Therapeutic peptides

Abstract

The present disclosure provides compositions and methods directed to a peptide that inhibits acid ceramidase and treatment of diseases or disorders associated with acid ceramidase. A method for treating a disease or disorder associated with acid ceramidase (e.g., cancer) may involve administering a therapeutically-effective amount of a peptide that inhibits acid ceramidase.

Description

WSGR Docket No.63634-702.601 THERAPEUTIC PEPTIDES CROSS REFERENCE

[0001] This application claims the benefit of U.S. Provisional Application No. 63 / 589,058 filed October 10, 2023, which is entirely incorporated herein by reference. BACKGROUND

[0002] Acid ceramidase is an essential enzyme for the breakdown of fatty substances (e.g., ceramides) in the body. Improper expression of acid ceramide can lead to the development of different disorders, such as Farber’s disease and spinal muscular atrophy with progressive myoclonic epilepsy (SMA-PME). Additionally, improper expression of acid ceramide can also result in cardiac, neurological, and breathing problems. INCORPORATION BY REFERENCE

[0003] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. SUMMARY

[0004] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, and a non-peptidal hydrophobic moiety attached to the peptide.

[0005] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises a region that has at least 80% identity to a subsequence of SEQ ID NO:7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO:7, wherein the peptide is a cyclic peptide.

[0006] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises a region that has at least 80% identity to a subsequence of SEQ ID NO:7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO:7, wherein the peptide comprises a disulfide bond.

[0007] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises a region that has at least 90% identity to a subsequence of SEQ ID NO:7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO:7, wherein the peptide comprises a disulfide bond.

[0008] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein amino acid sequence that has at least 80% identity to XQIVGGTICT (SEQ ID NO: 1), wherein X is anWSGR Docket No.63634-702.601 amino acid residue with an ionizable side chain, wherein the peptide is a cyclic peptide.

[0009] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein the peptide is a cyclic peptide, wherein the peptide has no more than 100 amino acid residues.

[0010] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein the peptide comprises a disulfide bond, wherein the peptide has no more than 100 amino acid residues.

[0011] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises an amino acid sequence that has at least 80% identity to XQIVGGTICT (SEQ ID NO: 1), wherein X is an amino acid residue with an ionizable side chain, wherein the peptide is attached to a non-peptidal hydrophobic moiety.

[0012] In some embodiments, disclosed herein is a composition comprising a peptide, wherein the peptide comprises a region that has at least 80% identity to a subsequence of SEQ ID NO:7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO:7, wherein a non-peptidal hydrophobic moiety is attached to the region.

[0013] In some embodiments, disclosed herein is a method of treating a condition, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase and a non-peptidal hydrophobic moiety attached to the peptide.

[0014] In some embodiments, disclosed herein is a method of treating a condition, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein the peptide is a cyclic peptide, wherein the peptide has no more than 100 amino acid residues.

[0015] In some embodiments, disclosed herein is a method of treating a condition, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein the peptide comprises a disulfide bond, wherein the peptide has not more than 100 amino acid residues.

[0016] In some embodiments, disclosed herein is a method of treating a condition, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that has at least 80% identity to XQIVGGTICT (SEQ ID NO: 1), wherein X is anWSGR Docket No.63634-702.601 amino acid residue with an ionizable side chain, wherein the peptide is attached to a non- peptidal hydrophobic moiety.

[0017] In some embodiments, disclosed herein is a method of treating a condition, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound, wherein the compound comprises a peptide, wherein the peptide comprises a region that has at least 80% identity to a subsequence of SEQ ID NO:7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO:7, wherein a non-peptidal hydrophobic moiety is attached to the region.

[0018] In some embodiments, disclosed herein is a method comprising contacting a tissue with a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein the peptide is a cyclic peptide, wherein the peptide has no more than 100 amino acid residues.

[0019] In some embodiments, disclosed herein is a method comprising contacting a tissue with a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase, wherein the peptide comprises a disulfide bond, wherein the peptide has not more than 100 amino acid residues.

[0020] In some embodiments, disclosed herein is a method comprising contacting a tissue with a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that has at least 80% identity to XQIVGGTICT (SEQ ID NO: 1), wherein X is an amino acid residue with an ionizable side chain, wherein the peptide is attached to a non- peptidal hydrophobic moiety.

[0021] In some embodiments, disclosed herein is a method comprising contacting a tissue with a compound, wherein the compound comprises a peptide, wherein the peptide comprises a region that has at least 80% identity to a subsequence of SEQ ID NO: 7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO: 7, wherein a non-peptidal hydrophobic moiety is attached to the region.

