer region comprising a  CMV sequence comprises the sequence of SEQ ID NO: 22. In some embodiments, the promoter region  comprising a CMV sequence comprises the sequence of SEQ ID NO: 23. In some embodiments, the TPL  sequence comprises the sequence of SEQ ID NO: 24. In some embodiments, the eMLP sequence comprises  the sequence of SEQ ID NO: 25. In some embodiments, the second enhancer region comprising a full EES  sequence comprises the sequence of SEQ ID NO: 26. In some embodiments, the HGH polyadenylation site  comprises the sequence of SEQ ID NO: 27.

[0132] In some embodiments, the rAAV particles comprise an AAV2 capsid protein comprising the amino  acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the AAV2 VP1  comprising the sequence of SEQ ID NO: 13. The sequence of SEQ ID NO: 13 is provided below:  MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLD  KGEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQ  AKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDAD  SVPDPQPLGQPPAAPSGLGTNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVI  TTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLI Attorney Docket No.17234.045WO1 NNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQG  CLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPF  HSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPG  PCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVL  IFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNRQAATADVNTQGV  LPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTT  FSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVY  SEPRPIGTRYLTRNL (SEQ ID NO: 13)

[0133] In some embodiments, the rAAV particles comprise an AAV2 capsid protein comprising the amino  acid sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid protein,  wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some  embodiments, the rAAV particles comprise an AAV2 capsid protein comprising the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the AAV2 VP1 comprising the  sequence of SEQ ID NO: 13.

[0134] In some embodiments, the rAAV particles comprise an AAV2 capsid protein comprising any of the  following amino acid sequences inserted between positions 587 and 588 of the capsid protein, wherein the  amino acid residue numbering corresponds to an AAV2 VP1 capsid protein: LALGETTRPA (SEQ ID NO: 1);  LANETITRPA (SEQ ID NO: 2), LAKAGQANNA (SEQ ID NO: 3), LAKDPKTTNA (SEQ ID NO: 4), KDTDTTR (SEQ ID  NO: 5), RAGGSVG (SEQ ID NO: 6), AVDTTKF (SEQ ID NO: 7), STGKVPN (SEQ ID NO: 8), LAKDTDTTRA (SEQ ID  NO: 9), LARAGGSVGA (SEQ ID NO: 10), LAAVDTTKFA (SEQ ID NO: 11), LASTGKVPNA (SEQ ID NO: 12), LGETTRP  (SEQ ID NO: 14), NETITRP (SEQ ID NO: 15), KAGQANN (SEQ ID NO: 16), KDPKTTN (SEQ ID NO: 17), KDTDTTR  (SEQ ID NO: 18), RAGGSVG (SEQ ID NO: 19), AVDTTKF (SEQ ID NO: 20), and STGKVPN (SEQ ID NO: 21). In  some embodiments, the rAAV particles comprise an AAV2 capsid protein comprising any of the following  amino acid sequences inserted between positions 587 and 588 of the AAV2 VP1 comprising the sequence of  SEQ ID NO: 13: LALGETTRPA (SEQ ID NO: 1); LANETITRPA (SEQ ID NO: 2), LAKAGQANNA (SEQ ID NO: 3),  LAKDPKTTNA (SEQ ID NO: 4), KDTDTTR (SEQ ID NO: 5), RAGGSVG (SEQ ID NO: 6), AVDTTKF (SEQ ID NO: 7),  STGKVPN (SEQ ID NO: 8), LAKDTDTTRA (SEQ ID NO: 9), LARAGGSVGA (SEQ ID NO: 10), LAAVDTTKFA (SEQ ID  NO: 11), LASTGKVPNA (SEQ ID NO: 12), LGETTRP (SEQ ID NO: 14), NETITRP (SEQ ID NO: 15), KAGQANN (SEQ  ID NO: 16), KDPKTTN (SEQ ID NO: 17), KDTDTTR (SEQ ID NO: 18), RAGGSVG (SEQ ID NO: 19), AVDTTKF (SEQ  ID NO: 20), and STGKVPN (SEQ ID NO: 21).

[0135] In some embodiments, the administration of the unit dose of rAAV particles to the one eye and / or  to the contralateral eye of the individual is by intravitreal (IVT) injection, intraocular administration, or Attorney Docket No.17234.045WO1 intraretinal injection.  In some embodiments, the administration of the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of the individual is by intravitreal (IVT) injection.

[0136] In some embodiments, the unit dose of rAAV particles is in a pharmaceutical formulation. In some  embodiments, the pharmaceutical formulation comprises the rAAV particles, one or more osmotic or ionic  strength agents, one or more buffering agents, one or more surfactants, and one or more solvents. In some  embodiments, the osmotic or ionic strength agent is sodium chloride. In some embodiments, the one or  more buffering agents are sodium phosphate monobasic and / or sodium phosphate dibasic. In some  embodiments, the surfactant is Poloxamer 188. In some embodiments, the solvent is water. In some  embodiments, the pharmaceutical formulation comprises the rAAV particles, sodium chloride, sodium  phosphate and a surfactant.  In some embodiments, the pharmaceutical formulation comprises about  1×1010 vg / mL to about 1×1013 vg / mL of rAAV particles. In some embodiments, the pharmaceutical  formulation comprises about 6×1011 vg / mL to about 6×1012 vg / mL of rAAV particles. In some embodiments,  the pharmaceutical formulation comprises about 150 mM to about 200 mM sodium chloride (e.g., any of  about 150 mM, about 160 mM, about 170 mM, about 180 mM, about 190 mM, or about 200 mM). In some  embodiments, the pharmaceutical formulation comprises about 1 mM to about 10 mM monobasic sodium  phosphate (e.g., about 1mM, about 2 mM, about 3 mM, about 4 mM, about 5 mM, about 6 mM, about 7  mM, about 8 mM, about 9 mM, or about 10 mM). In some embodiments, the pharmaceutical formulation  comprises about 1 mM to about 10 mM dibasic sodium phosphate (e.g., about 1mM, about 2 mM, about 3  mM, about 4 mM, about 5 mM, about 6 mM, about 7 mM, about 8 mM, about 9 mM, or about 10 mM). In  some embodiments, the pharmaceutical formulation comprises about 0.0005% (w / v) to about 0.005% (w / v)  poloxamer 188 (e.g., any of about 0.0005% (w / v), 0.0006% (w / v) , 0.0007% (w / v) , 0.0008% (w / v) , 0.0009%  (w / v), 0.001% (w / v) , 0.002% (w / v) , 0.003% (w / v) , 0.004% (w / v), or about 0.005% (w / v)). In some  embodiments, the pharmaceutical formulation has a pH of about 7.0 to about 7.5 (e.g., any of about 7.0,  about 7.1, about 7.2, about 7.3, about 7.4, or about 7.5).  In some embodiments, the pharmaceutical  formulation comprises about 6×1012 vg / mL of rAAV particles, about 180 mM sodium chloride, about 5 mM  monobasic sodium phosphate, about 5 mM dibasic sodium phosphate, and about 0.001% (w / v) poloxamer  188, wherein the pharmaceutical formulation has a pH of about 7.3. In some embodiments, the  pharmaceutical formulation comprises about 6×1011 vg / mL of rAAV particles, about 180 mM sodium  chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic sodium phosphate, and about  0.001% (w / v) poloxamer 188, wherein the pharmaceutical formulation has a pH of about 7.3.

[0137] In some embodiments, the unit dose of rAAV particles comprises a volume of between about 25 μL  to about 250 μL (e.g., any of about 25 μL, about 30 μL, about 40 μL, about 50 μL, about 60 μL, about 70 μL,  about 80 μL, about 90 μL, about 100 μL, about 110 μL, about 120 μL, about 130 μL, about 140 μL, about 150 Attorney Docket No.17234.045WO1 μL, about 160 μL, about 170 μL, about 180 μL, about 190 μL, about 200 μL, about 210 μL, about 220 μL,  about 230 μL, about 240 μL, or about 250 μL). In some embodiments, the concentration of rAAV particles in  the pharmaceutical formulation is adjusted such that the volume of the unit dose of rAAV particles  administered to an eye of the individual is between about 25 μL to about 250 μL. In some embodiments, the  unit dose of rAAV particles comprises a volume of about 100 μL. In some embodiments, the unit dose of  rAAV particles comprises a volume of about 30 μL.

[0138] In some embodiments, the unit dose of rAAV particles is administered in combination with steroid  treatment. In some embodiments, the steroid treatment is a corticosteroid treatment. In some  embodiments, the steroid treatment is a systemic steroid treatment. In some embodiments, the steroid  treatment is an oral steroid treatment. In some embodiments, the steroid treatment is a prednisone  treatment. In some embodiments, the steroid treatment is an ophthalmic steroid treatment. In some  embodiments, the ophthalmic steroid treatment is a topical steroid treatment (e.g., a drop), a periocular  steroid treatment (e.g., subtenons, subconjunctival), an intravitreal steroid treatment, an intravitreal  implant or a superchoroidal steroid treatment. In some embodiments, the ophthalmic steroid treatment is a  glucocorticoid including, but not limited to, an anti‐inflammatory glucocorticoid.  In some embodiments, the  topical steroid treatment is a glucocorticoid including but not limited to, an anti‐inflammatory  glucocorticoid.  In some embodiments, the topical steroid treatment is a difluprednate treatment, a  medrysone treatment, a loteprednol treatment, a prednisolone treatment, a fluocinolone treatment, a  triamcinolone treatment, a rimexolone treatment, a dexamethasone treatment, a fluorometholone  treatment, a fluocinolone treatment, a rimexolone treatment, or a prednisone treatment. Anti‐inflammatory  glucocorticoids may include, but are not limited to, difluprednate, dexamethasone, prednisolone,  triamcinolone, fluorometholone, rimexolone, fluocinolone, loteprednol and bioequivalents thereof. In some  embodiments, the topical steroid treatment is a difluprednate treatment.  By "dexamethasone" is intended  dexamethasone, dexamethasone biosimilars, dexamethasone bioequivalents, and pharmaceutical  compositions comprising dexamethasone, a dexamethasone biosimilar or a dexamethasone bioequivalent.  Pharmaceutical compositions comprising dexamethasone include, but are not limited to, Ozurdex™,  Maxidex™, Decadron™, Dexamethasone Intensol™, Ocu‐Dex™, Dexycu™, Dextenza™ and Zodex™. Ozurdex™  is a pharmaceutical composition comprising dexamethasone.  By "difluprednate" is intended difluprednate,  difluprednate biosimilars, difluprednate bioequivalents, and pharmaceutical compositions comprising  difluprednate, a difluprednate biosimilar or a difluprednate bioequivalent. Pharmaceutical compositions  comprising difluprednate include, but are not limited to, Durezol™ and difluprednate emulsions.  By  "triamcinolone" is intended triamcinolone, triamcinolone biosimilars, triamcinolone bioequivalents, and  pharmaceutical compositions comprising triamcinolone, triamcinolone acetonide, a triamcinolone biosimilar Attorney Docket No.17234.045WO1 or a triamcinolone bioequivalent. Pharmaceutical compositions comprising triamcinolone include, but are  not limited to, Triesence™, Xipere™, and Trivaris™.  By “prednisolone” is intended prednisolone,  prednisolone acetate, prednisolone biosimilars, prednisolone bioequivalents and pharmaceutical  compositions comprising prednisolone, prednisolone acetate, a prednisolone biosimilar, or a prednisolone  bioequivalent. Pharmaceutical compositions comprising prednisolone include, but are not limited to,  PredForte™.  By “fluorometholone” is intended fluorometholone, fluorometholone acetate,  fluorometholone biosimilars, fluorometholone bioequivalents and pharmaceutical compositions comprising  fluorometholone, fluorometholone acetate, a fluorometholone biosimilar, or a fluorometholone  bioequivalent. Pharmaceutical compositions comprising fluorometholone include, but are not limited to,  Flarex™.  By “loteprednol” is intended loteprednol, loteprednol etabonate, loteprednol biosimilars,  loteprednol bioequivalents and pharmaceutical compositions comprising loteprednol, loteprednol  etabonate, a loteprednol biosimilar, or a loteprednol bioequivalent. Pharmaceutical compositions  comprising loteprednol include, but are not limited to, Lotemax™.  By “rimexolone” is intended rimexolone,  rimexolone biosimilars, rimexolone bioequivalents and pharmaceutical compositions comprising  rimexolone, a rimexolone biosimilar, or a rimexolone bioequivalent. Pharmaceutical compositions  comprising rimexolone include, but are not limited to, Vexol™. In some embodiments, the steroid treatment  is administered before, during, and / or after administration of the unit dose of rAAV particles. In some  embodiments, the steroid treatment is administered before administration of the unit dose of rAAV  particles. In some embodiments, the steroid treatment is administered during administration of the unit  dose of rAAV particles. In some embodiments, the steroid treatment is administered after administration of  the unit dose of rAAV particles. In some embodiments, the steroid treatment is administered before and  during administration of the unit dose of rAAV particles. In some embodiments, the steroid treatment is  administered before and after administration of the unit dose of rAAV particles. In some embodiments, the  steroid treatment is administered during, and after administration of the unit dose of rAAV particles. In  some embodiments, the steroid treatment is administered before, during, and after administration of the  unit dose of rAAV particles.

[0139] In some embodiments, the steroid treatment is an ophthalmic steroid treatment (e.g.,  difluprednate). In some embodiments, the ophthalmic steroid treatment (e.g., difluprednate) is a daily  steroid treatment for up to about 4 weeks, about 6 weeks, or about 8 weeks from administering the unit  dose of rAAV particles.  In some embodiments, the ophthalmic steroid treatment comprises about four  administrations of ophthalmic steroid on about week 1, about three administrations of ophthalmic steroid  on about week 2, about two administrations of ophthalmic steroid on about week 3, and about one  administration of ophthalmic steroid on about week 4; timing starting with and following administration of Attorney Docket No.17234.045WO1 the unit dose of rAAV particles. In some embodiments, the ophthalmic steroid is about 0.005% to about  0.5% difluprednate. In some embodiments, the ophthalmic steroid is any of about 0.005%, about 0.006%,  about 0.007%, about 0.008%, about 0.009%, about 0.01%, about 0.02%, about 0.03%, about 0.4%, about  0.05%, about 0.06%, about 0.07%, about 0.08%, about 0.09%, or about 0.1% difluprednate. In some  embodiments, the ophthalmic steroid is difluprednate 0.05%. In some embodiments, a dose of  difluprednate 0.05% is one drop of ophthalmic solution. In some embodiments, one drop is about 50 µl (e.g.,  about 25 µl to about 50 µl, about 50 µl to about 100 µl).   In some embodiments, a dose of difluprednate  comprises about 1 µg to about 5 µg, or about 2 µg to about 3 µg, or about 2.5 µg difluprednate. In some  embodiments, a dose of difluprednate comprises about 2.5 µg difluprednate.

[0140] In some embodiments, the steroid treatment is an ophthalmic steroid treatment (e.g.,  difluprednate). In some embodiments, the ophthalmic steroid treatment (e.g., difluprednate) is a daily  topical steroid treatment for up to about 4 weeks, about 6 weeks, or about 8 weeks from administering the  unit dose of rAAV particles.  In some embodiments, the topical steroid treatment comprises about four  administrations of topical steroid on about week 1, about three administrations of topical steroid on about  week 2, about two administrations of topical steroid on about week 3, and about one administration of  topical steroid on about week 4; timing starting with and following administration of the unit dose of rAAV  particles. In some embodiments, the topical steroid treatment comprises about four administrations of  topical steroid (i.e., QID) per day for about 3 weeks after administration of the unit dose of rAAV particles,  followed by about 3 administrations of topical steroid per day (i.e., TID) for about 1 week, followed by about  2 administrations of topical steroid per day (i.e., BID) for about 1 week, and followed by about 1  administration of topical steroid per day (i.e., QD) for about 1 week. In some embodiments, the topical  steroid comprises difluprednate 0.05% at a dose of about 1µg to about 3 µg. In some embodiments, the  topical steroid comprises difluprednate 0.05% at a dose of about 2.5µg.  In some embodiments, the topical  steroid is about 0.005% to about 0.5% difluprednate. In some embodiments, the topical steroid is any of  about 0.005%, about 0.006%, about 0.007%, about 0.008%, about 0.009%, about 0.01%, about 0.02%, about  0.03%, about 0.04%, about 0.05%, about 0.06%, about 0.07%, about 0.08%, about 0.09%, or about 0.1%  difluprednate. In some embodiments, the topical steroid is difluprednate 0.05%. In some embodiments, a  dose of difluprednate 0.05% is one drop of ophthalmic solution. In some embodiments, one drop is about 50  µl (e.g., about 25 µl to about 50 µl, about 50 µl to about 100 µl).   In some embodiments, a dose of  difluprednate comprises about 1 µg to about 5 µg, or about 2 µg to about 3 µg, or about 2.5 µg  difluprednate. In some embodiments, a dose of difluprednate comprises about 2.5 µg difluprednate.

[0141] In some aspects, the invention provides methods for treating an ocular neovascular disease in an  individual, the method comprising administering of recombinant adeno‐associated virus (rAAV) particles to Attorney Docket No.17234.045WO1 one eye of the individual, wherein the individual is a human, wherein the rAAV particles comprise: a) a  nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about 95% identity to  the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats (ITRs), and b) an  AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between  positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering corresponds to an  AAV2 VP1 capsid protein, and wherein the unit dose of rAAV particles is administered in combination with  an oral steroid treatment and a topical steroid treatment or an oral steroid treatment and an intravitreal  (IVT) steroid treatment.  In some embodiments, the oral steroid treatment and the topical steroid treatment  or the oral steroid treatment and the IVT are a corticosteroid treatments. In some embodiments, an  intravitreal (IVT) steroid treatment may further comprise a topical steroid treatment that is initiated 4 or  more weeks after administration of the rAAV.  In some embodiments, the topical steroid treatment is a  difluprednate treatment. In some embodiments, the topical steroid treatment comprises difluprednate  0.05% at a dose of about 1µg to about 3 µg. In some embodiments, the topical steroid treatment comprises  difluprednate 0.05% at a dose of about 2.5µg. In some embodiments, the topical steroid treatment  comprises about four administrations of topical steroid per day on about day 7 prior to administration of the  unit dose of rAAV particles to about day 35 after administration of the unit does of rAAV particles, about  three administrations of topical steroid per day on about day 36 to about day 63 after administration of the  unit dose of rAAV particles, about two administrations of topical steroid per day on about day 64 to about  day 91 after administration of the unit dose of rAAV particles, about one administrations of topical steroid  per day on about day 92 to about day 119 after administration of the unit dose of rAAV particles, and about  one administrations of topical steroid every other day starting on about day 120 to about day 147 after  administration of the unit dose of rAAV particles. In some embodiments, the topical steroid treatment  comprises about four administrations of topical steroid per day about one week prior to administration of  the unit dose of rAAV particles to about five weeks after administration of the unit does of rAAV particles,  about three administrations of topical steroid per day about 6 weeks to about 9 weeks after administration  of the unit dose of rAAV particles, about two administrations of topical steroid per day about 10 weeks to  about 13 weeks after administration of the unit dose of rAAV particles, about one administrations of topical  steroid per day about 14 weeks to about 17 weeks after administration of the unit dose of rAAV particles,  and about one administrations of topical steroid every other day about 18 to about 21 weeks after  administration of the unit dose of rAAV particles. In some embodiments, the oral steroid treatment is a  prednisone treatment. In some embodiments, the oral steroid treatment is administered at a dose of: less  than about 0.8 mg / kg / day to about 1.00 mg / kg / day for the week prior to through week two following  administering the unit dose of rAAV particles, less than about 0.59 mg / kg / day to about 0.75 mg / kg / day on Attorney Docket No.17234.045WO1 weeks three to five following administering the unit dose of rAAV particles, less than about 0.4 mg / kg / day to  about 0.6 mg / kg / day on week six after administering the unit dose of rAAV particles, less than about 0.25  mg / kg / day to about 0.375 mg / kg / day on week seven after administering the unit dose of rAAV particles, less  than about 0.14 mg / kg / day to about 0.28 mg / kg / day on week eight after administering the unit dose of  rAAV particles, and less than about 0.063 mg / kg / day  to about 0.125 mg / kg / day on week nine after  administering the unit dose of rAAV particles. In some embodiments, the oral steroid treatment is  administered at a dose of: less than or equal to about 1.00 mg / kg / day for the week prior to through week  two following administering the unit dose of rAAV particles, less than or equal to about 0.75 mg / kg / day on  weeks three to five following administering the unit dose of rAAV particles, less than or equal to about 0.6  mg / kg / day on week six after administering the unit dose of rAAV particles, less than or equal to about 0.375  mg / kg / day on week seven after administering the unit dose of rAAV particles, less than or equal to about  0.28 mg / kg / day on week eight after administering the unit dose of rAAV particles, and less than or equal to  about 0.125 mg / kg / day on week nine after administering the unit dose of rAAV particles. In some  embodiments, the oral steroid treatment is administered at a dose of about 0.125 mg / kg / day to about 0.14  mg / kg / day on the first four days of week nine after administering the unit dose of rAAV particles and about  0.0625 mg / kg / day to about 0.070 mg / kg / day on the first four days of week nine after administering the unit  dose of rAAV particles if the individual weighs 70 kg or more. In some embodiments, the IVT steroid  treatment is a triamcinolone acetonide treatment, a dexamethasone treatment. In some embodiments, the  IVT steroid treatment is a treatment such as, but not limited to, Ozurdex®, Iluvien® or Triesence®. In some  embodiments, the IVT steroid treatment is a triamcinolone acetonide treatment of about 2 mg. In some  embodiments, the IVT steroid treatment comprises administration of the IVT steroid treatment one week  prior to administration of the unit dose of rAAV particles and at week 12 after administration of the unit  dose of rAAV particles. In some embodiments, the IVT steroid treatment is a dexamethasone of about 0.7  mg.  In some embodiments, the IVT steroid treatment is an intravitreal implant one week prior to  administration of the unit does of rAAV particles. In some embodiments, the oral steroid treatment and / or  the topical steroid treatment is administered before, during and / or after administration of the unit dose of  rAAV particles.