[0022] In some embodiments, disclosed herein is a method comprising contacting a tissue with a compound, wherein the compound comprises a peptide, wherein the peptide comprises an amino acid sequence that inhibits acid ceramidase and a non-peptidal hydrophobic moiety attached to the peptide, wherein the tissue comprises acid ceramidase.

[0023] In some embodiments, disclosed herein is a method comprising: (a) obtaining a result of an assay for acid ceramidase activity for a subject who has cancer, wherein the result indicates that the subject has a level of acid ceramidase activity associated with cancer; and (b) based on the result of the assay for acid ceramidase activity, administering to the subject a therapeutically-WSGR Docket No.63634-702.601 effective amount of an inhibitor of the acid ceramidase activity. BRIEF DESCRIPTION OF THE DRAWINGS

[0024] FIG. 1 illustrates conservation of domains in salivary cystatins.

[0025] FIG. 2 illustrates the predicted secondary structure of Cystatin SA.

[0026] FIG. 3 illustrates the predicted JNetPred hydrophobicity of Cystatin SA.

[0027] FIG. 4 illustrates molecular simulation of peptide-4 docking within the acid ceramidase enzyme active site.

[0028] FIG. 5 illustrates high-performance liquid chromatography analysis of peptide-7.

[0029] FIG. 6 illustrates a mass spectrometry spectrum of peptide-7.

[0030] FIG. 7 illustrates MALDI / TOF analysis of peptide-7 after 24 hour incubation at varying temperature conditions.

[0031] FIG. 8 illustrates the relative acid ceramidase activity following treatment with peptide-7 or a scrambled peptide-7.

[0032] FIG. 9 illustrates ceramide species levels following treatment with peptide-7 or carmofur.

[0033] FIG. 10 illustrates ceramidase levels measured by sphingolipidomic analysis after recovery of cisplatin with or without peptide-7.

[0034] FIG. 11 illustrates co-localization of acid ceramidase with fluorescently labeled peptide- 7 in FaDu cells.

[0035] FIG. 12 illustrates an experimental plan for testing cytotoxicity and recovery of cells treated with cisplatin in the presence or absence of peptide-7.

[0036] FIG. 13 illustrates recovery of cancer cells following cisplatin treatment in the presence or absence of peptide-7.

[0037] FIG. 14 illustrates recovery of cancer cells following treatment with cisplatin in the presence or absence of peptide-7 or scrambled peptide-7.

[0038] FIG. 15 illustrates ^-glycoside staining for senescence cells after cisplatin treatment in the presence or absence of peptide-7.

[0039] FIG. 16 illustrates p16 gene expression following treatment with cisplatin in the presence or absence of peptide-7.

[0040] FIG. 17 illustrates TNFalpha gene expression following treatment with cisplatin in the presence or absence of peptide-7.

[0041] FIG. 18 illustrates cancer cell growth followed by treatment with peptide-7, cisplatin, and venetoclax.WSGR Docket No.63634-702.601

[0042] FIG. 19 illustrates the effect of peptide-7 on cell growth in non-cancerous cells.

[0043] FIG. 20 illustrates the effect of camfour treatment on cell growth in non-cancerous cells.

[0044] FIG. 21 shows a linear detection range of Peptide-7 calculated with the area under the peak of different concentrations of Peptide-7.

[0045] FIG. 22 shows a liquid chromatography-mass spectrometry (LC-MS) profile of Peptide- 7 after 0 minutes incubation in phosphate buffer pH 7.4.

[0046] FIG. 23 shows a mass spectrum of Peptide-7 after 0 minutes incubation in phosphate buffer pH 7.4 at a retention time of 5.25 minutes.

[0047] FIG. 24 shows liquid chromatography-mass spectrometry (LC-MS) profile of Peptide-7 after 30 minutes incubation in phosphate buffer pH 7.4.

[0048] FIG. 25 shows a mass spectrum of Peptide-7 after 30 minutes incubation in phosphate buffer pH 7.4 at a retention time of 5.33 minutes.

[0049] FIG. 26 shows a liquid chromatography-mass spectrometry (LC-MS) profile of Peptide- 7 after 30 minutes incubation in citrate buffer pH 4.7.

[0050] FIG. 27 shows a mass spectrum of Peptide-7 after 30 minutes incubation in citrate buffer pH 4.7 at a retention time of 5.33-5.39 minutes.

[0051] FIG. 28 shows a liquid chromatography-mass spectrometry (LC-MS) profile of Peptide- 7 after 5 minutes incubation in human serum.

[0052] FIG. 29 shows a mass spectrum of Peptide-7 after 5 minutes incubation in human serum at a retention time of 5.37 minutes.

[0053] FIG. 30 shows a liquid chromatography-mass spectrometry (LC-MS) profile of Peptide- 7 after 30 minutes incubation in human serum.

[0054] FIG. 31 shows a liquid chromatography-mass spectrometry (LC-MS) profile of Peptide- 7 after 60 minutes incubation in human serum.

[0055] FIG. 32 shows a mass spectrum of Peptide-7 after 60 minutes incubation in human serum at a retention time of 5.36 minutes.

[0056] FIG. 33 shows a liquid chromatography-mass spectrometry (LC-MS) profile of Peptide- 7 after 95 minutes incubation in human serum.

[0057] FIG. 34 shows a mass spectrum of Peptide-7 after 95 minutes incubation in human serum at a retention time of 5.26 minutes.

[0058] FIG. 35 shows a liquid chromatography-mass spectrometry (LC-MS) profile human serum.

[0059] FIG. 36 shows a mass spectrum of human serum at a retention time of 3.96 minutes.

[0060] FIG. 37 shows UV chromatogram profiles of Peptide-7 in various conditions.WSGR Docket No.63634-702.601

[0061] FIG. 38 shows the amount of Peptide-7 in various conditions over time.

[0062] FIG. 39 illustrates the solubility of Peptide-17 in polymeric solubilizer and matrix forming polymer.

[0063] FIG. 40 shows the effect of Peptide-17 solubilized in polymeric solubilizer and matrix forming polymer on acid ceramidase activity.

[0064] FIG. 41 shows the effect of Peptide-16 solubilized in 4% polyethylene glycol (PEG) on acid ceramidase activity.

[0065] FIG. 42 shows the effect of Peptide-17 solubilized in polymeric solubilizer and matrix forming polymer on cancer cell viability.

[0066] FIG. 43 shows the recovery of cells following cisplatin treatment with varying concentrations of Peptide-16 in 4% PEG.

[0067] FIG. 44 shows an illustrative antibody-drug conjugate (ADC) comprising a palmitate- conjugated peptide. DETAILED DESCRIPTION

[0068] One aspect of the present disclosure provides methods and compositions for a peptide that inhibits acid ceramidase. In some embodiments, the peptide is a variant of and / or has a partial sequence of Cystatin SA. In some embodiments, the peptide is linear or circular. In some embodiments, the peptide is attached to a non-peptidal hydrophobic moiety. One aspect of the present disclosure provides methods for treating a disease. In some embodiments, the method comprises administering a compound to a subject in need thereof. In some embodiments, the compound is a peptide that inhibits acid ceramidase. In some embodiments, the disease is a cancer. Compositions

[0069] One aspect of the present disclosure provides a composition comprising a peptide. In some embodiments, the peptide comprises an amino acid sequence. In some embodiments, the amino acid sequence inhibits an enzyme. In some embodiments, the peptide inhibits the enzyme by binding to the enzyme. In some embodiments, the amino acid sequence of the peptide binds to the enzyme.

[0070] In some embodiments, the amino acid sequence of the peptide inhibits the enzyme by binding to at least one active site on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least about one active site on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to from about one active site to about 10 active sites on the enzyme. In some embodiments, the amino acid sequence of theWSGR Docket No.63634-702.601 peptide binds to at least about one active site, at least about two active sites, at least about three active sites, at least about four active sites, at least about five active sites, at least about six active sites, at least about seven active sites, at least about eight active sites, at least about nine active sites, at least about ten active sites, or more on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at most about ten active sites, at most about nine active sites, at most about eight active sites, at most about seven active sites, at most about six active sites, at most about five active sites, at most about four active sites, at most about three active sites, at most about two active sites, at most about one active site, or less on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to about one active site, about two active sites, about three active sites, about four active sites, about five active sites, about six active sites, about seven active sites, about eight active sites, about nine active sites, or about ten active sites on the enzyme.

[0071] In some embodiments, the amino acid sequence of the peptide inhibits the enzyme by binding to at least one non-active site location on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least one non-active site location on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to from about one non-active site to about ten non-active site locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least about one non-active site, at least about two non-active sites, at least about three non-active sites, at least about four non-active sites, at least about five non-active sites, at least about six non-active sites, at least about seven non-active sites, at least about eight non-active sites, at least about nine non-active sites, at least about ten non-active sites, or more locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at most about ten non-active sites, at most about nine non-active sites, at most about eight non-active sites, at most about seven non-active sites, at most about six non-active sites, at most about five non-active sites, at most about four non-active sites, at most about three non-active sites, at most about two non-active sites, at most about one non-active site, or less locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to about one non-active site, about two non-active sites, about three non-active sites, about four non-active sites, about five non-active sites, about six non-active sites, about seven non-active sites, about eight non-active sites, about nine non-active sites, or about ten non-active sites on the enzyme. Binding to at least one active site and / or at least one non-active site location on the enzyme can prevent the activity / function of the enzyme. In some embodiments, the amino acid sequence of the peptide inhibits the enzyme.