[0142] In some aspects, the invention provides a unit dose of recombinant adeno‐ associated virus (rAAV)  particles for use in a method for treating an ocular neovascular disease in an individual, the method  comprising administering said unit dose to one eye of the individual, wherein the individual is a human,  wherein the rAAV particles comprise a) a nucleic acid encoding a polypeptide comprising an amino acid  sequence with at least about 95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by  AAV2 inverted terminal repeats (ITRs), and b) an AAV2 capsid protein comprising an amino acid sequence Attorney Docket No.17234.045WO1 LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid protein, wherein the amino  acid residue numbering corresponds to an AAV2 VP1 capsid protein, and wherein the unit dose of rAAV  particles is administered in combination with (1) an oral steroid treatment and a topical steroid treatment,  or (2) an oral steroid treatment and an intravitreal (IVT) steroid treatment, or (3) an intravitreal (IVT) steroid  treatment with an optional topical steroid treatment initiated at 3 or more weeks post rAAV administration,  or (4) an intravitreal (IVT) steroid treatment with an optional topical and oral steroid treatment initiated at 3  or more weeks post rAAV administration.

[0143] In some embodiments, the retinal fluid in the eye of the individual (e.g., SRF and / or IRF) is reduced  by more than any of about 5%, about 10%, about 15%, about 20%, about 30%, about 40%, about 50%, about  60%, about 70%, about 80%, about 90%, or about 100% after administration of the unit dose of rAAV  particles to the one eye and / or to the contralateral of the individual. In some embodiments, the retinal fluid  in the eye of the individual (e.g., SRF and / or IRF) is reduced by more than any of about 5%, about 10%, about  15%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or  about 100% after administration of the unit dose of rAAV particles to the one eye and / or to the  contralateral of the individual compared to the level of retinal fluid in the eye of the individual prior to  administration of the unit dose or rAAV particles. In some embodiments, the retinal fluid in the eye of the  individual (e.g., SRF and / or IRF) is reduced by about 100% after administration of the unit dose of rAAV  particles to the one eye and / or to the contralateral of the individual compared to the level of retinal fluid in  the eye of the individual prior to administration of the unit dose or rAAV particles.

[0144] In some embodiments, the methods provided herein further comprise monitoring the level of  retinal fluid (e.g., SRF and / or IRF) in the one eye and / or the contralateral eye of the individual after  administration of the unit dose of rAAV particles. In some embodiments, the reduction of retinal fluid (e.g.,  SRF and / or IRF) in the eye is first observed any of about 1 day, about 3 days, about 8 days, about 2 weeks,  about 4 weeks, about 6 weeks, about 8 weeks, about 12 weeks, about 16 weeks, about 20 weeks, about 24  weeks, about 28 weeks, about 32 weeks, about 36 weeks, about 40 weeks, about 44 weeks, about 48 weeks,  about 52 weeks, about 56 weeks, about 60 weeks, about 64 weeks, about 68 weeks, about 72 weeks, about  76 weeks, about 80 weeks, about 84 weeks, about 88 weeks, about 92 weeks, about 96 weeks, about 100  weeks, about 104 weeks, or more after administration of the unit dose of rAAV particles. In some  embodiments, the reduction of retinal fluid (e.g., SRF and / or IRF)  in the eye continues or is maintained for  at least 1 week, at least 2 weeks, at least 4 weeks, at least 6 weeks, at least 8 weeks, at least 12 weeks, at  least 16 weeks, at least 20 weeks, at least 24 weeks, at least 28 weeks, at least 32 weeks, at least 36 weeks,  at least 40 weeks, at least 44 weeks, at least 48 weeks, at least 52 weeks, at least 56 weeks, at least 60  weeks, at least 64 weeks, at least 68 weeks, at least 72 weeks, at least 76 weeks, at least 80 weeks, at least Attorney Docket No.17234.045WO1 84 weeks, at least 88 weeks, at least 92 weeks, at least 96 weeks, at least 100 weeks, at least 104 weeks, or  more after administration of the unit dose of rAAV particles.

[0145] In some embodiments, the reduction of retinal fluid (e.g., SRF and / or IRF) in the eye is determined  by any method known in the art. In some embodiments, the reduction of retinal fluid (e.g., SRF and / or IRF)  in the eye is determined by optical coherence tomography (OCT), spectral domain OCT (SD‐OCT), OCT  angiography, fluorescein angiography, or by direct retinal observation. In some embodiments, the reduction  of retinal fluid (e.g., SRF and / or IRF) in the eye is determined by optical coherence tomography (OCT). In  some embodiments, the reduction of retinal fluid (e.g., SRF and / or IRF) in the eye is determined by spectral  domain OCT (SD‐OCT). In some embodiments, the reduction of retinal fluid (e.g., SRF and / or IRF) in the eye  is determined by OCT angiography. In some embodiments, the reduction of retinal fluid (e.g., SRF and / or  IRF) in the eye is determined by fluorescein angiography. In some embodiments, the reduction of retinal  fluid (e.g., SRF and / or IRF) in the eye is determined by direct retinal observation.

[0146] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles to the one eye and / or the contralateral eye is assessed  based on the level of retinal fluid (e.g., intraretinal fluid (IRF) and / or subretinal fluid (SRF)) compared the  level of retinal fluid (e.g., SRF and / or IRF) prior to administration of the unit dose of rAAV particles to the  one eye and / or the contralateral eye (e.g., as described above). In some embodiments, the retinal fluid is  subretinal fluid (SRF) or intraretinal fluid (IRF).  In some embodiments, the retinal fluid is subretinal fluid  (SRF).  In some embodiments, the retinal fluid is intraretinal fluid (IRF).  In some embodiments, treatment of  an ocular neovascular disease in an individual after administration of the unit dose of rAAV particles to the  one eye and / or the contralateral eye is determined if a reduction in retinal fluid (e.g., IRF and / or SRF) is  observed after administration of the unit dose of rAAV particles to the one eye and / or the contralateral eye  compared to the levels of retinal fluid (e.g., IRF and / or SRF) prior to administration of the unit dose of rAAV  particles in the one eye and / or the contralateral eye (e.g., as described above). In some embodiments, the  ocular neovascular disease is wAMD.

[0147] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in maintenance or a decrease of retinal thickness compared to  the retinal thickness prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of retinal thickness compared to the retinal thickness prior to administration of the unit  dose of rAAV particles. In some embodiments, retinal thickness is central subfield thickness (CST) or central  retinal thickness (CRT). In some embodiments, the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in a decrease of retinal thickness of more than Attorney Docket No.17234.045WO1 any of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about  45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about  90%, about 95%, about 99%, or about 100% compared to the retinal thickness prior to administration of the  unit dose of rAAV particles. In some embodiments, the retinal thickness (e.g., CST or CRT) is determined by  OCT or SD‐OCT.

[0148] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central  subfield thickness (CST) of about 10 μm to about 100 μm (e.g., more than any of about 10 μm, about 15 μm,  about 20 μm, about 25 μm, about 30 μm, about 35 μm, about 40 μm, about 45 μm, about 50 μm, about 55  μm, about 60 μm, about 65 μm, about 70 μm, about 75 μm, about 80 μm, about 85 μm, about 90 μm, about  95 μm, about 100 μm, or more). In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a decrease of central retinal thickness  (CRT) or central subfield thickness (CST) of about 5 μm to about 50 μm (e.g., any of about 5 μm, about 10  μm, about 15 μm, about 20 μm, about 25 μm, about 30 μm, about 35 μm, about 40 μm, about 45 μm, or  about 50 μm). In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or  central subfield thickness (CST) of about 5 μm to about 40 μm (e.g., any of about 5 μm, about 10 μm, about  15 μm, about 20 μm, about 25 μm, about 30 μm, about 35 μm, or about 40 μm).  In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 5 μm to  about 30 μm (e.g., any of about 5 μm, about 6 μm, about 7 μm, about 8 μm, about 9 μm, about 10 μm,  about 11 μm, about 12 μm, about 13 μm, about 14 μm, about 15 μm, about 16 μm, about 17 μm, about 18  μm, about 19 μm, about 20 μm, about 21 μm, about 22 μm, about 23 μm, about 24 μm, about 25 μm, about  26 μm, about 27 μm, about 28 μm, about 29 μm, or about 30 μm).  In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a  decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 5 μm to about 25 μm  (e.g., any of about 5 μm, about 6 μm, about 7 μm, about 8 μm, about 9 μm, about 10 μm, about 11 μm,  about 12 μm, about 13 μm, about 14 μm, about 15 μm, about 16 μm, about 17 μm, about 18 μm, about 19  μm, about 20 μm, about 21 μm, about 22 μm, about 23 μm, about 24 μm, or about 25 μm).  In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of about 5 μm to about 20 μm (e.g., any of about 5 μm, about 6 μm, about 7 μm, about 8 μm, about 9 μm,  about 10 μm, about 11 μm, about 12 μm, about 13 μm, about 14 μm, about 15 μm, about 16 μm, about 17 Attorney Docket No.17234.045WO1 μm, about 18 μm, about 19 μm, or about 20 μm). In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of between about 18 μm to about 75 μm.  In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of about 18.5 μm. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or  central subfield thickness (CST) of about 21.0 μm.  In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of about 8.3 μm. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 25.5 μm. In  some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield  thickness (CST) of about 24.8 μm.  In some embodiments, the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in a decrease of central retinal  thickness (CRT) or central subfield thickness (CST) of about 75 μm. In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a  decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 100 μm or more (e.g.,  any of about 100 μm or more, about 110 μm or more, about 120 μm or more, about 130 μm or more, about  140 μm or more, about 150 μm or more, about 160 μm or more, about 170 μm or more, about 180 μm or  more, about 190 μm or more, or about 200 μm or more). In some embodiments, the administering the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease  of central retinal thickness (CRT) or central subfield thickness (CST) of between about 10 μm to about 200  μm (e.g., any of about 10 μm, about 20 μm, about 30 μm, about 40 μm, about 50 μm, about 60 μm, about  70 μm, about 80 μm, about 90 μm, about 100 μm, about 110 μm, about 120 μm, about 130 μm, about 140  μm, about 150 μm, about 160 μm, about 170 μm, about 180 μm, about 190 μm, or about 200 μm). In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of between about 50 μm to about 200 μm (e.g., any of about 50 μm, about 60 μm, about 70 μm, about 80  μm, about 90 μm, about 100 μm, about 110 μm, about 120 μm, about 130 μm, about 140 μm, about 150  μm, about 160 μm, about 170 μm, about 180 μm, about 190 μm, or about 200 μm). In some embodiments,  the administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the Attorney Docket No.17234.045WO1 individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of  between about 60 μm to about 200 μm (e.g., any of about 60 μm, about 70 μm, about 80 μm, about 90 μm,  about 100 μm, about 110 μm, about 120 μm, about 130 μm, about 140 μm, about 150 μm, about 160 μm,  about 170 μm, about 180 μm, about 190 μm, or about 200 μm). In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a  decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about 70 μm to  about 200 μm (e.g., any of about 70 μm, about 80 μm, about 90 μm, about 100 μm, about 110 μm, about  120 μm, about 130 μm, about 140 μm, about 150 μm, about 160 μm, about 170 μm, about 180 μm, about  190 μm, or about 200 μm). In some embodiments, the administering the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of the individual results in a decrease of central retinal thickness  (CRT) or central subfield thickness (CST) of between about 80 μm to about 200 μm (e.g., any of about 80 μm,  about 90 μm, about 100 μm, about 110 μm, about 120 μm, about 130 μm, about 140 μm, about 150 μm,  about 160 μm, about 170 μm, about 180 μm, about 190 μm, or about 200 μm). In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about  90 μm to about 200 μm (e.g., any of about 90 μm, about 100 μm, about 110 μm, about 120 μm, about 130  μm, about 140 μm, about 150 μm, about 160 μm, about 170 μm, about 180 μm, about 190 μm, or about  200 μm). In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central  subfield thickness (CST) of between about 100 μm to about 200 μm (e.g., any of about 100 μm, about 110  μm, about 120 μm, about 130 μm, about 140 μm, about 150 μm, about 160 μm, about 170 μm, about 180  μm, about 190 μm, or about 200 μm). In some embodiments, the administering the unit dose of rAAV  particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of between about 110 μm to about 200 μm (e.g.,  any of about 110 μm, about 120 μm, about 130 μm, about 140 μm, about 150 μm, about 160 μm, about 170  μm, about 180 μm, about 190 μm, or about 200 μm). In some embodiments, the administering the unit dose  of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of  central retinal thickness (CRT) or central subfield thickness (CST) of between about 115 μm to about 200 μm  (e.g., any of about 115 μm, about 120 μm, about 125 μm, about 130 μm, about 135 μm, about 140 μm,  about 145 μm, about 150 μm, about 155 μm, about 160 μm, about 165 μm, about 170 μm, about 175 μm,  about 180 μm, about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about Attorney Docket No.17234.045WO1 120 μm to about 200 μm (e.g., any of about 120 μm, about 125 μm, about 130 μm, about 135 μm, about  140 μm, about 145 μm, about 150 μm, about 155 μm, about 160 μm, about 165 μm, about 170 μm, about  175 μm, about 180 μm, about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of between about 125 μm to about 200 μm (e.g., any of about 125 μm, about 130 μm, about 135 μm, about  140 μm, about 145 μm, about 150 μm, about 155 μm, about 160 μm, about 165 μm, about 170 μm, about  175 μm, about 180 μm, about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of between about 130 μm to about 200 μm (e.g., any of about 130 μm, about 135 μm, about 140 μm, about  145 μm, about 150 μm, about 155 μm, about 160 μm, about 165 μm, about 170 μm, about 175 μm, about  180 μm, about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about  135 μm to about 200 μm (e.g., any of about 135 μm, about 140 μm, about 145 μm, about 150 μm, about  155 μm, about 160 μm, about 165 μm, about 170 μm, about 175 μm, about 180 μm, about 185 μm, about  190 μm, about 195 μm, or about 200 μm). In some embodiments, the administering the unit dose of rAAV  particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of between about 140 μm to about 200 μm (e.g.,  any of about 140 μm, about 145 μm, about 150 μm, about 155 μm, about 160 μm, about 165 μm, about 170  μm, about 175 μm, about 180 μm, about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of between about 145 μm to about 200 μm (e.g., any of about 145 μm, about 150 μm, about 155 μm, about  160 μm, about 165 μm, about 170 μm, about 175 μm, about 180 μm, about 185 μm, about 190 μm, about  195 μm, or about 200 μm). In some embodiments, the administering the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of the individual results in a decrease of central retinal thickness  (CRT) or central subfield thickness (CST) of between about 150 μm to about 200 μm (e.g., any of about 150  μm, about 155 μm, about 160 μm, about 165 μm, about 170 μm, about 175 μm, about 180 μm, about 185  μm, about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the administering the unit dose  of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of  central retinal thickness (CRT) or central subfield thickness (CST) of between about 155 μm to about 200 μm Attorney Docket No.17234.045WO1 (e.g., any of about 155 μm, about 160 μm, about 165 μm, about 170 μm, about 175 μm, about 180 μm,  about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a  decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about 160 μm to  about 200 μm (e.g., any of about 160 μm, about 165 μm, about 170 μm, about 175 μm, about 180 μm,  about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a  decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about 165 μm to  about 200 μm (e.g., any of about 165 μm, about 170 μm, about 175 μm, about 180 μm, about 185 μm,  about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of between about 170 μm to about 200 μm (e.g.,  any of about 170 μm, about 175 μm, about 180 μm, about 185 μm, about 190 μm, about 195 μm, or about  200 μm). In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central  subfield thickness (CST) of between about 175 μm to about 200 μm (e.g., any of about 175 μm, about 180  μm, about 185 μm, about 190 μm, about 195 μm, or about 200 μm). In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of between about  180 μm to about 200 μm (e.g., any of about 180 μm, about 185 μm, about 190 μm, about 195 μm, or about  200 μm). In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central  subfield thickness (CST) of about 21.0 μm compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 8.3 μm  compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to administration of  the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a decrease of central retinal thickness  (CRT) or central subfield thickness (CST) of about 26.2 μm compared to the central retinal thickness (CRT) or  central subfield thickness (CST) prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) Attorney Docket No.17234.045WO1 of about 24.8 μm compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of about 40.8 μm compared to the central retinal  thickness (CRT) or central subfield thickness (CST) prior to administration of the unit dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield  thickness (CST) of about 30.0 μm compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 118.6 μm  compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to administration of  the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a decrease of central retinal thickness  (CRT) or central subfield thickness (CST) of about 119.0 μm compared to the central retinal thickness (CRT)  or central subfield thickness (CST) prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of about 137.8 μm compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease of central  retinal thickness (CRT) or central subfield thickness (CST) of about 152.7 μm compared to the central retinal  thickness (CRT) or central subfield thickness (CST) prior to administration of the unit dose of rAAV particles.   In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield  thickness (CST) of about 153.3 μm compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of about 149.8 μm  compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to administration of  the unit dose of rAAV particles.

[0149] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a change in the central retinal thickness (CRT) or central Attorney Docket No.17234.045WO1 subfield thickness (CST) of between about ‐200 μm to about +40 μm (e.g., any about ‐200 μm, about ‐180  μm, about ‐160 μm, about ‐140 μm, about ‐120 μm, about ‐100 μm, about ‐80 μm, about ‐60 μm, about ‐40  μm, about ‐20 μm, about 0 μm, about +5 μm, about +10 μm, about +15 μm, about +20 μm, about +25 μm,  about +30 μm, about +35 μm, or about +40 μm) compared to the retinal thickness prior to administration of  the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a decrease in the central retinal  thickness (CRT) or central subfield thickness (CST) of any of about 8 μm, about 11 μm, about 16 μm, about  29 μm, about 33 μm, about 38 μm, about 55 μm, about 61 μm, or about 117 μm. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease in the central retinal thickness (CRT) or central subfield thickness (CST) of any of about  27.8 μm or about 30.8 μm. In some embodiments, the administering the unit dose of rAAV particles to the  one eye and / or to the contralateral eye of the individual results in an increase in the central retinal thickness  (CRT) or central subfield thickness (CST) of any of about 4 μm, about 12 μm, or about 32 μm. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a change in the central retinal thickness (CRT) or central subfield thickness  (CST) of about ‐21.0 μm compared to the central retinal thickness (CRT) or central subfield thickness (CST)  prior to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in  the central retinal thickness (CRT) or central subfield thickness (CST) of about ‐8.3 μm compared to the  central retinal thickness (CRT) or central subfield thickness (CST) prior to administration of the unit dose of  rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in a change in the central retinal thickness (CRT) or  central subfield thickness (CST) of about ‐26.2 μm compared to the central retinal thickness (CRT) or central  subfield thickness (CST) prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a change in the central retinal thickness (CRT) or central subfield thickness (CST) of about ‐24.8 μm  compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to administration of  the unit dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a change in the central retinal  thickness (CRT) or central subfield thickness (CST) of about ‐40.8 μm compared to the central retinal  thickness (CRT) or central subfield thickness (CST) prior to administration of the unit dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a change in the central retinal thickness (CRT) or central subfield Attorney Docket No.17234.045WO1 thickness (CST) of about ‐30.0 μm compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a change in the central retinal thickness (CRT) or central subfield thickness (CST) of about ‐118.6  μm compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to administration  of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in a change in the central retinal  thickness (CRT) or central subfield thickness (CST) of about ‐119.0 μm compared to the central retinal  thickness (CRT) or central subfield thickness (CST) prior to administration of the unit dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a change in the central retinal thickness (CRT) or central subfield  thickness (CST) of about ‐137.8 μm compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a change in the central retinal thickness (CRT) or central subfield thickness (CST) of about ‐152.7  μm compared to the central retinal thickness (CRT) or central subfield thickness (CST) prior to administration  of the unit dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in a change in the central retinal  thickness (CRT) or central subfield thickness (CST) of about ‐153.3 μm compared to the central retinal  thickness (CRT) or central subfield thickness (CST) prior to administration of the unit dose of rAAV particles.   In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a change in the central retinal thickness (CRT) or central subfield  thickness (CST) of about ‐149.8 μm compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles.

[0150] In some embodiments, the change (e.g., the decrease) in the central retinal thickness (CRT) or  central subfield thickness (CST) compared to the central retinal thickness (CRT) or central subfield thickness  (CST) prior to administration of the unit dose of rAAV particles is present at any of about 1 day, about 1  week, about 2 weeks, about 4 weeks, about 8 weeks, about 16 weeks, about 24 weeks, about 30 weeks,  about 32 weeks, about 34 weeks, about 40 weeks, about 44 weeks, about 48 weeks, about 52 weeks, or  more after administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye  of the individual. In some embodiments, the change (e.g., the decrease) in the central retinal thickness (CRT)  or central subfield thickness (CST) compared to the central retinal thickness (CRT) or central subfield  thickness (CST) prior to administration of the unit dose of rAAV particles is present at any of about 1 day, Attorney Docket No.17234.045WO1 about 1 week, about 2 weeks, about 4 weeks, about 8 weeks, about 12 weeks, about 16 weeks, about 20  weeks, about 24 weeks, about 28 weeks, about 32 weeks, about 36 weeks, about 40 weeks, about 44 weeks,  about 48 weeks, about 52 weeks, about 56 weeks, about 60 weeks, about 64 weeks, about 68 weeks, about  72 weeks, about 76 weeks, about 80 weeks, about 84 weeks, about 88 weeks, about 92 weeks, about 96  weeks, about 100 weeks, about 104 weeks, about 108 weeks, or more after administration of the unit dose  of rAAV particles to the one eye and / or to the contralateral eye of the individual.