[0072] In some embodiments, the amino acid sequence of the peptide inhibits the enzyme insideWSGR Docket No.63634-702.601 of cells. In some embodiments, the amino acid sequence of the peptide inhibits the enzyme outside of cells. In some embodiments, the activity of the enzyme is determined by measuring the level of the enzyme’s substrate. In some embodiments, the activity of the enzyme is measured in the presence of the peptide. In some embodiments, the activity of the enzyme is measured in the absence of the peptide. In some embodiments, a reduction in the activity of the enzyme is determined by a reduction in the conversion of the enzyme’s substrate to the enzyme’s product. In some embodiments, the enzyme is acid ceramidase. In some embodiments, the enzyme’s substrate is sphingolipids. In some embodiments, the sphingolipid is ceramide. In some embodiments, the enzyme’s product is sphingosine.

[0073] In some embodiments, the peptide is cell permeable. In some embodiments, the peptide is cell impermeable.

[0074] In some embodiments, the enzyme is a hydrolase enzyme. Non-limiting examples of hydrolase enzymes include esterases, lipases, phosphatases, glycosidases, peptidases, and nucleosidases.

[0075] In some embodiments, the hydrolase enzyme is a N-terminal nucleophile hydrolase. Non-limiting examples of N-terminal nucleophile hydrolases include class II glutamine amidotransferases, penicillin acylases, (glycosyl)asparaginases, and acid ceramidase. In some embodiments, the N-terminal nucleophile hydrolase has a non-polar amino acid at the active site and / or catalytic site. Non-limiting examples of non-polar amino acids include glycine, alanine, valine, cysteine, proline, leucine, isoleucine, methionine, tryptophan, and phenylalanine. In some embodiments, the non-polar amino acid is glycine. In some embodiments, the non-polar amino acid is alanine. In some embodiments, the non-polar amino acid is valine. In some embodiments, the non-polar amino acid is cysteine. In some embodiments, the non-polar amino acid is proline. In some embodiments, the non-polar amino acid is leucine. In some embodiments, the non-polar amino acid is isoleucine. In some embodiments, the non-polar amino acid is methionine. In some embodiments, the non-polar amino acid is tryptophan. In some embodiments, the non-polar amino acid is phenylalanine.

[0076] In some embodiments, the hydrolase enzyme is a lipase (e.g., a lipid hydrolase). Non- limiting examples of lipid hydrolases include pancreatic lipase, lysosomal lipase, acid ceramidase, lipoprotein lipase, gastric lipase, and lingual lipase. In some embodiments, the lipase is acid ceramidase.

[0077] In some embodiments, the enzyme is a protease. Non-limiting examples of proteases include trypsin, chymotrypsin, elastase, papain, calpain, cathepsins, pepsin, rennin, thermolysin, and carboxypeptidase A. In some embodiments, the protease is a serine protease, a cysteineWSGR Docket No.63634-702.601 protein, an aspartic protease, or a metallo-protease. In some embodiments, the protease is a serine protease. In some embodiments, the serine protease is trypsin, chymotrypsin, or elastase. In some embodiments, the serine protease is trypsin. In some embodiments, the serine protease is chymotrypsin. In some embodiments, the serine protease is elastase. In some embodiments, the protease is a cysteine protease. In some embodiments, the cysteine protease is papain or a papain-like protease, caspase-1, calpain, or cathepsins. In some embodiments, the cysteine protease is papain or a papain-like protease. In some embodiments, the cysteine protease is caspase-1. In some embodiments, the cysteine protease is calpain. In some embodiments, the cysteine protease is a cathepsin protease. Non-limiting examples of cathepsins include cathepsin B, cathepsin H, cathepsin L, cathepsin C, cathepsin X, cathepsin V, cathepsin O, cathepsin K, cathepsin S, cathepsin E, and cathepsin W. In some embodiments, the protease is an aspartic protease. In some embodiments, the aspartic protease is pepsin or rennin. In some embodiments, the aspartic protease is pepsin. In some embodiments, the aspartic protease is rennin. In some embodiments, the protease is a metallo-protease. In some embodiments, the metallo-protease is thermolysin or carboxypeptidase A. In some embodiments, the metallo-protease is thermolysin. In some embodiments, the metalo-protease is carboxypeptidase A.

[0078] In some embodiments, the peptide has a molecular mass between about 1000 Daltons (Da) to about 1500 Da, between about 1500 Da to about 2000 Da, between about 2000 Da to about 2500 Da, or between 2500 Da to about 3000 Da. In some embodiments, the peptide has a molecular mass of at least about 1000 Da, at least about 1025 Da, at least about 1050 Da, at least about 1075 Da, at least about 1100 Da, at least about 1125 Da, at least about 1150 Da, at least about 1175 Da, at least about 1200 Da, at least about 1225 Da, at least about 1250 Da, at least about 1275 Da, at least about 1300 Da, at least about 1325 Da, at least about 1350 Da, at least about 1375 Da, at least about 1400 Da, at least about 1425 Da, at least about 1450 Da, at least about 1475 Da, at least about 1500 Da, at least about 1525 Da, at least about 1550 Da, at least about 1575 Da, at least about 1600 Da, at least about 1625 Da, at least about 1650 Da, at least about 1675 Da, at least about 1700 Da, at least about 1725 Da, at least about 1750 Da, at least about 1775 Da, at least about 1800 Da, at least about 1825 Da, at least about 1850 Da, at least about 1875 Da, at least about 1900 Da, at least about 1925 Da, at least about 1950 Da, at least about 1975 Da, at least about 2000 Da, at least about 2025 Da, at least about 2050 Da, at least about 2075 Da, at least about 2100 Da, at least about 2125 Da, at least about 2150 Da, at least about 2175 Da, at least about 2200 DA, at least about 2225 Da, at least about 2250 Da, at least about 2275 Da, at least about 2300 Da, at least about 2325 Da, at least about 2350 Da, at least about 2375 Da, at least about 2400 Da, at least about 2425 Da, at least about 2450 Da, at leastWSGR Docket No.63634-702.601 about 2475 Da, at least about 2500 Da, at least about 2525 Da, at least about 2550 Da, at least about 2575 Da, at least about 2600 Da, at least about 2625 Da, at least about 2650 Da, at least about 2675 Da, at least about 2700 Da, at least about 2725 Da, at least about 2750 Da, at least about 2775 Da, at least about 2800 Da, at least about 2825 Da, at least about 2850 Da, at least about 2875 Da, at least about 2900 Da, at least about 2925 Da, at least about 2950 Da, at least about 2975 Da, at least about 3000 Da, or more.

[0079] In some embodiments, the peptide has a molecular weight of at most about 3000 Da, at most about 2975 Da, at most about 2950 Da, at most about 2925 Da, at most about 2900 Da, at most about 2875 Da, at most about 2850 Da, at most about 2825 Da, at most about 2800 Da, at most about 2775 Da, at most about 2750 Da, at most about 2725 Da, at most about 2700 Da, at most about 2675 Da, at most about 2650 Da, at most about 2625 Da, at most about 2600 Da, at most about 2575 Da, at most about 2550 Da, at most about 2525 Da, at most about 2500 Da, at most about 2475 Da, at most about 2450 Da, at most about 2425 Da, at most about 2400 Da, at most about 2375 Da, at most about 2350 Da, at most about 2325 Da, at most about 2300 Da, at most about 2275 Da, at most about 2250 Da, at most about 2225 Da, at most about 2200 Da, at most about 2175 Da, at most about 2150 Da, at most about 2125 Da, at most about 2100 Da, at most about 2075 Da, at most about 2050 Da, at most about 2025 Da, at most about 2000 Da, at most about 1975 Da, at most about 1950 Da, at most about 1925 Da, at most about 1900 Da, at most about 1875 Da, at most about 1850 Da, at most about 1825 Da, at most about 1800 Da, at most about 1775 Da, at most about 1750 Da, at most about 1725 Da, at most about 1700 Da, at most about 1675 Da, at most about 1650 Da, at most about 1625 Da, at most about 1600 Da, at most about 1575 Da, at most about 1550 Da, at most about 1525 Da, at most about 1500 Da, at most about 1475 Da, at most about 1450 Da, at most about 1425 Da, at most about 1400 Da, at most about 1375 Da, at most about 1350 Da, at most about 1325 Da, at most about 1300 Da, at most about 1275 Da, at most about 1250 Da, at most about 1225 Da, at most about 1200 Da, at most about 1175 Da, at most about 1150 Da, at most about 1125 Da, at most about 1100 Da, at most about 1075 Da, at most about 1050 Da, at most about 1025 Da, at most about 1000 Da, or less.