[0151] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a decrease of central retinal thickness (CRT) or central  subfield thickness (CST)  of more than any of about 5%, about 10%, about 15%, about 20%, about 25%,  about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%,  about 75%, about 80%, about 85%, about 90%, about 95%, about 99%, or about 100% compared to the  retinal thickness prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST) of at least about  10% compared to the retinal thickness prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease of central retinal thickness (CRT) or central subfield thickness (CST)  of about 15% or more compared to the retinal thickness prior to administration of the unit dose of rAAV  particles.

[0152] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in an increase of central retinal thickness (CRT) or central  subfield thickness (CST) of less than about 40 μm (e.g., any of less than about 40 μm, less than about 35 μm,  less than about 30 μm, less than about 25 μm, less than about 20 μm, less than about 15 μm, less than  about 10 μm, less than about 5 μm, less than about 1 μm, or less) compared to the retinal thickness prior to  administration of the unit dose of rAAV particles.   In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in an increase of  central retinal thickness (CRT) or central subfield thickness (CST) of about 32 μm or less compared to the  retinal thickness prior to administration of the unit dose of rAAV particles.

[0153] In some embodiments, the maintenance, the decrease, or the increase of retinal thickness  compared to the retinal thickness prior to administration of the unit dose of rAAV particles is present at  about 30 weeks or more after administration of the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual. In some embodiments, the maintenance, the decrease, or the increase of  retinal thickness compared to the retinal thickness prior to administration of the unit dose of rAAV particles Attorney Docket No.17234.045WO1 is present at any of about 30 weeks, about 34 weeks, about 44 weeks, about 6 months, about 1 year, about  1.5 years, about 2 years, about 3 years, about 5 years, about 10 years, or more, after administration of the  unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual.

[0154] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in maintenance or a decrease in macular volume compared to  the macular volume prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease in macular volume compared to the macular volume prior to administration of the unit  dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in a decrease in macular volume of more than  any of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about  45%, or about 50% compared to the macular volume prior to administration of the unit dose of rAAV  particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a decrease in macular volume of at least about 10%  compared to the macular volume prior to administration of the unit dose of rAAV particles. In some  embodiments, the macular volume is determined by OCT or SD‐OCT. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a decrease in macular volume of at least about 10% compared to the macular volume prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease in  macular volume of about 15% or more compared to the macular volume prior to administration of the unit  dose of rAAV particles. In some embodiments, the macular volume is determined by OCT or SD‐OCT.

[0155] In some embodiments, the maintenance or the decrease in macular volume compared to the  macular volume prior to administration of the unit dose of rAAV particles is present at about 30 weeks or  more after administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye  of the individual. In some embodiments, the maintenance or the decrease in macular volume compared to  the macular volume prior to administration of the unit dose of rAAV particles is present at any of about 30  weeks, about 34 weeks, about 44 weeks, about 6 months, about 1 year, about 1.5 years, about 2 years,  about 3 years, about 5 years, about 10 years, or more after administration of the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual.

[0156] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in maintenance or an improvement of visual acuity compared  to the visual acuity prior to administration of the unit dose of rAAV particles. In some embodiments, the Attorney Docket No.17234.045WO1 administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in an improvement of visual acuity compared to the visual acuity prior to administration of the unit  dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in an improvement of visual acuity of more than  any of about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about  80%, about 90%, about 100%, about 125%, about 150%, about 175%, about 200%, about 225%, about 250%,  about 275%, about 300%, or more, compared to the visual acuity prior to administration of the unit dose of  rAAV particles. In some embodiments, visual acuity is best corrected visual acuity (BCVA). In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in an improvement of BCVA compared to the BCVA prior to administration of  the unit dose of rAAV particles. In some embodiments, BCVA is expressed as an ETDRS score, which  corresponds to the number of letters correctly read (Vitale et al., (2016) JAMA Opthalmol  134(9):1041:1047).

[0157] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in an improvement of BCVA of at least 15 ETDRS letters (Vitale  et al., (2016) JAMA Opthalmol 134(9):1041:1047) (e.g., at least about 15, at least about 20, at least about 30,  at least about 40, at least about 50, at least about 60, or about 70 letters)  compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in an improvement of  BCVA of between about 1 to about 15 (e.g., any of about 1, about 2, about 3, about 4, about 5, about 6,  about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, or about 15) ETDRS letters  compared to the BCVA prior to administration of the unit dose of rAAV particles.  In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in an improvement of BCVA of about 5 ETDRS letters compared to the BCVA prior to administration  of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in an improvement of BCVA of any of  about 1, about 2, about 3, about 4, about 5, about 6, or about 7 ETDRS letters compared to the BCVA prior  to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose  of rAAV particles to the one eye and / or to the contralateral eye of the individual results in an improvement  of BCVA of about 3 ETDRS letters or more compared to the BCVA prior to administration of the unit dose of  rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in an improvement of BCVA of about 4 ETDRS letters  or more compared to the BCVA prior to administration of the unit dose of rAAV particles. In some Attorney Docket No.17234.045WO1 embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in an improvement of BCVA of about 5.1 ETDRS letters or more compared to the  BCVA prior to administration of the unit dose of rAAV particles. In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in an  improvement of BCVA of about 6.4  ETDRS letters or more compared to the BCVA prior to administration of  the unit dose of rAAV particles.  In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in an improvement of BCVA of about 6.8  ETDRS letters compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in an improvement of BCVA of about 8.8 ETDRS letters compared to the BCVA  prior to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in an  improvement of BCVA of about 2.3 ETDRS letters compared to the BCVA prior to administration of the unit  dose of rAAV particles.

[0158] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in maintenance of BCVA, wherein the individual loses fewer  than 15 ETDRS letters (Vitale et al., (2016) JAMA Opthalmol 134(9):1041:1047) (e.g., any of 15 or less, 14 or  less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or  less, 2 or less, 1, or 0 letters)  compared to the BCVA prior to administration of the unit dose of rAAV  particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in maintenance of BCVA, wherein the individual loses about 2  letters compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in maintenance of BCVA, wherein the individual loses any of about 1, about 2,  about 3, about 4, about 5, about 6, about 7, about 8, or about 9 ETDRS letters compared to the BCVA prior  to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose  of rAAV particles to the one eye and / or to the contralateral eye of the individual results in maintenance of  BCVA, wherein the individual loses 0 letters compared to the BCVA prior to administration of the unit dose  of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in maintenance of BCVA, wherein the individual  loses about 1 letter compared to the BCVA prior to administration of the unit dose of rAAV particles. In  some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in maintenance of BCVA, wherein the individual loses about 2.7 Attorney Docket No.17234.045WO1 letters compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in maintenance of BCVA, wherein the individual loses about 2.8 letters  compared to the BCVA prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in maintenance of BCVA, wherein the individual loses about 2 letters or less compared to the BCVA  prior to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in  maintenance of BCVA, wherein the individual loses about 3.2 letters or less compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in maintenance of  BCVA, wherein the individual loses between about 15 to about 0 letters (e.g., any of about 15, about 14,  about 13, about 12, about 11, about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, about  2, about 1, or 0 letters) compared to the BCVA prior to administration of the unit dose of rAAV particles. In  some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in maintenance of BCVA, wherein the individual loses between  about 10 to about 0 letters (e.g., any of about 10, about 9, about 8, about 7, about 6, about 5, about 4,  about 3, about 2, about 1, or 0 letters) compared to the BCVA prior to administration of the unit dose of  rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in maintenance of BCVA, wherein the individual  loses between about 5 to about 0 letters (e.g., any of about 5, about 4, about 3, about 2, about 1, or 0  letters) compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in maintenance of BCVA, wherein the individual loses between about 4 to about  0 letters (e.g., any of about 4, about 3, about 2, about 1, or 0 letters) compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in maintenance of  BCVA, wherein the individual loses between about 3 to about 0 letters (e.g., any of about 3, about 2, about  1, or 0 letters) compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in maintenance of BCVA, wherein the individual loses between about 2 to about  0 letters (e.g., any of about 2, about 1, or 0 letters) compared to the BCVA prior to administration of the unit  dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one Attorney Docket No.17234.045WO1 eye and / or to the contralateral eye of the individual results in maintenance of BCVA, wherein the individual  loses between about 1 to about 0 letters compared to the BCVA prior to administration of the unit dose of  rAAV particles.

[0159] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a change in BCVA of between about ‐20 to +7 or more (e.g.,  any of ‐20, ‐19, ‐18, ‐17, ‐16, ‐15, ‐14, ‐13, ‐12, ‐11, ‐10, ‐9, ‐8,  ‐7, ‐6, ‐5, ‐4, ‐3, ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6,  +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the  BCVA prior to administration of the unit dose of rAAV particles. In some embodiments, the administering  the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in an  increase in BCVA of about any of 16, 7 or 5 ETDRS letters compared to the BCVA prior to administration of  the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a decrease in BCVA of about any of  19, 14, 7, 6, 5, 4, 3, 2, or 1 ETDRS letters compared to the BCVA prior to administration of the unit dose of  rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in a decrease in BCVA of about 4.8 or about 0.8  ETDRS letters compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a decrease in BCVA of about 2 ETDRS letters or less compared to the BCVA  prior to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a decrease  in BCVA of about 3.2 ETDRS letters or less compared to the BCVA prior to administration of the unit dose of  rAAV particles.

[0160] In some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in a change in BCVA of between about ‐15 to +7 or more (e.g.,  any of ‐15, ‐14, ‐13, ‐12, ‐11, ‐10, ‐9, ‐8,  ‐7, ‐6, ‐5, ‐4, ‐3, ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11,  +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in BCVA of  between about ‐10 to +7 or more (e.g., any of ‐10, ‐9, ‐8,  ‐7, ‐6, ‐5, ‐4, ‐3, ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6, +7,  +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA  prior to administration of the unit dose of rAAV particles. In some embodiments, the administering the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in  BCVA of between about ‐5 to +7 or more (e.g., any of ‐5, ‐4, ‐3, ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, Attorney Docket No.17234.045WO1 +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in BCVA of  between about ‐4 to +7 or more (e.g., any of ‐4, ‐3, ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11, +12,  +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in BCVA of  between about ‐3 to +7 or more (e.g., any of ‐3, ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11, +12,  +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of  rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in BCVA of  between about ‐2 to +7 or more (e.g., any of ‐2, ‐1, 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11, +12, +13,  +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to administration of  the unit dose of rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to  the one eye and / or to the contralateral eye of the individual results in a change in BCVA of between about ‐ 1 to +7 or more (e.g., any of ‐1, 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17,  +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to administration of the unit dose of  rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in a change in BCVA of between about 0 to +7 or  more (e.g., any of 0, +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20,  or more) ETDRS letters, compared to the BCVA prior to administration of the unit dose of rAAV particles. In  some embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the  contralateral eye of the individual results in a change in BCVA of between about +1 to +7 or more (e.g., any  of +1, +2, +3, +4, +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS  letters, compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a change in BCVA of between about +2 to +7 or more (e.g., any of +2, +3, +4,  +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared  to the BCVA prior to administration of the unit dose of rAAV particles. In some embodiments, the  administering the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual  results in a change in BCVA of between about +3 to +7 or more (e.g., any of +3, +4, +5, +6, +7, +8, +9, +10,  +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to  administration of the unit dose of rAAV particles. In some embodiments, the administering the unit dose of Attorney Docket No.17234.045WO1 rAAV particles to the one eye and / or to the contralateral eye of the individual results in a change in BCVA of  between about +4 to +7 or more (e.g., any of +4, +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17,  +18, +19, +20, or more) ETDRS letters, compared to the BCVA prior to administration of the unit dose of  rAAV particles. In some embodiments, the administering the unit dose of rAAV particles to the one eye  and / or to the contralateral eye of the individual results in a change in BCVA of between about +5 to +7 or  more (e.g., any of +5, +6, +7, +8, +9, +10, +11, +12, +13, +14, +15, +16, +17, +18, +19, +20, or more) ETDRS  letters, compared to the BCVA prior to administration of the unit dose of rAAV particles. In some  embodiments, the administering the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in a change in BCVA of about +6 or about +7 ETDRS letters, compared to the  BCVA prior to administration of the unit dose of rAAV particles.

[0161] In some embodiments, administration of the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of the individual results in transient inflammation (e.g., inflammation driven by  aqueous cells and / or vitreous cells, aqueous flare, posterior synchiae, poor pupil dilation). In some  embodiments, administration of the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of the individual results in inflammation (e.g., inflammation driven by aqueous cells and / or vitreous  cells, aqueous flare, posterior synchiae, poor pupil dilation) that is improved after administration of oral  and / or topical steroid treatment and / or mydriatics. In some embodiments, administration of the unit dose  of rAAV particles to the one eye and / or to the contralateral eye of the individual results in inflammation  (e.g., inflammation driven by aqueous cells and / or vitreous cells) that resolves after administration of oral  and / or topical steroid treatment. Inflammation (e.g., inflammation driven by aqueous cells and / or vitreous  cells, aqueous flare, posterior synchiae, poor pupil dilation) may be measured using any method known in  the art, such as the slit lamp exam.

[0162] In some embodiments, the maintenance or the improvement of visual acuity (e.g., BCVA)  compared to the visual acuity  prior to administration of the unit dose of rAAV particles is present at any of  about 1 day, about 1 week, about 2 weeks, about 4 weeks, about 8 weeks, about 12 weeks, about 16 weeks,  about 20 weeks, about 24 weeks, about 28 weeks, about 32 weeks, about 36 weeks, about 40 weeks, about  44 weeks, about 48 weeks, about 52 weeks, about 56 weeks, about 60 weeks, about 64 weeks, about 68  weeks, about 72 weeks, about 76 weeks, about 80 weeks, about 84 weeks, about 88 weeks, about 92 weeks,  about 96 weeks, about 100 weeks, about 104 weeks, about 108 weeks, or more, after administration of the  unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual. In some  embodiments, the maintenance or the improvement of visual acuity (e.g., BCVA) compared to the visual  acuity prior to administration of the unit dose of rAAV particles is present at about 30 weeks or more after  administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye of the Attorney Docket No.17234.045WO1 individual. In some embodiments, the maintenance or the improvement of visual acuity (e.g., BCVA)  compared to the visual acuity prior to administration of the unit dose of rAAV particles is present at any of  about 30 weeks, about 34 weeks, about 44 weeks, about 6 months, about 1 year, about 1.5 years, about 2  years, about 3 years, about 5 years, about 10 years, or more, after administration of the unit dose of rAAV  particles to the one eye and / or to the contralateral eye of the individual.

[0163] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on best corrected visual acuity (BCVA) in the one eye and / or the contralateral eye. In some  embodiments, BCVA is expressed as an ETDRS score, which corresponds to the number of letters correctly  read (Vitale et al., (2016) JAMA Opthalmol 134(9):1041:1047). In some embodiments, an individual is  determined to have maintenance of vision and / or visual acuity if the individual loses fewer than 15 letters in  an ETDRS score (e.g., any of 15 or less, 14 or less, 13 or less, 12 or less, 11 or less, 10 or less, 9 or less, 8 or  less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, 2 or less, 1, or 0 letters) compared to prior to  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In some  embodiments, an individual is determined to have an improvement of vision and / or visual acuity if the  individual gains at least 15 letters (e.g., any of at least about 15, at least about 20, at least about 30, at least  about 40, at least about 50, at least about 60, or about 70 letters) comparted to prior to administration of  the unit dose of rAAV particles in the one eye and / or the contralateral eye.

[0164] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on central subfield thickness (CST) or central retinal thickness (CRT) in the one eye and / or the  contralateral eye. In some embodiments, CST or CRT is determined by SD‐OCT. In some embodiments,  treatment of an ocular neovascular disease in an individual after administration of the unit dose of rAAV  particles in the one eye and / or the contralateral eye is determined if the CST or CRT assessed by SD‐OCT is  decreased after administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye  compared to prior to administration of the unit dose of rAAV particles in the one eye and / or the  contralateral eye. In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is determined if  the CST or CRT assessed by SD‐OCT is maintained after administration of the unit dose of rAAV particles in  the one eye and / or the contralateral eye compared to prior to administration of the unit dose of rAAV  particles in the one eye and / or the contralateral eye.

[0165] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed Attorney Docket No.17234.045WO1 based on macular volume in the one eye and / or the contralateral eye. In some embodiments, macular  volume is determined by SD‐OCT. In some embodiments, treatment of an ocular neovascular disease in an  individual after administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye  is determined if the macular volume assessed by SD‐OCT is decreased after administration of the unit dose  of rAAV particles in the one eye and / or the contralateral eye compared to prior to administration of the unit  dose of rAAV particles in the one eye and / or the contralateral eye. In some embodiments, treatment of an  ocular neovascular disease in an individual after administration of the unit dose of rAAV particles in the one  eye and / or the contralateral eye is determined if the macular volume assessed by SD‐OCT is maintained  after administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye compared  to prior to administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye.

[0166] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on retinal thickness (e.g., central retinal thickness (CRT) or central subfield thickness (CST)) and  macular volume in the one eye and / or the contralateral eye. In some embodiments, CST and macular  volume are determined by SD‐OCT. In some embodiments, treatment of an ocular neovascular disease in an  individual after administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye  is determined if the CST and macular volume assessed by SD‐OCT are decreased after administration of the  unit dose of rAAV particles in the one eye and / or the contralateral eye compared to prior to administration  of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In some embodiments,  treatment of an ocular neovascular disease in an individual after administration of the unit dose of rAAV  particles in the one eye and / or the contralateral eye is determined if the CST and macular volume assessed  by SD‐OCT are maintained after administration of the unit dose of rAAV particles in the one eye and / or the  contralateral eye compared to prior to administration of the unit dose of rAAV particles in the one eye  and / or the contralateral eye.

[0167] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on the number of rescue therapy treatments (e.g., aflibercept injections) required by the individual  after administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In some  embodiments, treatment of an ocular neovascular disease in an individual after administration of the unit  dose of rAAV particles in the one eye and / or the contralateral eye is determined if an individual requires less  than one rescue therapy treatment (e.g., aflibercept injection) any of every 4 weeks, every 5 weeks, every 6  weeks, every 7 weeks, every 8 weeks, every 9 weeks, every 10 weeks, or more, after administration of the  unit dose of rAAV particles in the one eye and / or the contralateral eye.  Attorney Docket No.17234.045WO1

[0168] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is determined if  an individual does not require any rescue therapy treatment (e.g., aflibercept injection) for any of at least 1  week, at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7  weeks, at least 8 weeks, at least 9 weeks, at least 10 weeks, at least 15 weeks, at least 20 weeks, at least 30  weeks, at least 40 weeks, at least 50 weeks, at least 60 weeks, at least 70 weeks, at least 80 weeks, at least  90 weeks, at least 100 weeks, at least 110 weeks, or more, after administration of the unit dose of rAAV  particles in the one eye and / or the contralateral eye.

[0169] In some embodiments, the individual does not require any rescue therapy treatment (e.g.,  aflibercept injection) for any of at least about 24 months, at least about 23 months, at least about 22  months, at least about 21 months, at least about 20 months, at least about 19 months, at least about 18  months, at least about 17 months, at least about 16 months, at least about 15 months, at least about 14  months, at least about 13 months, at least about 12 months, at least about 11 months, at least about 10  months, at least about 9 months, at least about 8 months, at least about 7 months, at least about 6 months,  at least about 5 months, at least about 4 months, at least about 3 months, at least about 2 months, at least  about 1 month, at least about 3 weeks, at least about 2 weeks, or at least about 1 week after administration  of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In some embodiments, the  individual does not require any rescue therapy treatment (e.g., aflibercept injection) for at least about 12  months after administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye.  In some embodiments, the individual does not require any rescue therapy treatment (e.g., aflibercept  injection) for at least about 10 months after administration of the unit dose of rAAV particles in the one eye  and / or the contralateral eye. In some embodiments, the individual does not require any rescue therapy  treatment (e.g., aflibercept injection) for at least about 7 months after administration of the unit dose of  rAAV particles in the one eye and / or the contralateral eye. In some embodiments, the individual does not  require any rescue therapy treatment (e.g., aflibercept injection) for at least about 6 months after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In some  embodiments, the individual does not require any rescue therapy treatment (e.g., aflibercept injection) for  at least about 2 months after administration of the unit dose of rAAV particles in the one eye and / or the  contralateral eye. In some embodiments, the individual does not require any rescue therapy treatment (e.g.,  aflibercept injection) for at least about 1 month after administration of the unit dose of rAAV particles in the  one eye and / or the contralateral eye.

[0170] In some embodiments, administration of a single unit dose of rAAV particles to the one eye and / or  to the contralateral eye of a plurality of individuals results in at least about 50% (e.g., any of at least about Attorney Docket No.17234.045WO1 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at  least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or 100%) of  the individuals in the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept injection).  In  some embodiments, administration of a single unit dose of rAAV particles to the one eye and / or to the  contralateral eye of a plurality of individuals results in at least about 67% (e.g., any of at least about 67%, at  least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least  about 95%, at least about 99%, or 100%) of the individuals in the plurality not requiring an anti‐VEGF rescue  treatment (e.g., aflibercept injection). In some embodiments, administration of a single unit dose of rAAV  particles to the one eye and / or to the contralateral eye of a plurality of individuals results in at least about  50% of the individuals in the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept  injection).  In some embodiments, administration of a single unit dose of rAAV particles to the one eye  and / or to the contralateral eye of a plurality of individuals results in at least about 78% of the individuals in  the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept injection).  In some  embodiments, administration of a single unit dose of rAAV particles to the one eye and / or to the  contralateral eye of a plurality of individuals results in at least about 80% of the individuals in the plurality  not requiring an anti‐VEGF rescue treatment (e.g., aflibercept injection). In some embodiments,  administration of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a  plurality of individuals results in at least about 82% of the individuals in the plurality not requiring an anti‐ VEGF rescue treatment (e.g., aflibercept injection). In some embodiments, administration of a single unit  dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality of individuals results in  100% of the individuals in the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept  injection).

[0171] In some embodiments, administration of a single unit dose of rAAV particles to the one eye and / or  to the contralateral eye of a plurality of individuals results in at least about 50% (e.g., any of at least about  50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at  least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or 100%) of  the individuals in the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept injection) for at  least about 4 weeks after administration of the rAAV particles, e.g., any of at least about 4 weeks, at least  about 8 weeks, at least about 12 weeks, at least about 16 weeks, at least about 20 weeks, at least about 24  weeks, at least about 28 weeks, at least about 32 weeks, at least about 36 weeks, at least about 40 weeks,  at least about 44 weeks, at least about 48 weeks, at least about 52 weeks, at least about 56 weeks, at least  about 60 weeks, at least about 64 weeks, at least about 68 weeks, at least about 72 weeks, at least about 76  weeks, at least about 80 weeks, at least about 84 weeks, at least about 88 weeks, at least about 92 weeks, Attorney Docket No.17234.045WO1 at least about 96 weeks, at least about 100 weeks, at least about 104 weeks, at least about 108 weeks, or  more after administration of the rAAV particles. In some embodiments, administration of a single unit dose  of rAAV particles to the one eye and / or to the contralateral eye of a plurality of individuals results in at least  about 50% of the individuals in the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept  injection) for about 52 weeks or more, or about 56 weeks or more, after administration of the rAAV  particles.  In some embodiments, administration of a single unit dose of rAAV particles to the one eye  and / or to the contralateral eye of a plurality of individuals results in at least about 67% (e.g., any of at least  about 67%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about  90%, at least about 95%, at least about 99%, or 100%) of the individuals in the plurality not requiring an anti‐ VEGF rescue treatment (e.g., aflibercept injection) for at least about 20 weeks after administration of the  rAAV particles, e.g., any of at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least  about 32 weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48  weeks, at least about 52 weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks,  at least about 66 weeks, or more after administration of the rAAV particles.  In some embodiments,  administration of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a  plurality of individuals results in at least about 78% of the individuals in the plurality not requiring an anti‐ VEGF rescue treatment (e.g., aflibercept injection) for at least about 4 weeks after administration of the  rAAV particles, e.g., any of at least about 4 weeks, at least about 8 weeks, at least about 12 weeks, at least  about 16 weeks, at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32  weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks,  at least about 52 weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least  about 68 weeks, at least about 72 weeks, at least about 76 weeks, at least about 80 weeks, at least about 84  weeks, at least about 88 weeks, at least about 92 weeks, at least about 96 weeks, at least about 100 weeks,  at least about 104 weeks, at least about 108 weeks, or more, after administration of the rAAV particles. In  some embodiments, administration of a single unit dose of rAAV particles to the one eye and / or to the  contralateral eye of a plurality of individuals results in at least about 78% of the individuals in the plurality  not requiring an anti‐VEGF rescue treatment (e.g., aflibercept injection) for about 20 weeks or more, or  about 36 weeks or more, after administration of the rAAV particles. In some embodiments, administration  of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality of  individuals results in at least about 80% of the individuals in the plurality not requiring an anti‐VEGF rescue  treatment (e.g., aflibercept injection) for at least about 20 weeks after administration of the rAAV particles,  e.g., any of at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32  weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks, Attorney Docket No.17234.045WO1 at least about 52 weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least  about 66 weeks, or more after administration of the rAAV particles. In some embodiments, administration  of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality of  individuals results in at least about 82% of the individuals in the plurality not requiring an anti‐VEGF rescue  treatment (e.g., aflibercept injection) for at least about 20 weeks after administration of the rAAV particles,  e.g., any of at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32  weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks,  at least about 52 weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least  about 66 weeks, or more, after administration of the rAAV particles. In some embodiments, administration  of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality of  individuals results in 100% of the individuals in the plurality not requiring an anti‐VEGF rescue treatment  (e.g., aflibercept injection) for at least about 20 weeks after administration of the rAAV particles, e.g., any of  at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32 weeks, at least  about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks, at least about 52  weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least about 66 weeks,  or more, after administration of the rAAV particles. In some embodiments, administration of a single unit  dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality of individuals results in  100% of the individuals in the plurality not requiring an anti‐VEGF rescue treatment (e.g., aflibercept  injection) for at least about 4 weeks after administration of the rAAV particles, e.g., any of any of at least  about 4 weeks, at least about 8 weeks, at least about 12 weeks, at least about 16 weeks, at least about 20  weeks, at least about 24 weeks, at least about 28 weeks, at least about 32 weeks, at least about 36 weeks,  at least about 40 weeks, at least about 44 weeks, at least about 48 weeks, at least about 52 weeks, at least  about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least about 68 weeks, at least about 72  weeks, at least about 76 weeks, at least about 80 weeks, at least about 84 weeks, at least about 88 weeks,  at least about 92 weeks, at least about 96 weeks, at least about 100 weeks, at least about 104 weeks, at  least about 108 weeks, or more after administration of the rAAV particles.  In some embodiments,  administration of a single unit dose of rAAV particles to the one eye and / or to the contralateral eye of a  plurality of individuals results in 100% of the individuals in the plurality not requiring an anti‐VEGF rescue  treatment (e.g., aflibercept injection) for any of about 64 weeks or more, 72 weeks or more, or 84 weeks or  more, after administration of the rAAV particles.

[0172] In some embodiments, administration of a unit dose of rAAV particles in the one eye and / or the  contralateral eye of a plurality of individuals results in about 78% or less (e.g., any of about 78% or less,  about 75% or less, about 70% or less, about 65% or less, about 60% or less, about 55% or less, about 50% or Attorney Docket No.17234.045WO1 less, about 45% or less, about 40% or less, about 35% or less, about 30% or less, about 25% or less, about  20% or less, about 15% or less, about 10% or less, about 5% or less, about 2.5% or less, about 1% or less, or  about 0.5% or less) of the individuals in the plurality requiring any rescue treatment (e.g., aflibercept  injection) in the one eye and / or the contralateral eye. In some embodiments, administration of a unit dose  of rAAV particles in the one eye and / or the contralateral eye of a plurality of individuals results in about 50%  or less (e.g., any of about 50% or less, about 45% or less, about 40% or less, about 35% or less, about 30% or  less, about 25% or less, about 20% or less, about 15% or less, about 10% or less, about 5% or less, about  2.5% or less, about 1% or less, or about 0.5% or less) of the individuals in the plurality requiring any rescue  treatment (e.g., aflibercept injection) in the one eye and / or the contralateral eye. In some embodiments,  administration of a unit dose of rAAV particles in the one eye and / or the contralateral eye of a plurality of  individuals results in less than about 30% (e.g., less than any of about 30%, about 25%, about 20%, about  15%, about 10%, about 5%, about 2.5%, about 1%, or about 0.5%) of the individuals in the plurality requiring  any rescue treatment (e.g., aflibercept injection) in the one eye and / or the contralateral eye. In some  embodiments, administration of a unit dose of rAAV particles in the one eye and / or the contralateral eye of  a plurality of individuals results in less than about 30% of the individuals in the plurality requiring any rescue  treatment (e.g., aflibercept injection) in the one eye and / or the contralateral eye. In some embodiments,  administration of a unit dose of rAAV particles in the one eye and / or the contralateral eye of a plurality of  individuals results in less than about 20% of the individuals in the plurality requiring any rescue treatment  (e.g., aflibercept injection) in the one eye and / or the contralateral eye. In some embodiments,  administration of a unit dose of rAAV particles in the one eye and / or the contralateral eye of a plurality of  individuals results in 0% of the individuals in the plurality requiring any rescue treatment (e.g., aflibercept  injection) in the one eye and / or the contralateral eye.

[0173] In some embodiments, administration of a unit dose of rAAV particles in the one eye and / or the  contralateral eye of a plurality of individuals results in about 78% or less (e.g., any of about 78% or less,  about 75% or less, about 70% or less, about 65% or less, about 60% or less, about 55% or less, about 50% or  less, about 45% or less, about 40% or less, about 35% or less, about 30% or less, about 25% or less, about  20% or less, about 15% or less, about 10% or less, about 5% or less, about 2.5% or less, about 1% or less, or  about 0.5% or less) of the individuals in the plurality requiring any rescue treatment (e.g., aflibercept  injection) for at least about 4 weeks after administration of the rAAV particles, e.g., any of at least about 4  weeks, at least about 8 weeks, at least about 12 weeks, at least about 16 weeks, at least about 20 weeks, at  least about 24 weeks, at least about 28 weeks, at least about 32 weeks, at least about 36 weeks, at least  about 40 weeks, at least about 44 weeks, at least about 48 weeks, at least about 52 weeks, at least about 56  weeks, at least about 60 weeks, at least about 64 weeks, at least about 68 weeks, at least about 72 weeks, Attorney Docket No.17234.045WO1 at least about 76 weeks, at least about 80 weeks, at least about 84 weeks, at least about 88 weeks, at least  about 92 weeks, at least about 96 weeks, at least about 100 weeks, at least about 104 weeks, at least about  108 weeks, or more, after administration of the rAAV particles. In some embodiments, administration of a  unit dose of rAAV particles in the one eye and / or the contralateral eye of a plurality of individuals results in  less than about 30% (e.g., less than any of about 30%, about 25%, about 20%, about 15%, about 10%, about  5%, about 2.5%, about 1%, or about 0.5%) of the individuals in the plurality requiring any rescue treatment  (e.g., aflibercept injection) for at least about 20 weeks after administration of the rAAV particles, e.g., any of  at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32 weeks, at least  about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks, at least about 52  weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least about 66 weeks,  or more, after administration of the rAAV particles. In some embodiments, administration of a unit dose of  rAAV particles in the one eye and / or the contralateral eye of a plurality of individuals results in less than  about 30% of the individuals in the plurality requiring any rescue treatment (e.g., aflibercept injection) in the  one eye and / or the contralateral eye for at least about 20 weeks after administration of the rAAV particles,  e.g., any of at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32  weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks,  at least about 52 weeks, at least about 56 weeks, at least about 60 weeks, at least about 64 weeks, at least  about 66 weeks, or more, after administration of the rAAV particles. In some embodiments, administration  of a unit dose of rAAV particles in the one eye and / or the contralateral eye of a plurality of individuals  results in less than about 20% of the individuals in the plurality requiring any rescue treatment (e.g.,  aflibercept injection) in the one eye and / or the contralateral eye for at least about 20 weeks after  administration of the rAAV particles, e.g., any of at least about 20 weeks, at least about 24 weeks, at least  about 28 weeks, at least about 32 weeks, at least about 36 weeks, at least about 40 weeks, at least about 44  weeks, at least about 48 weeks, at least about 52 weeks, at least about 56 weeks, at least about 60 weeks,  at least about 64 weeks, at least about 66 weeks,  or more after administration of the rAAV particles. In  some embodiments, administration of a unit dose of rAAV particles in the one eye and / or the contralateral  eye of a plurality of individuals results in 0% of the individuals in the plurality requiring any rescue treatment  (e.g., aflibercept injection) in the one eye and / or the contralateral eye for at least about 20 weeks after  administration of the rAAV particles, e.g., any of at least about 20 weeks, at least about 24 weeks, at least  about 28 weeks, at least about 32 weeks, at least about 36 weeks, at least about 40 weeks, at least about 44  weeks, at least about 48 weeks, at least about 52 weeks, at least about 56 weeks, at least about 60 weeks,  at least about 64 weeks, at least about 66 weeks, or more after administration of the rAAV particles. In some  embodiments, administration of a unit dose of rAAV particles in the one eye and / or the contralateral eye of Attorney Docket No.17234.045WO1 a plurality of individuals results in 0% of the individuals in the plurality requiring any rescue treatment (e.g.,  aflibercept injection) in the one eye and / or the contralateral eye for at least about 4 weeks after  administration of the rAAV particles, e.g., any of at least about 4 weeks, at least about 8 weeks, at least  about 12 weeks, at least about 16 weeks, at least about 20 weeks, at least about 24 weeks, at least about 28  weeks, at least about 32 weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks,  at least about 48 weeks, at least about 52 weeks, at least about 56 weeks, at least about 60 weeks, at least  about 64 weeks, at least about 68 weeks, at least about 72 weeks, at least about 76 weeks, at least about 80  weeks, at least about 84 weeks, at least about 88 weeks, at least about 92 weeks, at least about 96 weeks,  at least about 100 weeks, at least about 104 weeks, at least about 108 weeks, or more, after administration  of the rAAV particles.

[0174] In some embodiments, administration of the unit dose of rAAV particles to the one eye and / or to  the contralateral eye of a plurality of individuals results in a reduction in the mean annualized anti‐VEGF  injection rate of any of at least about 80%, at least about 85%, at least about 87%, at least about 90%, at  least about 95%, at least about 99%, or 100%, compared to the mean annualized anti‐VEGF injection rate  prior to administration of the unit dose of rAAV particles. In some embodiments, administration of the unit  dose of rAAV particles to the one eye and / or to the contralateral eye of a plurality of individuals results in a  reduction in the mean annualized anti‐VEGF injection rate of about 87% or more compared to the mean  annualized anti‐VEGF injection rate prior to administration of the unit dose of rAAV particles. In some  embodiments, administration of the unit dose of rAAV particles to the one eye and / or to the contralateral  eye of a plurality of individuals results in a reduction in the mean annualized anti‐VEGF injection rate of  100% compared to the mean annualized anti‐VEGF injection rate prior to administration of the unit dose of  rAAV particles.

[0175] In some embodiments, the mean annualized anti‐VEGF injection rate prior to administration of the  unit dose of rAAV particles is calculated according to the formula:  Annualized rate prior to administration of the unit dose of rAAV particles = (number of anti‐VEGF injections  in 12 months prior to administration of the unit dose of rAAV particles)  /  (days from the first anti‐VEGF  injection in the past 12 months prior to administration of the unit dose of rAAV particles to the  administration of the unit dose of rAAV particles  /  365.25)

[0176] In some embodiments, the mean annualized anti‐VEGF injection rate after administration of the  unit dose of rAAV particles is calculated according to the formula: Attorney Docket No.17234.045WO1 Annualized rate after administration of the unit dose of rAAV particles = (number of anti‐VEGF injections  since administration of the unit dose of rAAV particles)  /  (days from administration of the unit dose of rAAV  particles  /  365.25).

[0177] In some embodiments, an individual is determined to require a rescue treatment (e.g., anti‐VEGF  intravitreal injection, such as aflibercept injection) after administration of the rAAV particles if the individual  exhibits loss of 10 or more letters in BCVA (e.g., using the ETDRS protocol) in the one eye and / or the  contralateral eye administered the rAAV particles that is attributed to intraretinal or subretinal fluid (e.g., as  determined by SD‐OCT) compared to the BCVA in the one eye and / or the contralateral eye administered the  rAAV particles prior to administration of the rAAV particles. In some embodiments, an individual is  determined to require a rescue treatment (e.g., anti‐VEGF intravitreal injection, such as aflibercept injection)  after administration of the rAAV particles if the individual exhibits an increase in central subfield thickness  (e.g., CST or CRT) greater than 75 μm in the one eye and / or the contralateral eye administered the rAAV  particles compared to the central subfield thickness in the one eye and / or the contralateral eye  administered the rAAV particles prior to administration of the rAAV particles, e.g., as determined by SD‐OCT.  In some embodiments, an individual is determined to require a rescue treatment (e.g., anti‐VEGF intravitreal  injection, such as aflibercept injection) after administration of the rAAV particles if the individual exhibits  vision‐threatening hemorrhage due to AMD in the one eye and / or the contralateral eye administered the  rAAV particles.

[0178] In some embodiments, a rescue treatment comprises administration of a standard of care anti‐ VEGF therapy.  Such standard of care anti‐VEGF therapy comprises one or more anti‐VEGF treatments (e.g.,  anti‐VEGF intravitreal injections). In some embodiments, a rescue treatment comprises one or more  aflibercept IVT injections.  In some embodiments, a rescue treatment comprises one or more aflibercept IVT  injections comprising about 2 mg of aflibercept.

[0179] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on the level of retinal fluid compared the level of retinal fluid prior to administration of the unit dose  of rAAV particles in the one eye and / or the contralateral eye. In some embodiments, treatment of an ocular  neovascular disease in an individual after administration of the unit dose of rAAV particles in the one eye  and / or the contralateral eye is determined if a reduction in retinal fluid is observed after administration of  the unit dose of rAAV particles in the one eye and / or the contralateral eye compared to the level of retinal  fluid prior to administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In  some embodiments, the ocular neovascular disease is wAMD. Attorney Docket No.17234.045WO1

[0180] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on the resolution of pigment epithelial detachment (PED) compared to PED prior to administration of  the unit dose of rAAV particles in the one eye and / or the contralateral eye. In some embodiments,  treatment of an ocular neovascular disease in an individual after administration of the unit dose of rAAV  particles in the one eye and / or the contralateral eye is determined if resolution of PED after administration  of the unit dose of rAAV particles in the one eye and / or the contralateral eye is observed, compared to PED  prior to administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye. In  some embodiments, the ocular neovascular disease is wAMD.

[0181] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on choroidal neovascularization (CNV) lesion growth as determined by fluorescein angiography. In  some embodiments, treatment of an ocular neovascular disease in an individual after administration of the  unit dose of rAAV particles in the one eye and / or the contralateral eye is determined if CNV lesions shrink  (e.g., by more than any of about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%,  about 70%, about 80%, or 100%) after administration of the unit dose of rAAV particles in the one eye  and / or the contralateral eye compared to CNV lesions present prior to administration of the unit dose of  rAAV particles in the one eye and / or the contralateral eye. In some embodiments, treatment of an ocular  neovascular disease in an individual after administration of the unit dose of rAAV particles in the one eye  and / or the contralateral eye is determined if CNV lesions do not grow (e.g., grow less than any of about  1%,  about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 15%,  or about 20%) after administration of the unit dose of rAAV particles in the one eye and / or the contralateral  eye compared to CNV lesions present prior to administration of the unit dose of rAAV particles in the one  eye and / or the contralateral eye. In some embodiments, the ocular neovascular disease is wAMD.

[0182] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on the anatomical features of the one eye and / or the contralateral eye based on any methods known  in the art (e.g., SD‐OCT, OCT, fluorescein angiography, digital color fundus photography, etc.). In some  embodiments, treatment of an ocular neovascular disease in an individual after administration of the unit  dose of rAAV particles in the one eye and / or the contralateral eye is determined if an improvement in  anatomical features of the one eye and / or the contralateral eye is observed after administration of the unit  dose of rAAV particles in the one eye and / or the contralateral eye. In some embodiments, the ocular  neovascular disease is wAMD. Attorney Docket No.17234.045WO1

[0183] In some embodiments, treatment of an ocular neovascular disease in an individual after  administration of the unit dose of rAAV particles in the one eye and / or the contralateral eye is assessed  based on ophthalmologic examination, intraocular pressure (e.g., using a Goldmann applanation tonometer  or Tono‐pen), indirect ophthalmoscopy, examination of the one eye and / or the contralateral eye and  adnexa, eyelid and / or pupil responsiveness, belpharoptosis, abnormal pupil shape, unequal pupils,  abnormal reaction to light, afferent pupillary defects, slit‐lamp examination (including of the eyelids,  conjunctiva, cornea, lens, iris, and anterior chamber), posterior segment abnormalities of the vitreous, optic  nerve, peripheral retina, and retinal vasculature, SD‐OCT, fluorescein angiography, digital color fundus  photography (including images of the retina, optic disc, and / or macula), aqueous humor sampling, vitreous  humor sampling, OCT‐angiography (OCT‐A), refraction and / or visual acuity (BCVA). In some embodiments,  SD‐OCT is performed to evaluate retinal thickness (e.g., central retinal thickness or central subfield  thickness), macular volume, and / or the presence of fluid (e.g., subretinal fluid or intraretinal fluid). In some  embodiments, the ocular neovascular disease is wAMD.

[0184] The unit dose of rAAV particles may be administered to the one eye and / or to the contralateral eye  of the individual by any method known in the art. For example, the unit dose of rAAV particles may be  administered to the one eye and / or to the contralateral eye of the individual intraocularly, or by intravitreal  injection. In some embodiments, the administration of the unit dose of rAAV particles to the one eye and / or  to the contralateral eye of the individual is intraocular.  In some embodiments, the administration of the  unit dose of rAAV particles to the one eye and / or to the contralateral eye of the individual is by intravitreal  injection (IVT) or subretinal injection. In some embodiments, the administration of the unit dose of rAAV  particles to the one eye and / or to the contralateral eye of the individual is by IVT injection. In some  embodiments, aseptic technique is employed to administer a unit dose of rAAV particles by intravitreal  injection. In some embodiments, aseptic technique with providone‐iodine is employed to administer a unit  dose of rAAV particles by intravitreal injection.