[0080] In some embodiments, the peptide has a molecular weight of about 1000 Da, about 1025 Da, about 1050 Da, about 1075 Da, about 1100 Da, about 1125 Da, about 1150 Da, about 1175 Da, about 1200 Da, about 1225 Da, about 1250 Da, about 1275 Da, about 1300 Da, about 1325 Da, about 1350 Da, about 1375 Da, about 1400 Da, about 1425 Da, about 1450 Da, about 1475 Da, about 1500 Da, about 1525 Da, about 1550 Da, about 1575 Da, about 1600 Da, about 1625 Da, about 1650 Da, about 1675 Da, about 1700 Da, about 1725 Da, about 1750 Da, about 1775WSGR Docket No.63634-702.601 Da, about 1800 Da, about 1825 Da, about 1850 Da, about 1875 Da, about 1900 Da, about 1925 Da, about 1950 Da, about 1975 Da, about 2000 Da, about 2025 Da, about 2050 Da, about 2075 Da, about 2100 Da, about 2125 Da, about 2150 Da, about 2175 Da, about 2200 Da, about 2225 Da, about 2250 Da, about 2275 Da, about 2300 Da, about 2325 Da, about 2350 Da, about 2375 Da, about 2400 Da, about 2425 Da, about 2450 Da, about 2475 Da, about 2500 Da, about 2525 Da, about 2550 Da, about 2575 Da, about 2600 Da, about 2625 Da, about 2650, about 2675 Da, about 2700 Da, about 2725 Da, about 2750 Da, about 2775 Da, about 2800 Da, about 2825 Da, about 2850 Da, about 2875 Da, about 2900 Da, about 2925 Da, about 2950 Da, about 2975 Da, or about 3000 Da.

[0081] In some embodiments, the structure of the peptide is at least about 40% alpha helix. In some embodiments, the structure of the peptide is at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at most about 95%, or at least about 100% alpha helix. In some embodiments, the structure of the peptide is at most about 60% beta sheets. In some embodiments, the structure of the peptide is at most about 60%, at most about 55%, at most about 50%, at most about 45%, at most about 40%, at most about 35%, at most about 30%, at most about 25%, at most about 20%, at most about 15%, at most about 10%, at most about 5%, at most about 1%, or less beta sheets.

[0082] In some embodiments, the peptide has a half-life of at least three months in vitro. In some embodiments, the peptide has a half-life of between about three months to about six months, between about six months to about nine months, between about nine months to about one year, between about one year to about 1.5 years, between about 1.5 years to about 2 years, between about 2 years to about 2.5 years, or between about 2.5 years to about 3 years in vitro. In some embodiments, the peptide has a half-life of at least about three months, at least about six months, at least about nine months, at least about 1 year, at least about 1.5 years, at least about 2 years, at least about 2.5 years, at least about 3 years, or more in vitro. In some embodiments, the peptide has a half-life of about three months, about six months, about nine months, about one year, about 1.5 years, about 2 years, about 2.5 years, or about 3 years in vitro.

[0083] In some embodiments, the peptide has a half-life of at least about 1 hour in vivo. In some embodiments, the peptide has a half-life between about 1 hour to about 2 hours, between about 2 hours to about 3 hours, between about 3 hours to about 4 hours, between about 4 hours to about 8 hours, between about 8 hours to about 12 hours, between about 12 hours to about 16 hours, between about 16 hours to about 20 hours, or between about 20 hours to about 24 hours in vivo. In some embodiments, the peptide has a half-life of at least about 1 hour, at least about 2 hours,WSGR Docket No.63634-702.601 at least about 3 hours, at least about 4 hours, at least about 5 hours, at least about 6 hours, at least about 7 hours, at least about 8 hours, at least about 10 hours, at least about 11 hours, at least about 12 hours, at least about 13 hours, at least about 14 hours, at least about 15 hours, at least about 16 hours, at least about 17 hours, at least about 18 hours, at least about 19 hours, at least about 20 hours, at least about 21 hours, at least about 22 hours, at least about 23 hours, at least about 24 hours, or more in vivo. In some embodiments, the peptide has a half-life of about 1 hour, about 2 hours, about 3 hours, about 4 hours, about 5 hours, about 6 hours, about 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, or about 24 hours.

[0084] In some embodiments, a non-peptidal hydrophobic moiety is attached to the peptide. In some embodiments, the non-peptidal hydrophobic moiety is a C6-20alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C6alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C7alkyl group. In some embodiments, the non- peptidal hydrophobic moiety is a C8alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C9alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C10alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C11alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C12alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C13alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C14alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C15alkyl group. In some embodiments, the non- peptidal hydrophobic moiety is a C16alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C17alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C18alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C19alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C20alkyl group.