[0185] In some embodiments, the individual has not received a prior treatment for an ocular neovascular  disease. In some embodiments, the individual has not received a prior treatment in the one eye and / or the  contralateral eye for an ocular neovascular disease. In some embodiments, the individual has not received a  prior treatment with an anti‐VEGF agent (e.g., bevacizumab, brolucizumab, ranibizumab, faricimab, abicipar  pegol, conbercept, OPT‐302, KSI‐301, injectable sunitinib maleate (GB‐102), PAN‐90806 (PanOptica), and / or  aflibercept). In some embodiments, the individual has not received a prior treatment with an anti‐VEGF  agent (e.g., bevacizumab, brolucizumab, ranibizumab, faricimab, abicipar pegol, conbercept, OPT‐302, KSI‐ 301, injectable sunitinib maleate (GB‐102), PAN‐90806 (PanOptica), and / or aflibercept) in the one eye  and / or the contralateral eye. In some embodiments, the individual has not received a prior aflibercept Attorney Docket No.17234.045WO1 treatment. In some embodiments, the individual has not received a prior aflibercept treatment in the one  eye and / or the contralateral eye.    Steroid Treatments

[0186] In some embodiments, the unit dose of rAAV particles is administered in combination with steroid  treatment. In some embodiments, the steroid treatment is a corticosteroid treatment. Exemplary  corticosteroids include, without limitation, aclometasone, amcinomide, beclometasone, betamethasone,  budesonide, ciclesonide, clobetasol, clobetasone, clocortolone, cloprednol, cortivazol, deflazacort,  deoxycorticosterone, desonide desoximetasone, dexamethasone, diflorasone, diflucortolone, difluprednate,  fluclorolone, fludrocortisone, fludroxycortide, flumetasone, flunisolide, fluocinolone acetonide,  fluocinonide, fluocortin, fluocortolone, fluorometholone, fluperolone, fluticasone, fuprednidene,  formocortal, halcinonide, halometasone, hydrocortisone aceponate, hydrocortisone buteprate,  hydrocortisone butyrate, loteprednol, medrysone, meprednisone, methylprednisolone, methylprednisolone  aceponate, mometasone furoate, paramethasone, prednicarbate, prednisone, prednisolone, prednylidene,  remexolone, tixocortol, triamcinolone, and ulobetasol. In some embodiments, the steroid treatment is a  systemic steroid treatment. In some embodiments, the steroid treatment is an oral steroid treatment. In  some embodiments, the steroid treatment is an ophthalmic steroid treatment. In some embodiments, the  ophthalmic steroid treatment is a topical steroid treatment (e.g. a drop), a periocular steroid treatment  (e.g., subtenons, subconjunctival), an intravitreal steroid treatment, or a superchoroidal steroid treatment.  In some embodiments, the topical steroid treatment is a difluprednate treatment, a medrysone treatment, a  loteprednol treatment, a prednisolone treatment, a fluocinolone treatment, a triamcinolone treatment, a  rimexolone treatment, a dexamethasone treatment, a fluorometholone treatment, a fluocinolone  treatment, a rimexolone treatment, or a prednisone treatment. In some embodiments, the ophthalmic  steroid treatment is a difluprednate treatment. In some embodiments, the steroid treatment is a prednisone  treatment. In some embodiments, the steroid treatment is a difluprednate treatment.

[0187] In some embodiments, the steroid treatment comprises a systemic steroid treatment and a topical  steroid treatment. In some embodiments, the systemic steroid treatment is an oral steroid treatment. In  some embodiments, the systemic steroid treatment is a prednisone treatment.  In some embodiments, the  topical steroid treatment is a difluprednate treatment. In some embodiments, the systemic steroid  treatment and the topical steroid treatment are administered simultaneously (e.g., on the same day). In  some embodiments, the systemic steroid treatment and the topical steroid treatment are administered  separately (e.g., on different days).  Attorney Docket No.17234.045WO1

[0188] In some embodiments, the steroid treatment is an oral treatment such as, but not limited to, a  prednisone treatment, methylprednisolone treatments, budesonide treatment, triamcinolone treatment,  hydrocortisone treatment, and betamethasone treatment. In some embodiments, the oral steroid  treatment (e.g., prednisone) is a daily steroid treatment for up to about 4 weeks, about 6 weeks, about 8  weeks, or about 9 weeks from administering the unit dose of rAAV particles.  In some embodiments, the oral  steroid treatment (e.g., prednisone) is administered at a dose of: 1ess than about 0.8 mg / kg / day to about  1.00 mg / kg / day for the week prior to through week two following administering the unit dose of rAAV  particles, less than about 0.59 mg / kg / day to about 0.75 mg / kg / day on weeks three to five following  administering the unit dose of rAAV particles, less than about 0.4 mg / kg / day to about 0.6 mg / kg / day on  week six after administering the unit dose of rAAV particles, less than about 0.25 mg / kg / day to about 0.375  mg / kg / day on week seven after administering the unit dose of rAAV particles, less than about 0.14  mg / kg / day to about 0.28 mg / kg / day on week eight after administering the unit dose of rAAV particles, and  less than about 0.063 mg / kg / day  to about 0.125 mg / kg / day on week nine after administering the unit dose  of rAAV particles. In some embodiments, the oral steroid treatment is administered at a dose of: 1ess than  or equal to about 1.00 mg / kg / day for the week prior to through week two following administering the unit  dose of rAAV particles, less than or equal to about 0.75 mg / kg / day on weeks three to five following  administering the unit dose of rAAV particles, less than or equal to about 0.6 mg / kg / day on week six after  administering the unit dose of rAAV particles, less than or equal to about 0.375 mg / kg / day on week seven  after administering the unit dose of rAAV particles, less than or equal to about 0.28 mg / kg / day on week  eight after administering the unit dose of rAAV particles, and less than or equal to about 0.125 mg / kg / day  on week nine after administering the unit dose of rAAV particles.  In some embodiments, the oral steroid  treatment is administered at a dose of about 0.125 mg / kg / day to about 0.14 mg / kg / day on the first four  days of week nine after administering the unit dose of rAAV particles and about 0.0625 mg / kg / day to about  0.070 mg / kg / day on the first four days of week nine after administering the unit dose of rAAV particles if the  individual weighs 70 kg or more.

[0189] In some embodiments, the steroid is administered before, during, and / or after administration of  the unit dose of rAAV particles. In some embodiments, the steroid is administered before, during, and after  administration of the unit dose of rAAV particles. In some embodiments, the steroid is administered during,  and after administration of the unit dose of rAAV particles. In some embodiments, the steroid is  administered before administration of the unit dose of rAAV particles. In some embodiments, the steroid is  administered during administration of the unit dose of rAAV particles. In some embodiments, the steroid is  administered before and during administration of the unit dose of rAAV particles.   In some embodiments,  the steroid is administered after administration of the unit dose of rAAV particles. In some embodiments, Attorney Docket No.17234.045WO1 the steroid is administered during and after administration of the unit dose of rAAV particles.  In some  embodiments, the steroid is administered before and / or after administration of the unit dose of rAAV  particles. In some embodiments, the steroid is administered before and after administration of the unit dose  of rAAV particles.

[0190] In some embodiments, the steroid treatment is a systemic steroid treatment. In some  embodiments, the systemic steroid treatment is an oral steroid treatment.

[0191] In some embodiments, the steroid treatment is an oral prednisone treatment. In some  embodiments, the oral prednisone treatment is initiated prior to administration of the unit dose of rAAV  particles. In some embodiments, an initial oral prednisone treatment is administered at a dose of any of  about 40 mg, about 45 mg, about 50 mg, about 55 mg, about 60 mg, about 65 mg, or about 70 mg of  prednisone per day any of about 7 days, about 6 days, about 5 days, about 4 days, about 3 days, about 2  days, about 1 day, or 0 days before administration of the unit dose of rAAV particles, and is continued for  any of about 3 days, about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, or  about 10 days, or more. In some embodiments, an initial oral prednisone treatment is administered at a  dose of about 60 mg of prednisone per day about 3 days before administration of the unit dose of rAAV, and  is continued for about 3 days.

[0192] In some embodiments, the initial oral prednisone treatment is followed by an oral prednisone  treatment dose taper. In some embodiments, the oral prednisone treatment dose taper is administered at a  dose of any of about 20 mg, about 25 mg, about 30 mg, about 35 mg, about 40 mg, about 45 mg, or about  50 mg of prednisone per day for a total of any of about 1 day, about 2 days, about 3 days, about 4 days,  about 5 days, about 6 days, or about 7 days, followed by a dose of about 10 mg, about 15 mg, about 20 mg  or about 25 mg of prednisone per day for any of about 1 day, about 2 days, about 3 days, or about 4 days,  followed by a dose of about 5 mg, about 10 mg, or about 15 mg of prednisone per day for about 1 day,  about 2 days, about 3 days, or about 4 days. In some embodiments, the prednisone dose taper is  administered at a dose of any of about 40 mg of prednisone per day for 3 days, followed by a dose of about  20 mg of prednisone per day for 2 days, followed by a dose of about 10 mg of prednisone per day for 2 days.

[0193] In some embodiments, an initial oral prednisone treatment is initiated 3 days before administration  of the unit dose of rAAV particles at a dose of 60 mg of prednisone per day for a total of 6 days, followed by  a dose of 40 mg of prednisone per day for a total of 3 days, followed by a dose of 20 mg of prednisone per  day for 2 days, followed by a dose of 10 mg of prednisone per day for 2 days.

[0194] In some embodiments, the steroid treatment is an oral treatment (e.g., prednisone). In some  embodiments, the oral steroid treatment (e.g., prednisone) is a daily steroid treatment for up to about 4  weeks, about 6 weeks, about 8 weeks, or about 9 weeks from administering the unit dose of rAAV particles.  Attorney Docket No.17234.045WO1 In some embodiments, the oral steroid treatment (e.g., prednisone) is administered at a dose of: 1ess than  about 0.8 mg / kg / day to about 1.00 mg / kg / day for the week prior to through week two following  administering the unit dose of rAAV particles, less than about 0.59 mg / kg / day to about 0.75 mg / kg / day on  weeks three to five following administering the unit dose of rAAV particles, less than about 0.4 mg / kg / day to  about 0.6 mg / kg / day on week six after administering the unit dose of rAAV particles, less than about 0.25  mg / kg / day to about 0.375 mg / kg / day on week seven after administering the unit dose of rAAV particles, less  than about 0.14 mg / kg / day to about 0.28 mg / kg / day on week eight after administering the unit dose of  rAAV particles, and less than about 0.063 mg / kg / day  to about 0.125 mg / kg / day on week nine after  administering the unit dose of rAAV particles. In some embodiments, the oral steroid treatment is  administered at a dose of: 1ess than or equal to about 1.00 mg / kg / day for the week prior to through week  two following administering the unit dose of rAAV particles, less than or equal to about 0.75 mg / kg / day on  weeks three to five following administering the unit dose of rAAV particles, less than or equal to about 0.6  mg / kg / day on week six after administering the unit dose of rAAV particles, less than or equal to about 0.375  mg / kg / day on week seven after administering the unit dose of rAAV particles, less than or equal to about  0.28 mg / kg / day on week eight after administering the unit dose of rAAV particles, and less than or equal to  about 0.125 mg / kg / day on week nine after administering the unit dose of rAAV particles.  In some  embodiments, the oral steroid treatment is administered at a dose of about 0.125 mg / kg / day to about 0.14  mg / kg / day on the first four days of week nine after administering the unit dose of rAAV particles and about  0.0625 mg / kg / day to about 0.070 mg / kg / day on the first four days of week nine after administering the unit  dose of rAAV particles if the individual weighs 70 kg or more.

[0195] In some embodiments, the steroid treatment is an ophthalmic steroid treatment. In some  embodiments, the ophthalmic steroid treatment is a difluprednate treatment. In some embodiments, the  steroid treatment is administered before, during, and / or after administration of the unit dose of rAAV  particles. In some embodiments, the steroid treatment is administered before administration of the unit  dose of rAAV particles. In some embodiments, the steroid treatment is administered during administration  of the unit dose of rAAV particles. In some embodiments, the steroid treatment is administered after  administration of the unit dose of rAAV particles. In some embodiments, the steroid treatment is  administered before and during administration of the unit dose of rAAV particles. In some embodiments,  the steroid treatment is administered before and after administration of the unit dose of rAAV particles. In  some embodiments, the steroid treatment is administered during, and after administration of the unit dose  of rAAV particles. In some embodiments, the steroid treatment is administered before, during, and after  administration of the unit dose of rAAV particles. Attorney Docket No.17234.045WO1

[0196] In some embodiments, the steroid treatment is an ophthalmic steroid treatment, e.g., a topical  steroid treatment. In some embodiments, the ophthalmic steroid treatment, e.g., a topical steroid  treatment, is a daily steroid treatment for up to 4 weeks, up to 6 weeks, up to 8 weeks, up to 3 months, up  to 4 months, up to 5 months, or up to 6 months after administration of the unit dose of rAAV particles. In  some embodiments, the topical steroid treatment comprises about four administrations of topical steroid  on about week 1, about three administrations of topical steroid on about week 2, about two administrations  of topical steroid on about week 3, and about one administration of topical steroid on about week 4; timing  starting with and following administration of the unit dose of rAAV particles. In some embodiments, the  topical steroid treatment comprises about four administrations of topical steroid per day (i.e., QID) for about  3 weeks after administration of the unit dose of rAAV particles, followed by about 3 administrations of  topical steroid per day (i.e., TID) for about 1 week, followed by about 2 administrations of topical steroid per  day (i.e., BID) for about 1 week, and followed by about 1 administration of topical steroid per day (i.e., QD)  for about 1 week. In some embodiments, the ophthalmic steroid treatment is extended at the discretion of  the treating physician.

[0197] In some embodiments, the ophthalmic steroid is about 0.005% to about 0.5% difluprednate. In  some embodiments, the ophthalmic steroid is any of about 0.005%, about 0.006%, about 0.007%, about  0.008%, about 0.009%, about 0.01%, about 0.02%, about 0.03%, about 0.4%, about 0.05%, about 0.06%,  about 0.07%, about 0.08%, about 0.09%, or about 0.1% difluprednate. In some embodiments, the  ophthalmic steroid is difluprednate 0.05%.  In some embodiments, a dose of difluprednate 0.05% is one  drop of ophthalmic solution.  In some embodiments, one drop is about 50 µl (e.g., about 25 µl to about 50  µl, or about 50 µl to about 100 µl).   In some embodiments, a dose of difluprednate comprises about 1 µg to  about 5 µg, or about 2 µg to about 3 µg, or about 2.5 µg difluprednate. In some embodiments, a dose of  difluprednate comprises about 2.5 µg difluprednate.

[0198] In some embodiments, the topical steroid treatment comprises a 7‐week topical steroid treatment,  e.g., 0.05% difluprednate. In some embodiments, the topical steroid treatment comprises about four  administrations of topical steroid per day (i.e., QID) for about four weeks, followed by about three  administrations of topical steroid per day (i.e., TID) for about one week, followed by about two  administrations of topical steroid per day (i.e., BID) for about one week, and followed by about one  administration of topical steroid per day (i.e., QD) for about one week; timing starting at about one week  prior to administration of the unit dose of rAAV particles.  In some embodiments, the topical steroid  treatment comprises about four administrations of topical steroid per day (i.e., QID) for about 28 days,  followed by about three administrations of topical steroid per day (i.e., TID) for about 7 days, followed by  about two administrations of topical steroid per day (i.e., BID) for about 7 days, and followed by about one Attorney Docket No.17234.045WO1 administration of topical steroid per day (i.e., QD) for about 7 days; timing starting at about 7 days prior to  administration of the unit dose of rAAV particles.  In some embodiments, the topical steroid treatment  comprises about four administrations of topical steroid per day (i.e., QID) on Day 1 to about Day 28,  followed by about three administrations of topical steroid per day (i.e., TID) on about Day 29 to about Day  35, followed by about two administrations of topical steroid per day (i.e., BID) on about Day 36 to about Day  42, and followed by about one administration of topical steroid per day (i.e., QD) on about Day 43 to about  Day 49; timing starting at Day 1.  In some embodiments, the topical steroid treatment is continued if  inflammation is present.

[0199] In some embodiments, the methods of treatment provided herein comprise administering an anti‐ VEGF agent (e.g., an aflibercept IVT injection) to one eye of the individual prior to administration of the unit  dose of rAAV particles to the one eye of the individual. In some embodiments, the anti‐VEGF agent is  administered about 7 days or about 1 week prior to administration of the unit dose of rAAV particles. In  some embodiments, the anti‐VEGF agent is administered on about Day 1 and the unit dose of rAAV particles  is administered on about Day 8. In some embodiments, the topical steroid treatment comprises a 7‐week  topical steroid treatment, e.g., 0.05% difluprednate. In some embodiments, the topical steroid treatment  comprises about four administrations of topical steroid per day (i.e., QID) for about four weeks, followed by  about three administrations of topical steroid per day (i.e., TID) for about one week, followed by about two  administrations of topical steroid per day (i.e., BID) for about one week, and followed by about one  administration of topical steroid per day (i.e., QD) for about one week; timing starting with and following  administration of the anti‐VEGF agent.  In some embodiments, the topical steroid treatment comprises  about four administrations of topical steroid per day (i.e., QID) for about 28 days, followed by about three  administrations of topical steroid per day (i.e., TID) for about 7 days, followed by about two administrations  of topical steroid per day (i.e., BID) for about 7 days, and followed by about one administration of topical  steroid per day (i.e., QD) for about 7 days; timing starting with and following administration of the anti‐VEGF  agent.  In some embodiments, the topical steroid treatment comprises about four administrations of topical  steroid per day (i.e., QID) on Day 1 to about Day 28, followed by about three administrations of topical  steroid per day (i.e., TID) on about Day 29 to about Day 35, followed by about two administrations of topical  steroid per day (i.e., BID) on about Day 36 to about Day 42, and followed by about one administration of  topical steroid per day (i.e., QD) on about Day 43 to about Day 49; timing starting at Day 1.  In some  embodiments, the topical steroid treatment is continued if inflammation is present.

[0200] In some embodiments, the topical steroid treatment comprises a 4‐month topical steroid  treatment, e.g., 0.05% difluprednate. In some embodiments, the topical steroid treatment comprises about  four administrations of topical steroid per day (i.e., QID) for about one month, followed by about three Attorney Docket No.17234.045WO1 administrations of topical steroid per day (i.e., TID) for about one month, followed by about two  administrations of topical steroid per day (i.e., BID) for about one month, and followed by about one  administration of topical steroid per day (i.e., QD) for about one month; timing starting at about one week  prior to administration of the unit dose of rAAV particles.  In some embodiments, the topical steroid  treatment comprises about four administrations of topical steroid per day (i.e., QID) for about 30 days,  followed by about three administrations of topical steroid per day (i.e., TID) for about 30 days, followed by  about two administrations of topical steroid per day (i.e., BID) for about 30 days, and followed by about one  administration of topical steroid per day (i.e., QD) for about 30 days; timing starting at about 7 days prior to  administration of the unit dose of rAAV particles.  In some embodiments, the topical steroid treatment  comprises about four administrations of topical steroid per day (i.e., QID) on Day 1 to about Day 30,  followed by about three administrations of topical steroid per day (i.e., TID) on about Day 31 to about Day  60, followed by about two administrations of topical steroid per day (i.e., BID) on about Day 61 to about Day  90, and followed by about one administration of topical steroid per day (i.e., QD) on about Day 91 to about  Day 120; timing starting at Day 1.  In some embodiments, the topical steroid treatment is continued if  inflammation is present.

[0201] In some embodiments, the methods of treatment provided herein comprise administering an anti‐ VEGF agent (e.g., an aflibercept IVT injection) to one eye of the individual prior to administration of the unit  dose of rAAV particles to the one eye of the individual. In some embodiments, the anti‐VEGF agent is  administered about 7 days or about 1 week prior to administration of the unit dose of rAAV particles. In  some embodiments, the anti‐VEGF agent is administered on about Day 1 and the unit dose of rAAV particles  is administered on about Day 8. In some embodiments, the topical steroid treatment comprises a 4‐month  topical steroid treatment, e.g., 0.05% difluprednate. In some embodiments, the topical steroid treatment  comprises about four administrations of topical steroid per day (i.e., QID) for about one month, followed by  about three administrations of topical steroid per day (i.e., TID) for about one month, followed by about two  administrations of topical steroid per day (i.e., BID) for about one month, and followed by about one  administration of topical steroid per day (i.e., QD) for about one month; timing starting with and following  administration of the anti‐VEGF agent.  In some embodiments, the topical steroid treatment comprises  about four administrations of topical steroid per day (i.e., QID) for about 30 days, followed by about three  administrations of topical steroid per day (i.e., TID) for about 30 days, followed by about two  administrations of topical steroid per day (i.e., BID) for about 30 days, and followed by about one  administration of topical steroid per day (i.e., QD) for about 30 days; timing starting with and following  administration of the anti‐VEGF agent.  In some embodiments, the topical steroid treatment comprises  about four administrations of topical steroid per day (i.e., QID) on Day 1 to about Day 30, followed by about Attorney Docket No.17234.045WO1 three administrations of topical steroid per day (i.e., TID) on about Day 31 to about Day 60, followed by  about two administrations of topical steroid per day (i.e., BID) on about Day 61 to about Day 90, and  followed by about one administration of topical steroid per day (i.e., QD) on about Day 91 to about Day 120;  timing starting at Day 1.  In some embodiments, the topical steroid treatment is continued if inflammation is  present.  Vectors for Delivering Transgenes to Target Cells

[0202] In some embodiments, the recombinant adeno‐associated virus (rAAV) particles comprise a  recombinant viral vector derived from adeno‐associated virus (AAV) that has been altered so that it is  replication‐defective in the subject (e.g., a human or a non‐human primate).  In some embodiments, the  adeno‐associated virus (AAV) is a recombinant AAV (rAAV).

[0203] AAV or rAAV are small non‐enveloped single‐stranded DNA viruses. rAAVs are non‐pathogenic  human parvoviruses and can be made to be dependent on helper viruses, including adenovirus, herpes  simplex virus, vaccinia virus and CMV, for replication.

[0204] Exposure to wild type (wt) AAV is not associated or known to cause any human pathologies and is  common in the general population, making AAV or rAAV a suitable delivery system for gene therapy. AAV  and rAAV used for gene therapy for delivery of an anti‐VEGF agent, e.g., aflibercept, can be of any serotype.   In some embodiments, the methods of the disclosure provide for use of any suitable AAV serotype,  including AAV1, AAV2, AAV2.5, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, rh10,  AAV‐DJ, and any hybrid or chimeric AAV thereof. In some embodiments, the serotype used is based on  tropism of the virus, or infectivity of a target cell of interest. In some embodiments, several AAV vectors may  be generated to allow selection of the most optimal serotype for use with an anti‐VEGF agent transgene  (e.g., aflibercept transgene).

[0205] In some embodiments, the methods of the present disclosure provide for the use of pseudotyped  AAV. Pseudotyped AAV particles comprise AAV genome inverted terminal repeats (ITRs) of one AAV  serotype enbcapsidated by an AAV capsid of another AAV serotype. Typically, pseudotyped AAV is  designated as “AAV# / #”, where the first “#” indicates the AAV ITR serotype and the second “#” indicates  capsid serotype. For example, an AAV particle comprising AAV2 ITRs and an AAV1 capsid would be  designated “AAV2 / 1”.

[0206] In some embodiments, the rAAV particles comprise a nucleic acid, e.g., a heterologous nucleic acid.  In some embodiments, the nucleic acid encodes a transgene, e.g., an anti‐VEGF agent (e.g., aflibercept). In  some embodiments, the encoded transgene, e.g., anti‐VEGF agent, is under the transcriptional control of a  promoter that initiates transcription of the nucleic acid. In some embodiments, the promoter is a Attorney Docket No.17234.045WO1 “ubiquitous” promoter. In some embodiments, the promoter is a “strong” or constitutively active promoter,  e.g., a cytomegalovirus (CMV) promoter, an elongation factor 1 alpha (EFla) promoter, a glyceraldehyde 3‐ phosphate dehydrogenase (GAPDH) promoter, or a connexin36 (or “Cx36”) promoter.  In some  embodiments, the promoter is a tissue‐specific promoter that is activated in specific tissues or cells, such as  retinal cells, to reduce potential toxicity or undesirable effects to non‐targeted cells. In some aspects,  several AAV vectors may be generated to allow selection of the most optimal serotype and promoter for use  with the anti‐VEGF agent transgene (e.g., aflibercept transgene). In some embodiments, the nucleic acid is  flanked by AAV inverted terminal repeats (ITRs). In some embodiments, the nucleic acid is flanked by AAV2  ITRs.

[0207] In some embodiments, the AAV vector comprises a polynucleotide cassette for enhanced  expression of a transgene (e.g., an anti‐VEGF agent such as aflibercept) in a target cell (e.g., a retinal cell).  In  some embodiments, the polynucleotide cassette comprises in 5' to 3' order: (a) a first enhancer region  comprising a CMV sequence (SEQ ID NO: 22); (b) a promoter region, comprising a CMV sequence (SEQ ID  NO: 23); (c) a 5'UTR region comprising, in 5' to 3' order, TPL and eMLP sequences (SEQ ID NO: 24 and SEQ ID  NO: 25, respectively); (d) a coding sequence encoding a peptide or polypeptide (e.g., an anti‐VEGF agent  such as aflibercept); (e) a second enhancer region comprising a full EES sequence (SEQ ID NO: 26); and (f) a  HGH polyadenylation site (SEQ ID NO: 27). In certain of these embodiments, the polynucleotide cassette  comprises one or more sequences selected from SEQ ID NOs: 28‐32, or a sequence with at least 85% identity  thereto. In certain of these embodiments, the 5' arm of the polynucleotide cassette comprises or consists of  SEQ ID NO: 33 or a sequence with at least 85% identity thereto. In certain of these embodiments, the 3' arm  of the polynucleotide cassette comprises or consists of SEQ ID NO: 34 or a sequence with at least 85%  identity thereto. The nucleic acid sequences of SEQ ID NOs: 22‐34 are provided below:   ACTTACGGTA AATGGCCCGC CTGGCTGACC GCCCAACGAC CCCCGCCCAT TGACGTCAAT AATGACGTAT  GTTCCCATAG TAACGCCAAT AGGGACTTTC CATTGACGTC AATGGGTGGA GTATTTACGG TAAACTGCCC  ACTTGGCAGT ACATCAAGTG TATCATATGC CAAGTCCGCC CCCTATTGAC GTCAATGACG GTAAATGGCC  CGCCTGGCAT TATGCCCAGT ACATGACCTT ACGGGACTTT CCTACTTGGC AGTACATCTA CGTATTAGTC  ATCGCTATTA CCA (SEQ ID NO: 22)    TGCTGATGCG GTTTTGGCAG TACACCAATG GGCGTGGATA GCGGTTTGAC TCACGGGGAT TTCCAAGTCT  CCACCCCATT GACGTCAATG GGAGTTTGTT TTGGCACCAA AATCAACGGG ACTTTCCAAA ATGTCGTAAT  AACCCCGCCC CGTTGACGCA AATGGGCGGT AGGCGTGTAC GGTGGGAGGT CTATATAAGC AGAGCTCGTT  TAGTGAACCG (SEQ ID NO: 23)    CTCACTCTCT TCCGCATCGC TGTCTGCGAG GGCCAGCTGT TGGGCTCGCG GTTGAGGACA AACTCTTCGC  GGTCTTTCCA GTACTCTTGG ATCGGAAACC CGTCGGCCTC CGAACGGTAC TCCGCCACCG AGGGACCTGA  GCGAGTCCGC ATCGACCGGA TCGGAAAACC TCTCGAGAAA GGCGTCTAAC CAGTCACAGT CGCAAGGTAG Attorney Docket No.17234.045WO1 GCTGAGCACC GTGGCGGGCG GCAGCGGGTG GCGGTCGGGG TTGTTTCTGG CGGAGGTGCT GCTGATGATG  TAATTAAAGT AGGCGGTCTT GAGACGGCGG ATGGTCGA (SEQ ID NO: 24)                                                       CCAGCTGTTG GGGTGAGTAC TCCCTCTCAA AAGCGGGCAT TACTTCTGCG CTAAGATTGT CAGTTTCCAA  AAACGAGGAG GATTTGATAT TCACCTGGCC CG (SEQ ID NO: 25)             CTGTTCTCAT CACATCATAT CAAGGTTATA TACCATCAAT ATTGCCACAG ATGTTACTTA GCCTTTTAAT  ATTTCTCTAA TTTAGTGTAT ATGCAATGAT AGTTCTCTGA TTTCTGAGAT TGAGTTTCTC ATGTGTAATG  ATTATTTAGA GTTTCTCTTT CATCTGTTCA AATTTTTGTC TAGTTTTATT TTTTACTGAT TTGTAAGACT TCTTTTTATA  ATCTGCATAT TACAATTCTC TTTACTGGGG TGTTGCAAAT ATTTTCTGTC ATTCTATGGC CTGACTTTTC  TTAATGGTTT TTTAATTTTA AAAATAAGTC TTAATATTCA TGCAATCTAA TTAACAATCT TTTCTTTGTG  GTTAGGACTT TGAGTCATAA GAAATTTTTC TCTACACTGA AGTCATGATG GCATGCTTCT ATATTATTTT  CTAAAAGATT TAAAGTTTTG CCTTCTCCAT TTAGACTTAT AATTCACTGG AATTTTTTTG TGTGTATGGT  ATGACATATG GGTTCCCTTT TATTTTTTAC ATATAAATAT ATTTCCCTGT TTTTCTAAAA AAGAAAAAGA  TCATCATTTT CCCATTGTAA AATGCCATAT TTTTTTCATA GGTCACTTAC ATATATCAAT GGGTCTGTTT  CTGAGCTCTA CTCTATTTTA TCAGCCTCAC TGTCTATCCC CACACATCTC ATGCTTTGCT CTAAATCTTG  ATATTTAGTG GAACATTCTT TCCCATTTTG TTCTACAAGA ATATTTTTGT TATTGTCTTT GGGCTTTCTA TATACATTTT  GAAATGAGGT TGACAAGTTA (SEQ ID NO: 26)     CTGCCCGGGT GGCATCCCTG TGACCCCTCC CCAGTGCCTC TCCTGGCCCT GGAAGTTGCC ACTCCAGTGC  CCACCAGCCT TGTCCTAATA AAATTAAGTT GCATCATTTT GTCTGACTAG GTGTCCTTCT ATAATATTAT  GGGGTGGAGG GGGGTGGTAT GGAGCAAGGG GCCCAAGTTG GGAAGAAACC TGTAGGGCCT GC (SEQ ID NO:  27)    AGGCGGTCTT GAGACGGCGG ATGGTCGAGG TGAGGTGTGG CAGGCTTGAG ATCCAGCTGT   TGGGGTGA (SEQ ID NO: 28)                                                                   CGCTGTTTTG ACCTCCATAG TGGACACCGG GACCGATCCA GCCTCCGCGT CTCAGGGGAG ATCTCGTTTA  GTGAACCGTC AGATCCTCAC TCTCTTCCGC ATCGCTGTCT GCGAGGGCCA   GCTGTTGGG (SEQ ID NO: 29)                                                                     TTGATATTCA CCTGGCCCGA TCTGGCCATA CACTTG (SEQ OD NO: 30)     CCCAGGTCCA AGTTTAAACG CC (SEQ ID NO: 31)    TCTTTGGGCT TTCTATATAC ATTTTGAAAT GAGGTTGACA AGTTACCTAG GAAAACTGTC TTCCTGCCCG GGTGGCA  (SEQ ID NO: 32)    CTCTGGAGAC GACTTACGGT AAATGGCCCG CCTGGCTGAC CGCCCAACGA CCCCCGCCCA TTGACGTCAA  TAATGACGTA TGTTCCCATA GTAACGCCAA TAGGGACTTT CCATTGACGT CAATGGGTGG AGTATTTACG  GTAAACTGCC CACTTGGCAG TACATCAAGT GTATCATATG CCAAGTCCGC CCCCTATTGA CGTCAATGAC  GGTAAATGGC CCGCCTGGCA TTATGCCCAG TACATGACCT TACGGGACTT TCCTACTTGG CAGTACATCT  ACGTATTAGT CATCGCTATT ACCATGCTGA TGCGGTTTTG GCAGTACACC AATGGGCGTG GATAGCGGTT  TGACTCACGG GGATTTCCAA GTCTCCACCC CATTGACGTC AATGGGAGTT TGTTTTGGCA CCAAAATCAA  CGGGACTTTC CAAAATGTCG TAATAACCCC GCCCCGTTGA CGCAAATGGG CGGTAGGCGT GTACGGTGGG  AGGTCTATAT AAGCAGAGCT CGTTTAGTGA ACCGTCAGAT CGCCTGGAGA GGCCATCCAC GCTGTTTTGA  CCTCCATAGT GGACACCGGG ACCGATCCAG CCTCCGCGTC TCAGGGGAGA TCTCGTTTAG TGAACCGTCA  GATCCTCACT CTCTTCCGCA TCGCTGTCTG CGAGGGCCAG CTGTTGGGCT CGCGGTTGAG GACAAACTCT  TCGCGGTCTT TCCAGTACTC TTGGATCGGA AACCCGTCGG CCTCCGAACG GTACTCCGCC ACCGAGGGAC Attorney Docket No.17234.045WO1 CTGAGCGAGT CCGCATCGAC CGGATCGGAA AACCTCTCGA GAAAGGCGTC TAACCAGTCA CAGTCGCAAG  GTAGGCTGAG CACCGTGGCG GGCGGCAGCG GGTGGCGGTC GGGGTTGTTT CTGGCGGAGG TGCTGCTGAT  GATGTAATTA AAGTAGGCGG TCTTGAGACG GCGGATGGTC GAGGTGAGGT GTGGCAGGCT TGAGATCCAG  CTGTTGGGGT GAGTACTCCC TCTCAAAAGC GGGCATTACT TCTGCGCTAA GATTGTCAGT TTCCAAAAAC  GAGGAGGATT TGATATTCAC CTGGCCCGAT CTGGCCATAC ACTTGAGTGA CAATGACATC CACTTTGCCT  TTCTCTCCAC AGGTGTCCAC TCCCAGGTCC AAGTTTAAAC GCCGCCACCA TG (SEQ ID NO: 33)    ACTGTTCTCA TCACATCATA TCAAGGTTAT ATACCATCAA TATTGCCACA GATGTTACTT AGCCTTTTAA  TATTTCTCTA ATTTAGTGTA TATGCAATGA TAGTTCTCTG ATTTCTGAGA TTGAGTTTCT CATGTGTAAT  GATTATTTAG AGTTTCTCTT TCATCTGTTC AAATTTTTGT CTAGTTTTAT TTTTTACTGA TTTGTAAGAC TTCTTTTTAT  AATCTGCATA TTACAATTCT CTTTACTGGG GTGTTGCAAA TATTTTCTGT CATTCTATGG CCTGACTTTT  CTTAATGGTT TTTTAATTTT AAAAATAAGT CTTAATATTC ATGCAATCTA ATTAACAATC TTTTCTTTGT  GGTTAGGACT TTGAGTCATA AGAAATTTTT CTCTACACTG AAGTCATGAT GGCATGCTTC TATATTATTT  TCTAAAAGAT TTAAAGTTTT GCCTTCTCCA TTTAGACTTA TAATTCACTG GAATTTTTTT GTGTGTATGG  TATGACATAT GGGTTCCCTT TTATTTTTTA CATATAAATA TATTTCCCTG TTTTTCTAAA AAAGAAAAAG  ATCATCATTT TCCCATTGTA AAATGCCATA TTTTTTTCAT AGGTCACTTA CATATATCAA TGGGTCTGTT  TCTGAGCTCT ACTCTATTTT ATCAGCCTCA CTGTCTATCC CCACACATCT CATGCTTTGC TCTAAATCTT GATATTTAGT  GGAACATTCT TTCCCATTTT GTTCTACAAG AATATTTTTG TTATTGTCTT TGGGCTTTCT ATATACATTT  TGAAATGAGG TTGACAAGTT ACCTAGGAAA ACTGTCTTCC TGCCCGGGTG GCATCCCTGT GACCCCTCCC  CAGTGCCTCT CCTGGCCCTG GAAGTTGCCA CTCCAGTGCC CACCAGCCTT GTCCTAATAA AATTAAGTTG  CATCATTTTG TCTGACTAGG TGTCCTTCTA TAATATTATG GGGTGGAGGG GGGTGGTATG GAGCAAGGGG  CCCAAGTTGG GAAGAAACCT GTAGGGCCTG CGAAGACAGT CAG (SEQ ID NO: 34)

[0208] In some embodiments, the polynucleotide cassette comprises or consists of SEQ ID NO: 39 or a  sequence with at least 85% identity thereto.  gcgcgctcgctcgctcactgaggccgcccgggcaaagcccgggcgtcgggcgacctttggtcgcccggcctcagtgagcgagcgagcgcgcagagaggga gtggccaactccatcactaggggttccttgtagttaatgattaacccgccatgctacttatctacgtactctggagacgacttacggtaaatggcccgcctggc tgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttac ggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagta catgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatgctgatgcggttttggcagtacaccaatgggcgtggatagc ggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataacccc gccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagatcgcctggagaggccatccacg ctgttttgacctccatagtggacaccgggaccgatccagcctccgcgtctcaggggagatctcgtttagtgaaccgtcagatcctcactctcttccgcatcgct gtctgcgagggccagctgttgggctcgcggttgaggacaaactcttcgcggtctttccagtactcttggatcggaaacccgtcggcctccgaacggtactccg ccaccgagggacctgagcgagtccgcatcgaccggatcggaaaacctctcgagaaaggcgtctaaccagtcacagtcgcaaggtaggctgagcaccgtgg cgggcggcagcgggtggcggtcggggttgtttctggcggaggtgctgctgatgatgtaattaaagtaggcggtcttgagacggcggatggtcgaggtgaggt gtggcaggcttgagatccagctgttggggtgagtactccctctcaaaagcgggcattacttctgcgctaagattgtcagtttccaaaaacgaggaggatttga tattcacctggcccgatctggccatacacttgagtgacaatgacatccactttgcctttctctccacaggtgtccactcccaggtccaagtttaaacgccgccac catggtgtcatactgggatactggagtcttgctttgtgccctgctgtcctgcctcctcctgactggctccagctcgggctcagataccggtcgccccttcgtgga gatgtactccgagatcccggaaattatccacatgactgaggggcgcgaacttgtgatcccctgccgggtcaccagcccgaacattactgtgactttgaagaa gttccccctggacaccctgattccggatgggaagagaattatctgggattcacggaagggattcatcatcagcaacgcgacctacaaggaaattggcctcct cacttgcgaagccactgtgaacggacacttgtacaagaccaactacctgacccaccgccagaccaacaccatcatcgacgtcgtcctgtccccttcgcacgg gatcgagctctcggtgggagagaagttggtgcttaactgcaccgcccggacggaactgaatgtgggaatcgacttcaactgggaatacccgtccagcaagc atcagcataagaagctggtgaaccgggacctcaagactcagtccggcagcgaaatgaagaagttcctgtcgaccctcactattgacggagtgaccagatcc gaccagggcctctacacttgcgccgcttccagcggactcatgaccaagaagaacagcactttcgtgagggtgcatgagaaggacaagacccacacgtgtccAttorney Docket No.17234.045WO1 gccgtgcccagccccagagctgctgggaggcccttccgtgttcctgtttccgcccaagccaaaggataccctgatgatctcaaggacccctgaggtcacatgc gtcgtggtggatgtgtcgcacgaggaccctgaagtcaaattcaattggtatgtggacggagtggaagtccacaacgcgaaaaccaagccgagagaagaac agtacaattccacctaccgggtggtgtcggtgctgactgtgctgcaccaggactggctcaacggaaaggagtacaagtgcaaggtgtccaacaaggctctg cccgcacctattgaaaagaccatctccaaggccaagggtcaacctcgcgagcctcaggtgtacactctgcctccaagccgggacgaactgactaagaacca agtctctctgacctgtttggtgaagggcttctacccgtcagacatcgcagtggagtgggagtcaaacggtcagccggagaacaactacaaaacaacccccc ccgtgctggactccgacggctccttcttcctgtactccaagcttaccgtggataagagccgctggcaacagggcaacgtgttttcctgctccgtcatgcacgaa gccctgcacaaccattatacccagaagtccctgtcgctgtcccccgggaaatagtgactgttctcatcacatcatatcaaggttatataccatcaatattgcca cagatgttacttagccttttaatatttctctaatttagtgtatatgcaatgatagttctctgatttctgagattgagtttctcatgtgtaatgattatttagagtttct ctttcatctgttcaaatttttgtctagttttattttttactgatttgtaagacttctttttataatctgcatattacaattctctttactggggtgttgcaaatattttct gtcattctatggcctgacttttcttaatggttttttaattttaaaaataagtcttaatattcatgcaatctaattaacaatcttttctttgtggttaggactttgagtc ataagaaatttttctctacactgaagtcatgatggcatgcttctatattattttctaaaagatttaaagttttgccttctccatttagacttataattcactggaat ttttttgtgtgtatggtatgacatatgggttcccttttattttttacatataaatatatttccctgtttttctaaaaaagaaaaagatcatcattttcccattgtaaa atgccatatttttttcataggtcacttacatatatcaatgggtctgtttctgagctctactctattttatcagcctcactgtctatccccacacatctcatgctttgct ctaaatcttgatatttagtggaacattctttcccattttgttctacaagaatatttttgtta  ttgtctttgggctttctatatacattttgaaatgaggttgacaagttacctaggaaaactgtcttcctgcccgggtggcatccctgtgacccctccccagtgcctc tcctggccctggaagttgccactccagtgcccaccagccttgtcctaataaaattaagttgcatcattttgtctgactaggtgtccttctataatattatggggtg gaggggggtggtatggagcaaggggcccaagttgggaagaaacctgtagggcctgcgtacgtagataagtagcatggcgggttaatcattaactacaagg aacccctagtgatggagttggccactccctctctgcgcgctcgctcgctcactgaggccgggcgaccaaaggtcgcccgacgcccgggctttgcccgggcgg cctcagtgagcgagcgagcgcgc (SEQ ID NO: 39)

[0209] SEQ ID NO: 39 shown above comprises, in the 5’ to 3’ direction, an inverted terminal repeat (ITR) of  AAV serotype 2 comprising nucleotides 1‐145 of SEQ ID NO: 39; a CMV promoter comprising nucleotides  180‐693 of SEQ ID NO: 39; a 5’ Untranslated Region (UTR), including an Adenovirus Tripartite Leader  Sequence and Synthetic Intron, and comprising nucleotides 694‐1314 of SEQ ID NO: 39; a Kozak sequence  comprising nucleotides 1329‐1340 of SEQ ID NO: 39; a codon‐optimized aflibercept cDNA sequence  comprising  nucleotides 1338‐2714 of SEQ ID NO: 39; a 3’ UTR including a human scaffold attachment region  and comprising nucleotides 2717‐3527 of SEQ ID NO: 39; a human growth hormone  polyadenylation / transcription stop signal comprising nucleotides 3546‐3748 of SEQ ID NO: 39; and an  inverted terminal repeat (ITR) of AAV serotype 2 comprising nucleotides 3772‐3916 of SEQ ID NO: 39.

[0210] Additional polynucleotide cassettes for enhanced expression of a transgene (e.g., a transgene  encoding an anti‐VEGF agent such as aflibercept) in a target cell (such as a retinal cell) are disclosed in  WO2018 / 170473, the contents of which related to polynucleotide cassettes for enhanced expression of a  transgene in a target cell are incorporated herein by reference.