[0085] In some embodiments, the non-peptidal hydrophobic moiety is a lipid. In some embodiments, the lipid is saturated. Non-limiting examples of saturated lipids include propionic acid, butyric acid, valeric acid, caproic acid, enanthic acid, caprylic acid, pelargonic acid, capric acid, undecylic acid, lauric acid, tridecylic acid, myristic acid, pentadecylic acid, palmitic acid, margaric acid, stearic acid, nonadecylic acid, arachidic acid, heneicosylic acid, behenic acid, tricosylic acid, lignoceric acid, pentacosylic acid, cerotic acid, carboceric acid, montanic acid, nonacosylic acid, melissic acid, hentriacontylic acid, lacceroic acid, psyllic acid, geddic acid, ceroplastic acid, hexatriacontylic acid, heptratriacontylic acid, octatriacontylic acid, nonatriacontylic acid, and tetracontylic acid. In some embodiments, the lipid is unsaturated.WSGR Docket No.63634-702.601 Non-limiting examples of unsaturated lipids include crotonic acid, myristoleic acid, palmitoleic acid, sapienic acid, oleic acid, elaidic acid, vaccenic acid, gadoleic acid, eicosenoic acid, erucic acid, nervonic acid, linoleic acid, eicosadienoic acid, docosadienoic acid, linolenic acid, pinolenic acid, eleostearic acid mead acid, dihomo-γ-linolenic acid, eicosatrienoic acid, stearidonic acid, arachidonic acid, eicosatetraenoic acid, adrenic acid, bosseopentaenoic acid, eicosapentaenoic acid, ozubondo acid, sardine acid, tetracosanolpentaenoic acid, cervonic acid, and nisinic acid.

[0086] In some embodiments, the lipid is fatty acyl group. Non-limiting examples of fatty acyl groups include arachidonoyl, behenoyl, butyryl, cerotoyl, decanoyl, docosenoyl, dodecanoyl, eleostearoyl, heptanoyl, heptatrienoyl, hexanoyl, icosanoyl, icosenoyl, lignoceroyl, linoleoyl, lipoyl, margaroyl, melissoyl, mycolyl, myristoleoyl, nervonoyl, nonanoyl, obtusiloyl, octadic-9- ynoyl, octadecenoyl, octanoyl, palmitoleoyl, palmitoyl, parinaroyl, stearoyl, tetradecanoyl, undecanoyl, and valeryl.

[0087] In some embodiments, the fatty acyl group is a short-chain acyl group. Non-limiting examples of short-chain acyl groups include formate, acetate, propionate, butyrate, isobutyrate, valerate, isovalerate, and 2-Methylbutanoate. In some embodiments, the short-chain fatty acyl group is formate. In some embodiments, the short-chain fatty acyl group is acetate. In some embodiments, the short-chain fatty acyl group is propionate. In some embodiments, the short- chain fatty acyl group is butyrate. In some embodiments, the short-chain fatty acyl group is isobutyrate. In some embodiments, the short-chain fatty acyl group is valerate. In some embodiments, the short-chain fatty acyl group is isovalerate. In some embodiments, the short- chain fatty acyl group is 2-Methylbutanoate. In some embodiments, the fatty acyl group is a medium-chain acyl group. Non-limiting examples of medium-chain acyl groups include hexanoate, octanoate, decanoate, caproic acid, caprylic acid, capric acid, lauric acid, and dodecanoate. In some embodiments, the medium-chain fatty acyl group is hexanoate. In some embodiments, the medium-chain fatty acyl group is octanoate. In some embodiments, the medium-chain fatty acyl group is decanoate. In some embodiments, the medium-chain fatty acyl group is caproic acid. In some embodiments, the medium-chain fatty acyl group is caprylic acid. In some embodiments, the medium-chain fatty acyl group is capric acid. In some embodiments, the medium-chain fatty acyl group is lauric acid. In some embodiments, the medium-chain fatty acyl group is dodecanoate. In some embodiments, the fatty acyl group is a long-chain fatty acyl group. Non-limiting examples of long-chain fatty acyl groups include myrisate, stearoyl, palmitoyl, arachidonoyl, oleate, palmitoleoyl, nervonoyl, linoleoyl, docosahexaenoic acid, and eicosapentaenoic acid. In some embodiments, the long-chain fatty acyl group is myrisate. InWSGR Docket No.63634-702.601 some embodiments, the long-chain fatty acyl group is stearoyl. In some embodiments, the long- chain fatty acyl group is palmitoyl. In some embodiments, the long-chain fatty acyl group is arachidonoyl. In some embodiments, the long-chain fatty acyl group is oleate. In some embodiments, the long-chain fatty acyl group is palmitoleoyl. In some embodiments, the long- chain fatty acyl group is nervonoyl. In some embodiments, the long-chain fatty acyl group is linoleoyl. In some embodiments, the long-chain fatty acyl group is docosahexaenoic acid. In some embodiments, the long-chain fatty acyl group is eicosapentaenoic acid.