[0211] In some embodiments, the rAAV particles comprise a variant capsid protein having increased  infectivity of target cells, e.g. retinal cells, are used to increase transduction of retinal cells or to increase  targeting of gene delivery to retinal cells in an individual. In some embodiments, the rAAV particle comprises  an amino acid modification in a capsid protein GH loop / loop IV of the AAV capsid protein. In some  embodiments, the site of modification is a solvent‐accessible portion of the GH loop / loop IV of the AAV Attorney Docket No.17234.045WO1 capsid protein. For a description of the GH loop / loop IV of AAV capsid, see, e.g., van Vliet et al. (2006) Mol.  Ther. 14:809; Padron et al. (2005) J. Virol. 79:5047; and Shen et al. (2007) Mol. Ther. 15:1955. Several AAV  capsid variants are known, including the 7m8 variant. In some embodiments, a rAAV particle comprises a  variant AAV capsid protein that comprises an insertion of from 5 amino acids to 11 amino acids, e.g., 7  amino acid sequence, in the GH loop of a capsid protein relative to a corresponding parental AAV capsid  protein, and wherein the variant capsid protein confers increased infectivity of a retinal cell compared to the  infectivity of the retinal cell by an AAV particle comprising the corresponding parental or unmodified AAV  capsid protein. In some embodiments, any one of the following amino acid sequences can be inserted in the  GH loop of a capsid protein: LALGETTRPA (SEQ ID NO: 1); LANETITRPA (SEQ ID NO: 2), LAKAGQANNA (SEQ ID  NO: 3), LAKDPKTTNA (SEQ ID NO: 4), KDTDTTR (SEQ ID NO: 5), RAGGSVG (SEQ ID NO: 6), AVDTTKF (SEQ ID  NO: 7), STGKVPN (SEQ ID NO: 8), LAKDTDTTRA (SEQ ID NO: 9), LARAGGSVGA (SEQ ID NO: 10), LAAVDTTKFA  (SEQ ID NO: 11), and LASTGKVPNA (SEQ ID NO: 12), LGETTRP (SEQ ID NO: 14), NETITRP (SEQ ID NO: 15),  KAGQANN (SEQ ID NO: 16), KDPKTTN (SEQ ID NO: 17), KDTDTTR (SEQ ID NO: 18), RAGGSVG (SEQ ID NO: 19),  AVDTTKF (SEQ ID NO: 20), and STGKVPN (SEQ ID NO: 21).  In some embodiments, any one of the amino acid  sequences set forth in SEQ ID NOs: 1‐12 and 14‐21 is inserted in the solvent‐exposed GH loop of VP1 capsid  protein in a rAAV. Additional details regarding amino acid sequences that can be inserted into the GH loop  of a capsid protein, e.g., to facilitate transduction of a nucleic acid of interest to a retinal cell following IVT  injection, are provided in WO2012145601, US9587282, US10202657, and US10214785, the contents of  which related to amino acid sequences that can be inserted into the GH loop of a capsid protein are  incorporated herein by reference.

[0212] In some embodiments, the rAAV particles comprise an AAV capsid protein, e.g., an AAV2 capsid  protein, that includes any one of the following amino acid sequences: LALGETTRPA (SEQ ID NO: 1);  LANETITRPA (SEQ ID NO: 2), LAKAGQANNA (SEQ ID NO: 3), LAKDPKTTNA (SEQ ID NO: 4), KDTDTTR (SEQ ID  NO: 5), RAGGSVG (SEQ ID NO: 6), AVDTTKF (SEQ ID NO: 7), STGKVPN (SEQ ID NO: 8), LAKDTDTTRA (SEQ ID  NO: 9), LARAGGSVGA (SEQ ID NO: 10), LAAVDTTKFA (SEQ ID NO: 11), and LASTGKVPNA (SEQ ID NO: 12),  LGETTRP (SEQ ID NO: 14), NETITRP (SEQ ID NO: 15), KAGQANN (SEQ ID NO: 16), KDPKTTN (SEQ ID NO: 17),  KDTDTTR (SEQ ID NO: 18), RAGGSVG (SEQ ID NO: 19), AVDTTKF (SEQ ID NO: 20), and STGKVPN (SEQ ID NO:  21) inserted at the following positions: between positions 587 and 588 of the AAV2 capsid protein; between  amino acids 590 and 591 of the AAV1 capsid protein; between amino acids 575 and 576 of the AAV5 capsid  protein; between amino acids 590 and 591 of the AAV6 capsid protein; between amino acids 589 and 590 of  the AAV7 capsid protein; between amino acids 590 and 591 of the AAV8 capsid protein; between amino  acids 588 and 589 of the AAV9 capsid protein; or between amino acids 589 and 590 of the AAV10 capsid  protein. In some embodiments, the rAAV particles comprise AAV2 capsid proteins comprising an amino acid Attorney Docket No.17234.045WO1 sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid protein,  wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some  embodiments, the rAAV particles comprise AAV2 capsid proteins comprising the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the AAV2 VP1 comprising the  sequence of SEQ ID NO: 13.

[0213] In some embodiments, rAAV particles comprise the 7m8 variant capsid protein from AAV2  comprising the amino acid sequence LALGETTRPA (SEQ ID NO: 1) inserted in the GH loop of the AAV2 VP1  protein between positions 587 and 588 of the AAV2 VP1. In some embodiments, the rAAV particles  comprise an AAV2 VP1 capsid protein comprising a GH loop that comprises the amino acid sequence of SEQ  ID NO: 38 or an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 38. In some  embodiments, the rAAV particles comprise an AAV2 VP1 capsid protein comprising a GH loop that comprises  an amino acid sequence having any of at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at  least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 38.   FSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDI  RDQSRNWLPGPCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDE  EKFFPQSGVLIFGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNLAL  GETTRPARQAATADVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLK  HPPPQILIKN (SEQ ID NO: 38)

[0214] In some embodiments, rAAV particles comprise the 7m8 variant capsid protein from AAV2  comprising the amino acid sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of  the AAV2 VP1. The sequence of the 7m8 variant capsid protein from AAV2 comprising the amino acid  sequence LALGETTRPA (SEQ ID NO: 1) is inserted between positions 587 and 588 of the AAV2 VP1 is  provided below:     MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAY DRQLDSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGK AGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAPSGLGTNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMG DRVITTSTRTWALPTYNNHLYKQISSQSGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLF NIQVKEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYF PSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQSRNWLPG PCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLIFGKQGSEKTNVDIEKVMITAttorney Docket No.17234.045WO1 DEEEIRTTNPVATEQYGSVSTNLQRGNLALGETTRPARQAATADVNTQGVLPGMVWQDRDVYLQGPIWAKIPHTDGHFH PSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYNKSVNVDF TVDTNGVYSEPRPIGTRYLTRNL (SEQ ID NO: 37)

[0215] In some embodiments, the rAAV particles comprise a capsid protein VP1 comprising the amino acid  sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the capsid protein, wherein  the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some embodiments, the  rAAV particles comprise a capsid protein VP2 comprising the amino acid sequence LGETTRP (SEQ ID NO: 14)  inserted between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein. In some embodiments, the rAAV particles comprise a capsid  protein VP3 comprising the amino acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587  and 588 of the capsid protein, wherein the amino acid residue numbering corresponds to an AAV2 VP1  capsid protein. In some embodiments, the rAAV particles comprise capsid proteins VP1, VP2, and VP3,  wherein each of VP1, VP2, and VP3 comprise the amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein.

[0216] In some embodiments, the rAAV particles comprise a capsid protein VP1 comprising the amino acid  sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid protein,  wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some  embodiments, the rAAV particles comprise a capsid protein VP2 comprising the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid protein, wherein the  amino acid residue numbering corresponds to an AAV2 VP1 capsid protein. In some embodiments, the rAAV  particles comprise a capsid protein VP3 comprising the amino acid sequence LALGETTRPA (SEQ ID NO: 1)  inserted between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein. In some embodiments, the rAAV particles comprise capsid  proteins VP1, VP2, and VP3, wherein each of VP1, VP2, and VP3 comprise the amino acid sequence  LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid protein, wherein the  amino acid residue numbering corresponds to an AAV2 VP1 capsid protein.

[0217] In some embodiments, a recombinant virus and / or plasmid used to generate a rAAV virus  comprises other transcriptional or regulatory elements, such as a poly A (polyadenylation) sequence,  untranslated regions (UTRs), 3’ UTRs, or termination sequences.  In some embodiments, more than one  gene is expressed from the vector or plasmid using internal ribosome entry site (IRES) or similar element  that allows co‐expression of two or more proteins or create multigene, or polycistronic mRNA. Attorney Docket No.17234.045WO1

[0218] In some embodiments, the rAAV and / or plasmid used to generate the rAAV comprises one or  more of the following nucleic acid elements: a first ITR sequence; a promoter sequence; an intron sequence;  a first UTR sequence; a heterologous nucleic acid encoding an anti‐VEGF agent (e.g., aflibercept); a second  UTR sequence; a polyA sequence; and a second ITR sequence. In some embodiments, linker sequence(s) are  inserted between two or more of the nucleic acid elements. In some embodiments, the heterologous  nucleic acid encodes a therapeutic polypeptide, e.g., encodes aflibercept (or a functional fragment or  functional variant thereof).

[0219] In some embodiments, the vector is a targeted vector, especially a targeted rAAV (e.g., AAV2.7m8)  that shows higher infectivity of a specific cell, such as a retinal cell (e.g., a photoreceptor, a retinal ganglion  cell, a Müller cell, a bipolar cell, an amacrine cell, a horizontal cell, or a retinal pigmented epithelium cell).  Viral vectors for use in the disclosure can include those that exhibit low toxicity and / or low immunogenicity  in an individual and expresses therapeutically effective quantities of the anti‐VEGF agent (e.g., aflibercept) in  an individual, e.g., a human. Any suitable method known in the art can be used in the biochemical  purification of recombinant viruses (e.g., rAAV), e.g., for the preparation of pharmaceutical compositions  described elsewhere herein. Recombinant AAV viruses can be harvested directly from cells, or from the  culture media comprising cells. Virus can be purified using various biochemical means, such as gel filtration,  filtration, chromatography, affinity purification, gradient ultracentrifugation, or size exclusion methods.  In  some embodiments, the virus is lyophilized.

[0220] In some embodiments, the rAAV particles comprise a 7m8 variant capsid protein, e.g., rAAV2.7m8,  and a nucleic acid sequence that encodes an anti‐VEGF agent (e.g., aflibercept, or a functional fragment or  functional variant thereof). In some embodiments, the rAAV particles (e.g., the 7m8 variant) have an  increase in retinal cell infectivity of any of at least 5%, at least 10%, at least 20%, at least 30%, at least 40%,  at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100% as compared to an AAV  particle comprising the corresponding parental or unmodified AAV capsid protein. In some embodiments,  the increase in infectivity of retinal cells is an increase of any of between 5% to 100%, between 5% to 95%,  between 5% to 90%, between 5% to 85%, between 5% to 80%, between 5% to 75%, between 5% to 70%,  between 5% to 65%, between 5% to 60%, between 5% to 55%, between 5% to 50%, between 5% to 45%,  between 5% to 40%, between 5% to 35%, between 5% to 30%, between 5% to 25%, between 5% to 20%,  between 5% to 15%, or between 5% to 10%, as compared to an AAV particle comprising the corresponding  parental or unmodified AAV capsid protein.

[0221] In some embodiments, the increase in retinal cell infectivity of a rAAV variant, e.g., rAAV2.7m8, is  any of at least 1‐fold, at least 1.1‐fold, at least 1.2‐fold, at least 1.3‐fold, at least 1.4‐fold, at least 1.5‐fold, at  least 1.6‐fold, at least 1.7‐fold, at least 1.8‐fold, at least 1.9‐fold, or at least 2‐fold compared to an AAV Attorney Docket No.17234.045WO1 particle comprising the corresponding parental or unmodified AAV capsid protein. In some embodiments,  the increase in infectivity is any of at least 2‐fold, at least 3‐fold, at least 4‐fold, at least 5‐fold, at least 6‐fold,  at least 7‐fold, at least 8‐fold, at least 9‐fold, or at least 10‐fold, as compared to an AAV particle comprising  the corresponding parental AAV capsid protein. In some embodiments, the increase in infectivity is any of at  least 15‐fold, at least 20‐fold, at least 25‐fold, at least 30‐fold, at least 35‐fold, at least 40‐fold, at least 45‐ fold, at least 50‐fold, at least 55‐fold, at least 60‐fold, at least 65‐fold, at least 70‐fold, at least 75‐fold, at  least 80‐fold, at least 85‐fold, at least 90‐fold, or at least 100‐fold compared to an AAV particle comprising  the corresponding parental or unmodified AAV capsid protein.

[0222] In some embodiments, the increase in retinal cell infectivity of a rAAV variant, e.g., rAAV2.7m8,  is  between 10‐fold to 100‐fold, between 10‐fold to 95‐fold, between 10‐fold to 90‐fold, between 10‐fold to 85‐ fold, between 10‐fold to 80‐fold, between 10‐fold to 75‐fold, between 10‐fold to 70‐fold, between 10‐fold to  65‐fold, between 10‐fold to 60‐fold, between 10‐fold to 55‐fold, between 10‐fold to 50‐fold, between 10‐ fold to 45‐fold, between 10‐fold to 40‐fold, between 10‐fold to 35‐fold, between 10‐fold to 30‐fold, between  10‐fold to 25‐fold, between 10‐fold to 20‐fold, or between 10‐fold to 15‐fold, as compared to an AAV  particle comprising the corresponding parental or unmodified AAV capsid protein.

[0223] In some embodiments, the increase in retinal cell infectivity is between 2‐fold to 20‐fold, between  2‐fold to 19‐fold, between 2‐fold to 18‐fold, between 2‐fold to 17‐fold, between 2‐fold to 16‐fold, between  2‐fold to 15‐fold, between 2‐fold to 14‐fold, between 2‐fold to 13‐fold, between 2‐fold to 12‐fold, between  2‐fold to 11‐fold, between 2‐fold to 10‐fold, between 2‐fold to 9‐fold, between 2‐fold to 8‐fold, between 2‐ fold to 7‐fold, between 2‐fold to 6‐fold, between 2‐fold to 5‐fold, between 2‐fold to 4‐fold, or between 2‐ fold to 3‐fold, as compared to an AAV particle comprising the corresponding parental or unmodified AAV  capsid protein.

[0224] In some embodiments, an amino acid modification of a capsid protein described herein can confer  an increase in an ability to cross an internal limiting membrane (ILM) in an eye of an individual, e.g., a  human, as compared to the ability of an AAV particle comprising the corresponding parental or unmodified  AAV capsid protein to cross the ILM in the eye of the subject. In some embodiments, the increase in the  ability to cross the ILM of a rAAV variant, e.g., rAAV2.7m8, is an increase of any of at least 5%, at least 10%,  at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or  at least 100% as compared to an AAV particle comprising the corresponding parental or unmodified AAV  capsid protein.  In some embodiments, the increase in the ability to cross the ILM is an increase of between  5% to 100%, between 5% to 95%, between 5% to 90%, between 5% to 85%, between 5% to 80%, between  5% to 75%, between 5% to 70%, between 5% to 65%, between 5% to 60%, between 5% to 55%, between 5%  to 50%, between 5% to 45%, between 5% to 40%, between 5% to 35%, between 5% to 30%, between 5% to Attorney Docket No.17234.045WO1 25%, between 5% to 20%, between 5% to 15%, or between 5% to 10%, as compared to the parental or  unmodified AAV capsid protein.

[0225] In some embodiments, the increase in the ability to cross the ILM of a rAAV variant, e.g.,  rAAV2.7m8, is any of at least 1‐fold, at least 1.1‐fold, at least 1.2‐fold, at least 1.3‐fold, at least 1.4‐fold, at  least 1.5‐fold, at least 1.6‐fold, at least 1.7‐fold, at least 1.8‐fold, at least 1.9‐fold, or at least 2‐fold compared  to an AAV particle comprising the corresponding parental AAV capsid protein.  In some embodiments, the  increase in the ability to cross the ILM is any of at least 2‐fold, at least 3‐fold, at least 4‐fold, at least 5‐fold,  at least 6‐fold, at least 7‐fold, at least 8‐fold, at least 9‐fold, or at least...

Claims

Attorney Docket No.17234.045WO1 CLAIMS  1. A method for treating an ocular neovascular disease in an individual, the method comprising  administering a unit dose of about 2 × 1011 vector genomes (vg) or less of recombinant adeno‐associated  virus (rAAV) particles to one eye of the individual, wherein the individual is a human, and wherein the rAAV  particles comprise:  a) a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats  (ITRs), and  b) an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein.

2. The method of claim 1, wherein retinal fluid in the eye of the individual with an ocular  neovascular disease is reduced.

3. A method for reducing retinal fluid in an eye of an individual with an ocular neovascular disease,  the method comprising administering a unit dose of rAAV particles to one eye of the individual, wherein the  individual is a human, and wherein the rAAV particles comprise:  a) a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats  (ITRs), and  b) an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein.

4. The method of claim 3, wherein the individual has received at least one treatment of an anti‐ VEGF agent in about 12 weeks prior to administration of the unit dose of rAAV particles.

5. The method of claim 3 or claim 4, wherein the amount or presence of retinal fluid in the one eye  of the individual is refractory to prior treatment with an anti‐VEGF agent.

6. The method of claim 4 or claim 5, wherein the anti‐VEGF agent is aflibercept. Attorney Docket No.17234.045WO1   7. The method of any one of claims 2‐6, wherein the retinal fluid in the one eye is reduced by at  least about 60%.

8. The method of any one of claims 2‐7, wherein the retinal fluid in the one eye is reduced by  about 80% compared to the level of retinal fluid in the one eye of the individual prior to administration of  the rAAV to the individual.

9. The method of any one of claims 2‐8, wherein the retinal fluid is subretinal fluid (SRF) or  intraretinal fluid (IRF).

10. The method of any one of claims 3‐9, wherein the unit dose of rAAV particles is about 6 × 1011  vector genomes per eye (vg / eye) or less.

11. A method for treating an ocular neovascular disease in an individual, the method comprising:  (a) administering an anti‐VEGF agent to one eye of the individual; and  (b) administering a unit dose of about 6 × 1011 vector genomes (vg) or less of recombinant adeno‐associated  virus (rAAV) particles to the one eye of the individual after administration of the anti‐VEGF agent, wherein  the individual is a human, and wherein the rAAV particles comprise:    (i) a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats  (ITRs), and    (ii) an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14)  inserted between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein.

12. The method of claim 11, comprising administering the unit dose of rAAV particles to the one eye  of the individual about 1 week or about 7 days after administration of the anti‐VEGF agent.

13. The method of claim 11 or claim 12, comprising administering the anti‐VEGF agent to the one  eye of the individual on Day 1, and administering the unit dose of rAAV particles to the one eye of the  individual on Day 8.    Attorney Docket No.17234.045WO1 14. The method of any one of claims 11‐13, wherein the anti‐VEGF agent comprises aflibercept.

15. The method of claim 14, where the aflibercept is administered at a dose of about 2 mg by  intravitreal injection.

16. The method of any one of claims 1‐15, wherein the unit dose of rAAV particles is between about  6 × 1010 to about 6 × 1011 vector genomes per eye (vg / eye).

17. The method of any one of claims 1‐16, wherein the unit dose of rAAV particles is between about  6 × 1010 to about 2 × 1011 vector genomes per eye (vg / eye).

18. The method of any one of claims 1‐16, wherein the unit dose of rAAV particles is between about  2 × 1011 to about 6 × 1011 vector genomes per eye (vg / eye).

19. The method of claim 18, wherein the unit dose of rAAV particles is about 2 × 1011 or about 6 ×  1011 vector genomes per eye (vg / eye).

20. The method claim 19, wherein the unit dose of rAAV particles is about 2 × 1011 vector genomes  per eye (vg / eye).

21. The method claim 19, wherein the unit dose of rAAV particles is about 6 × 1011 vector genomes  per eye (vg / eye).

22. The method of any one of claims 1‐21, wherein the individual has one or more symptoms of an  ocular neovascular disease in the contralateral eye.

23. The method of any one of claims 1‐22, further comprising administering a unit dose of rAAV  particles to the contralateral eye of the individual.

24. The method of claim 23, wherein the administering the unit dose of rAAV particles to the  contralateral eye is up to about 2 weeks after administering the unit dose of rAAV particles to the one eye.

25. The method of claim 24, wherein: Attorney Docket No.17234.045WO1 (a) the administering the unit dose of rAAV particles to the contralateral eye is on the same day as the  administering the unit dose of rAAV particles to the one eye; or  (b) the administering the unit dose of rAAV particles to the contralateral eye is between about 1 day to  about 14 days after administering the unit dose of rAAV particles to the one eye.

26. The method of claim 24 or claim 25, wherein the unit dose of rAAV particles administered to the  contralateral eye of the individual comprises the same or less vector genomes per eye (vg / eye) than the unit  dose of rAAV particles administered to the one eye of the individual.

27. The method of claim 23, wherein the administering the unit dose of rAAV particles to the  contralateral eye is at least about 2 weeks after administering the unit dose of rAAV particles to the one eye.

28. The method of claim 27, wherein the unit dose of rAAV particles administered to the  contralateral eye of the individual comprises more vector genomes per eye (vg / eye) than the unit dose of  rAAV particles administered to the one eye of the individual.

29. The method of any one of claims 1‐28, wherein the nucleic acid comprises the nucleic acid  sequence of SEQ ID NO: 40 or a sequence having at least 85% identity thereto.

30. The method of any one of claims 1‐29, wherein the polypeptide comprises the amino acid  sequence of SEQ ID NO:

35.

31. The method of any one of claims 1‐30, wherein the polypeptide comprises the amino acid  sequence of SEQ ID NO:

41.

32. The method of any one of claims 1‐31, wherein the polypeptide is aflibercept.

33. The method of any one of claims 1‐32, wherein the nucleic acid further comprises a first  enhancer region, a promoter region, a 5'UTR region,  a second enhancer region, and a polyadenylation site.

34. The method of any one of claims 1‐33, wherein the nucleic acid comprises, in the 5’ to 3’ order:     (a) a first enhancer region;     (b) a promoter region;  Attorney Docket No.17234.045WO1   (c) a 5'UTR region;   (d) a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about 95%  identity to the amino acid sequence of SEQ ID NO: 35;  (e) a second enhancer region; and   (f) a polyadenylation site;  and flanked by AAV2 inverted terminal repeats (ITRs).

35. The method of claim 33 or claim 34, wherein the first enhancer region comprises a CMV  sequence comprising the sequence of SEQ ID NO: 22 or a sequence having at least 85% identity thereto.

36. The method of any one of claims 33‐35, wherein the promoter region comprises a CMV  sequence comprising the sequence of SEQ ID NO: 23 or a sequence having at least 85% identity thereto.

37. The method of any one of claims 34‐36, wherein the nucleic acid encoding a polypeptide  comprises the nucleic acid sequence of SEQ ID NO: 40 or a sequence having at least 85% identity thereto.

38. The method of any one of claims 34‐37, wherein the polypeptide comprises the amino acid  sequence of SEQ ID NO: 35 or a sequence having at least 95% identity thereto.

39. The method of any one of claims 34‐38, wherein the polypeptide comprises the amino acid  sequence of SEQ ID NO: 41 or a sequence having at least 95% identity thereto.

40. The method of any one of claims 34‐39, wherein the polypeptide is aflibercept.

41. The method of any one of claims 33‐40, wherein the 5'UTR region comprises, in 5' to 3' order, a  TPL sequence comprising the sequence of SEQ ID NO: 24 or a sequence having at least 85% identity thereto,  and an eMLP sequence comprising the sequence of SEQ ID NO: 25 or a sequence having at least 85% identity  thereto.

42. The method of any one of claims 33‐41, wherein the second enhancer region comprises a full  EES sequence comprising the sequence of SEQ ID NO: 26 or a sequence having at least 85% identity thereto.    Attorney Docket No.17234.045WO1 43. The method of any one of claims 33‐42, wherein the polyadenylation site comprises a HGH  polyadenylation site comprising the sequence of SEQ ID NO: 27 or a sequence having at least 85% identity  thereto.

44. The method of any one of claims 1‐32, wherein the nucleic acid further comprises (a) a first  enhancer region comprising a CMV sequence comprising the sequence of  SEQ ID NO: 22 or a sequence  having at least 85% identity thereto; (b) a promoter region, comprising a CMV sequence comprising the  sequence of SEQ ID NO: 23 or a sequence having at least 85% identity thereto; (c) a 5'UTR region comprising,  in 5' to 3' order, a TPL sequence comprising the sequence of SEQ ID NO: 24 or a sequence having at least  85% identity thereto, and an eMLP sequence comprising the sequence of SEQ ID NO: 25 or a sequence  having at least 85% identity thereto; (d) a second enhancer region comprising a full EES sequence  comprising the sequence of SEQ ID NO: 26 or a sequence having at least 85% identity thereto; and (e) a HGH  polyadenylation site comprising the sequence of SEQ ID NO: 27 or a sequence having at least 85% identity  thereto.

45. The method of any one of claims 1‐44, wherein the nucleic acid comprises the sequence of SEQ  ID NO: 39 or a sequence having at least 85% identity thereto.

46. The method of any one of claims 1‐45, wherein the AAV2 capsid protein comprises the amino  acid sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the capsid protein,  wherein the amino acid residue numbering corresponds to an AAV2 VP1 capsid protein.

47. The method of any one of claims 1‐46, wherein the AAV2 capsid protein comprises the amino  acid sequence LGETTRP (SEQ ID NO: 14) inserted between positions 587 and 588 of the AAV2 VP1  comprising the sequence of SEQ ID NO:

13.

48. The method of any one of claims 1‐47, wherein the AAV2 capsid protein comprises the amino  acid sequence LALGETTRPA (SEQ ID NO: 1) inserted between positions 587 and 588 of the AAV2 VP1  comprising the sequence of SEQ ID NO:

13.

49. The method of any one of claims 1‐46, wherein the rAAV particles comprise an AAV2 VP1 capsid  protein comprising a GH loop that comprises the amino acid sequence of SEQ ID NO: 38 or an amino acid  sequence having at least 90% sequence identity to SEQ ID NO:

38. Attorney Docket No.17234.045WO1    50.  The method of any one of claims 1‐49, wherein the administration of the unit dose of rAAV  particles to the one eye and / or the contralateral eye is by intravitreal administration.

51. The method of any one of claims 1‐50, wherein the unit dose of rAAV particles is in a  pharmaceutical formulation.

52. The method of claim 51, wherein the pharmaceutical formulation comprises the rAAV particles,  sodium chloride, sodium phosphate and a surfactant.

53. The method of claim 52, wherein the pharmaceutical formulation comprises about 150 to about  200 mM sodium chloride, about 1 to about 10 mM monobasic sodium phosphate, about 1 to about 10 mM  dibasic sodium phosphate, about 0.0005% (w / v) to about 0.005% (w / v) poloxamer 188, and about 6 × 1013  to about 6 × 1010  vector genomes (vg) per mL (vg / mL) of the rAAV particles, wherein the pharmaceutical  formulation has a pH of about 7.0 to about 7.

5.

54. The method of claim 53, wherein the pharmaceutical formulation comprises about 180 mM  sodium chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic sodium phosphate, about  6 ×1012 vg / mL of the rAAV particles, and about 0.001% (w / v) poloxamer 188, wherein the pharmaceutical  formulation has a pH of about 7.

3.

55. The method of claim 53, wherein the pharmaceutical formulation comprises about 180 mM  sodium chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic sodium phosphate, about  2 ×1012 vg / mL of the rAAV particles, and about 0.001% (w / v) poloxamer 188, wherein the pharmaceutical  formulation has a pH of about 7.

3.

56. The method of claim 53, wherein the pharmaceutical formulation comprises about 180 mM  sodium chloride, about 5 mM monobasic sodium phosphate, about 5 mM dibasic sodium phosphate, about  6 ×1011 vg / mL of the rAAV particles, and about 0.001% (w / v) poloxamer 188, wherein the pharmaceutical  formulation has a pH of about 7.

3.

57. The method of any one of claims 1‐56, wherein the unit dose of rAAV particles administered to  the one eye and / or to the contralateral eye in a volume of about 25 μL to about 250 μL. Attorney Docket No.17234.045WO1   58. The method of claim 57, wherein the unit dose of rAAV particles administered to the one eye  and / or to the contralateral eye comprises a volume of about 100μL.

59. The method of claim 57, wherein the unit dose of rAAV particles administered to the one eye  and / or to the contralateral eye comprises a volume of about 30μL.

60. The method of any one of claims 1‐59, wherein the individual received prior treatment for the  ocular neovascular disease with an anti‐VEGF agent.

61. The method of claim 60, wherein the individual has received 1 or 2 injections of an anti‐VEGF  agent in the one eye and / or in the contralateral eye prior to administration of the rAAV particles in the one  eye and / or in the contralateral eye.

62. The method of any one of claims 1‐3 or 7‐59, wherein the individual has not received prior  treatment for the ocular neovascular disease with an anti‐VEGF agent.

63. The method of any one of claims 60‐62, wherein the anti‐VEGF agent is aflibercept.

64. The method of any one of claims 1‐63, wherein the ocular neovascular disease is wet age‐ related macular degeneration (AMD), retinal neovascularization, choroidal neovascularization diabetic  retinopathy, proliferative diabetic retinopathy, retinal vein occlusion, central retinal vein occlusion,  branched retinal vein occlusion, diabetic macular edema, diabetic retinal ischemia, ischemic retinopathy,  diabetic retinal edema, or any combination thereof.

65. The method of any one of claims 1‐10 or 16‐64, wherein the unit dose of rAAV particles is  administered in combination with steroid treatment.

66. The method of claim 65, wherein the steroid treatment is a corticosteroid treatment.

67. The method of claim 65 or claim 66, wherein the steroid treatment is a systemic steroid  treatment.   Attorney Docket No.17234.045WO1 68. The method of any one of claims 65‐67, wherein the steroid treatment is an oral steroid  treatment.

69. The method of any one of claims 65‐68, wherein the steroid treatment is a prednisone  treatment.

70. The method of claim 65 or claim 66, wherein the steroid treatment is a topical steroid  treatment.

71. The method of claim 70, wherein the steroid treatment is a difluprednate treatment.

72. The method of any one of claims 65‐71, wherein the steroid is administered before, during  and / or after administration of the unit dose of rAAV particles to the one eye and / or to the contralateral eye.

73. The method of any one of claims 70‐72, wherein the steroid treatment is a topical steroid  treatment and the topical steroid treatment is a daily steroid treatment for up to about 4 weeks, up to  about 6 weeks, or up to about 8 weeks from administering the unit dose of rAAV particles.

74. The method of claim 73, wherein the topical steroid treatment comprises about four  administrations of topical steroid per day on about week 1, about three administrations of topical steroid  per day on about week 2, about two administrations of topical steroid per day on about week 3, and about  one administration per day of topical steroid on about week 4; timing starting with and following  administration of the unit dose of rAAV particles.

75. The method of claim 73, wherein the topical steroid treatment comprises about four  administrations of topical steroid per day for about 3 weeks after administration of the unit dose of rAAV  particles, followed by about 3 administrations of topical steroid per day for about 1 week, followed by about  2 administrations of topical steroid per day for about 1 week, and followed by about 1 administration of  topical steroid per day for about 1 week.

76. The method of claim 73, wherein the topical steroid treatment comprises about four  administrations of topical steroid per day for about four weeks, followed by about three administrations of  topical steroid per day for about one week, followed by about two administrations of topical steroid per day Attorney Docket No.17234.045WO1 for about one week, and followed by about one administration of topical steroid per day for about one  week; timing starting at about one week prior to administration of the unit dose of rAAV particles.

77. The method of any one of claims 11‐64, further comprising administering a topical steroid  treatment.

78. The method of claim 77, wherein the topical steroid treatment is a difluprednate treatment.

79. The method claim 77 or claim 78, wherein the topical steroid treatment comprises about four  administrations of topical steroid per day for about four weeks, followed by about three administrations of  topical steroid per day for about one week, followed by about two administrations of topical steroid per day  for about one week, and followed by about one administration of topical steroid per day for about one  week; timing starting with and following administration of the anti‐VEGF agent.

80. The method of any one of claims 71‐79, wherein the topical steroid comprises difluprednate  0.05% at a dose of about 1µg to about 3 µg.

81. The method of any one of claims 71‐80, wherein the topical steroid comprises difluprednate  0.05% at a dose of about 2.5µg.

82. The method of any one of claims 1‐81, wherein the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in maintenance or a decrease of  retinal thickness compared to the retinal thickness prior to administration of the unit dose of rAAV particles.

83. The method of claim 82, wherein the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in a decrease in retinal thickness compared to  the retinal thickness prior to administration of the unit dose of rAAV particles.

84. The method of claim 83, wherein the decrease in retinal thickness is at least about 10%  compared to the retinal thickness prior to administration of the unit dose of rAAV particles.

85. The method of any one of claims 82‐84, wherein retinal thickness is central subfield thickness  (CST) or central retinal thickness (CRT). Attorney Docket No.17234.045WO1   86. The method of any one of claims 1‐85, wherein the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in maintenance or a decrease in  macular volume compared to the macular volume prior to administration of the unit dose of rAAV particles.

87. The method of claim 86, wherein the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in a decrease in macular volume compared to  the macular volume prior to administration of the unit dose of rAAV particles.

88. The method of claim 87, wherein the decrease in macular volume is at least about 10%  compared to the macular volume prior to administration of the unit dose of rAAV particles.

89. The method of any one of claims 1‐88, wherein the administering the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of the individual results in maintenance or an improvement of  visual acuity compared to the visual acuity prior to administration of the unit dose of rAAV particles.

90. The method of claim 89, wherein the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in an improvement of visual acuity compared to  the visual acuity prior to administration of the unit dose of rAAV particles.

91. The method of claim 89 or claim 90, wherein visual acuity is best corrected visual acuity (BCVA).

92. The method of any one of claims 1‐91, wherein administration of the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of a plurality of individuals results in at least about 50% of the  individuals in the plurality not requiring an anti‐VEGF rescue treatment.

93. The method of claim 92, wherein at least about 50% of the individuals in the plurality do not  require an anti‐VEGF rescue treatment for at least about 20 weeks, at least about 36 weeks, at least about  52 weeks, at least about 56 weeks, or more after administration of the unit dose of rAAV particles.

94. The method of any one of claims 1‐91, wherein administration of the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of a plurality of individuals results in at least about 67% of the  individuals in the plurality not requiring an anti‐VEGF rescue treatment.  Attorney Docket No.17234.045WO1    95. The method of claim 94, wherein at least about 67% of the individuals in the plurality do not  require an anti‐VEGF rescue treatment for at least about 20 weeks, at least about 36 weeks, at least about  52 weeks, at least about 60 weeks, at least about 64 weeks, or at least about 66 weeks after administration  of the unit dose of rAAV particles.

96. The method of any one of claims 1‐91, wherein administration of the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of a plurality of individuals results in at least about 78% of the  individuals in the plurality not requiring an anti‐VEGF rescue treatment.

97. The method of claim 96, wherein at least about 78% of the individuals in the plurality do not  require an anti‐VEGF rescue treatment for at least about 20 weeks, at least about 36 weeks, or more after  administration of the unit dose of rAAV particles.

98. The method of any one of claims 1‐91, wherein administration of the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of a plurality of individuals results in 100% of the individuals  in the plurality not requiring an anti‐VEGF rescue treatment.

99. The method of claim 98, wherein 100% of the individuals in the plurality do not require an anti‐ VEGF rescue treatment for at least about 64 weeks, at least about 68 weeks, at least about 72 weeks, at  least about 76 weeks, at least about 80 weeks, at least about 84 weeks, or more after administration of the  unit dose of rAAV particles.

100. The method of any one of claims 1‐99, wherein administration of the unit dose of rAAV particles  to the one eye and / or to the contralateral eye of a plurality of individuals results in a reduction in the  annualized anti‐VEGF injection rate of at least about 80%, at least about 85%, at least about 87%, at least  about 90%, at least about 95%, at least about 99%, or 100% compared to the annualized anti‐VEGF injection  rate prior to administration of the unit dose of rAAV particles.

101. The method of any one of claims 1‐10, 16‐76, or 80‐100, wherein the ocular neovascular disease  is wet age‐related macular degeneration (AMD).     Attorney Docket No.17234.045WO1 102. The method of any one of claims 1‐3, 11‐64, 77‐83, 85‐87, or 89‐91, wherein the ocular  neovascular disease is diabetic macular edema (DME).

103. The method of claim 102, wherein the administering the unit dose of rAAV particles to the one  eye and / or to the contralateral eye of the individual results in a 2‐step or in a 3‐step improvement in  Diabetic Retinopathy Severity Scale (DRSS).

104. A unit dose of about 6 × 1011 vector genomes (vg) or less of recombinant adeno‐ associated virus  (rAAV) particles for use in a method for treating an ocular neovascular disease in an individual, the method  comprising administering said unit dose to one eye of the individual, wherein the individual is a human, and  wherein the rAAV particles comprise:  a)  a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats  (ITRs), and  b)  an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein.

105. A unit dose of rAAV particles for use in a method for reducing retinal fluid in an eye of an  individual with an ocular neovascular disease, the method comprising administering said unit dose to one  eye of the individual, wherein the individual is a human, and wherein the rAAV particles comprise:  a)  a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted terminal repeats  (ITRs), and  b)  an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue numbering  corresponds to an AAV2 VP1 capsid protein.

106. The unit dose for use according to claim 104 or claim 105 wherein said method further  comprises administering an anti‐VEGF agent to said one eye of the individual before administration of said  unit dose.   Attorney Docket No.17234.045WO1 107. A method for treating an ocular neovascular disease in an individual, the method comprising  administering of recombinant adeno‐associated virus (rAAV) particles to one eye of the individual,  wherein the individual is a human,    wherein the rAAV particles comprise:  a)  a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted  terminal repeats (ITRs), and  b)  an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue  numbering corresponds to an AAV2 VP1 capsid protein, and    wherein the unit dose of rAAV particles is administered in combination with (1) an oral steroid  treatment and a topical steroid treatment or (2) an oral steroid treatment and an intravitreal (IVT) steroid  treatment or (3) an intravitreal (IVT) steroid treatment.

108. The method of claim 107, wherein the oral steroid treatment and the topical steroid treatment or  the oral steroid treatment and the IVT are a corticosteroid treatments.

109. The method of claim 107 or 108, wherein the topical steroid treatment is a difluprednate treatment.

110. The method of any one of claims 107‐109, wherein the topical steroid treatment comprises  difluprednate 0.05% at a dose of about 1µg to about 3 µg.

111. The method of any one of claims 107‐110, wherein the topical steroid treatment comprises  difluprednate 0.05% at a dose of about 2.5µg.

112. The method of any one of claims 107‐111, wherein the topical steroid treatment comprises  a. about four administrations of topical steroid per day on about day 7 prior to administration  of the unit dose of rAAV particles to about day 35 after administration of the unit does of  rAAV particles,   b. about three administrations of topical steroid per day on about day 36 to about day 63 after  administration of the unit dose of rAAV particles,  c. about two administrations of topical steroid per day on about day 64 to about day 91 after  administration of the unit dose of rAAV particles, Attorney Docket No.17234.045WO1 d. about one administrations of topical steroid per day on about day 92 to about day 119 after  administration of the unit dose of rAAV particles, and   e. about one administrations of topical steroid every other day starting on about day 120 to  about day 147 after administration of the unit dose of rAAV particles.

113. The method of any one of claims 107‐112, wherein the topical steroid treatment comprises  a. about four administrations of topical steroid per day about one week prior to administration  of the unit dose of rAAV particles to about five weeks after administration of the unit does  of rAAV particles,   b. about three administrations of topical steroid per day about 6 weeks to about 9 weeks after  administration of the unit dose of rAAV particles,  c. about two administrations of topical steroid per day about 10 weeks to about 13 weeks  after administration of the unit dose of rAAV particles,  d. about one administrations of topical steroid per day about 14 weeks to about 17 weeks  after administration of the unit dose of rAAV particles, and   e. about one administrations of topical steroid every other day about 18 to about 21 weeks  after administration of the unit dose of rAAV particles.

114. The method of any one of claims 107‐113, wherein the oral steroid treatment is a prednisone  treatment.

115. The method of claim 114, wherein the oral steroid treatment is administered at a dose of:  a. 1ess than about 0.8 mg / kg / day to about 1.00 mg / kg / day for the week prior to through week  two following administering the unit dose of rAAV particles,  b. less than about 0.59 mg / kg / day to about 0.75 mg / kg / day on weeks three to five following  administering the unit dose of rAAV particles,  c. less than about 0.4 mg / kg / day to about 0.6 mg / kg / day on week six after administering the  unit dose of rAAV particles,  d. less than about 0.25 mg / kg / day to about 0.375 mg / kg / day on week seven after  administering the unit dose of rAAV particles,  e. less than about 0.14 mg / kg / day to about 0.28 mg / kg / day on week eight after administering  the unit dose of rAAV particles, and Attorney Docket No.17234.045WO1 f. less than about 0.063 mg / kg / day to about 0.125 mg / kg / day on week nine after  administering the unit dose of rAAV particles.

116. The method of claim 114 or 115, wherein the oral steroid treatment is administered at a dose of:  a. 1ess than or equal to about 1.00 mg / kg / day for the week prior to through week two  following administering the unit dose of rAAV particles,  b. less than or equal to about 0.75 mg / kg / day on weeks three to five following administering  the unit dose of rAAV particles,  c. less than or equal to about 0.6 mg / kg / day on week six after administering the unit dose of  rAAV particles,  d. less than or equal to about 0.375 mg / kg / day on week seven after administering the unit  dose of rAAV particles,  e. less than or equal to about 0.28 mg / kg / day on week eight after administering the unit dose  of rAAV particles, and  f. less than or equal to about 0.125 mg / kg / day on week nine after administering the unit dose  of rAAV particles.

117. The method of any one of claims 114‐116, where the oral steroid treatment is administered at a  dose of about 0.125 mg / kg / day to about 0.14 mg / kg / day on the first four days of week nine after  administering the unit dose of rAAV particles and about 0.0625 mg / kg / day to about 0.070 mg / kg / day on  the first four days of week nine after administering the unit dose of rAAV particles if the individual  weighs 70 kg or more.

118. The method of any one of claims 107‐117, wherein the IVT steroid treatment is a triamcinolone  acetonide treatment or a dexamethasone treatment.

119. The method of claim 118, wherein the IVT steroid treatment is a triamcinolone acetonide treatment  of about 2 mg.

120. The method of claim 118 or 119, wherein the IVT steroid treatment comprises administration of the  IVT steroid treatment one week prior to administration of the unit dose of rAAV particles and at week 12  after administration of the unit dose of rAAV particles.   Attorney Docket No.17234.045WO1 121. The method of claim 118, wherein the IVT steroid treatment is a dexamethasone of about 0.7 mg.

122. The method of claim 121, wherein the IVT steroid treatment is an intravitreal implant one week  prior to administration of the unit does of rAAV particles.

123. The method of any one of claims 107‐122, wherein the oral steroid treatment and / or the topical  steroid treatment is administered before, during and / or after administration of the unit dose of rAAV  particles.

124. A unit dose of recombinant adeno‐ associated virus (rAAV) particles for use in a method for treating  an ocular neovascular disease in an individual, the method comprising administering said unit dose to  one eye of the individual, wherein the individual is a human,      wherein the rAAV particles comprise:  a)  a nucleic acid encoding a polypeptide comprising an amino acid sequence with at least about  95% identity to the amino acid sequence of SEQ ID NO: 35 and flanked by AAV2 inverted  terminal repeats (ITRs), and  b)  an AAV2 capsid protein comprising an amino acid sequence LGETTRP (SEQ ID NO: 14) inserted  between positions 587 and 588 of the capsid protein, wherein the amino acid residue  numbering corresponds to an AAV2 VP1 capsid protein, and    wherein the unit dose of rAAV particles is administered in combination with (1) an oral steroid  treatment and a topical steroid treatment or (2) an oral steroid treatment and an intravitreal (IVT) steroid  treatment or (3) an intravitreal (IVT) steroid treatment.

125. The method of claim 65, wherein the corticosteroid treatment is an intravitreal (IVT) steroid treatment  (e.g., Ozudex).

126. The method of claim 125 further comprising a topical steroid treatment that is initiated 3, 4, 5, 6, 7, 8  or more weeks after administration of the rAAV.

127. The method of claim 126, wherein the topical steroid treatment is a difluprednate treatment, e.g.,  Durazol, comprising 3‐4 drops per day or as recommended by a physician.   Attorney Docket No.17234.045WO1 128.  The method of claim 108, wherein the intravitreal (IVT) steroid treatment further comprises a topical  steroid treatment that is initiated 3 or more weeks after administration of the rAAV.

Images