[0088] In some embodiments, the non-peptidal hydrophobic moiety is a short-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is a medium-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is a long-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is palmitoyl.

[0089] Alternatively, in some embodiments, the peptide is not attached to a non-peptidal hydrophobic moiety.

[0090] In some embodiments, the hydrophobicity of the peptide between about 20% to about 25%, between about 25% to about 30%, between about 30% to about 35%, between about 35% to about 40%, between about 40% to about 45%, between about 45% to about 50%, between about 50% to about 55%, or between about 55% to about 60%. In some embodiments, the hydrophobicity of the peptide is at least about 20%, at least about 21%, at least about 22%, at least about 23%, at least about 24%, at least about 25%, at least about 26%, at least about 27%, at least about 28%, at least about 29%, at least about 30%, at least about 31%, at least about 32%, at least about 33%, at least about 34%, at least about 35%, at least about 36%, at least about 37%, at least about 38%, at least about 39%, at least about 40%, at least about 41%, at least about 42%, at least about 43%, at least about 44%, at least about 45%, at least about 46%, at least about 47%, at least about 48%, at least about 49%, at least about 50%, at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, or more.

[0091] In some embodiments, the hydrophobicity of the peptide is at most about 60%, at most about 59%, at most about 58%, at most about 57%, at most about 56%, at most about 55%, at most about 54%, at most about 53%, at most about 52%, at most about 51%, at most about 50%, at most about 49%, at most about 48%, at most about 47%, at most about 46%, at most about 45%, at most about 44%, at most about 43%, at most about 42%, at most about 41%, at most about 40%, at most about 39%, at most about 38%, at most about 37%, at most about 36%, at most about 35%, at most about 34%, at most about 33%, at most about 32%, at most about 31%,WSGR Docket No.63634-702.601 at most about 30%, at most about 29%, at most about 28%, at most about 27%, at most about 26%, at most about 25%, at most about 24%, at most about 23%, at most about 22%, at most about 21%, at most about 20%, or less.

[0092] In some embodiments, the hydrophobicity of the peptide is about 20%, about 21%, about 22%, about 23%, about 24%, about 25%, about 26%, about 27%, about 28%, about 29%, about 30%, about 31%, about 32%, about 33%, about 34%, about 35%, about 36%, about 37%, about 38%, about 39%, about 40%, about 41%, about 42%, about 43%, about 44%, about 45%, about 46%, about 47%, about 48%, about 49%, about 50%, about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, or about 60%.

[0093] In some embodiments, the hydrophobicity is determined by an assay. In some embodiments, the assay is hydrophobic interaction chromatography. In some embodiments, the assay is a hydrophobic protein analysis. In some embodiments, the hydrophobic protein analysis is a colorimetric assay. In some embodiments, the assay is a reverse-phase high-performance liquid chromatography (RP-HPLC). In some embodiments, RP-HPLC separates molecules on the basis of the molecule’s hydrophobicity.

[0094] In some embodiments, the peptide is hydrophobic. In some embodiments, the peptide is hydrophilic.

[0095] In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the N-terminal and / or C-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the N-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the C-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to a non- terminal amino acid residue. In some embodiments, the non-terminal amino acid residue is any amino acid of the peptide excluding the N-terminal or the C-terminal.

[0096] In some embodiments, the peptide is linear. In some embodiments, the peptide is circular. In some embodiments, the peptide is a cyclic peptide. In some embodiments, the peptide has about two portions. In some embodiments, the two portions are a first portion and a second portion. In some embodiments, the first portion is linear and the second portion is circular. In some embodiments, the first portion is circular and the second portion is linear. In some embodiment, the peptide has three portions. In some embodiments, the three portions are a first portion, a second portion, and a third portion. In some embodiments, the first portion is linear, the second portion is circular, and the third portion is linear. In some embodiments, the first portion is circular, the second portion is linear, and the third portion is circular.

[0097] In some embodiments, the peptide has at least one disulfide bond. In some embodiments,WSGR Docket No.63634-702.601 the peptide has from about one disulfide bond to about 20 disulfide bonds. In some embodiments, the peptide has at least about one disulfide bond, at least about two disulfide bonds, at least about three disulfide bonds, at least about four disulfide bonds, at least about five disulfide bonds, at least about six disulfide bonds, at least about seven disulfide bonds, at least about eight disulfide bonds, at least about nine disulfide bonds, at least about ten disulfide bonds, at least about 11 disulfide bonds, at least about 12 disulfide bonds, at least about 13 disulfide bonds, at least about 14 disulfide bonds, at least about 15 disulfide bonds, at least about 16 disulfide bonds, at least about 17 disulfide bonds, at least about 18 disulfide bonds, at least about 19 disulfide bonds, at least about 20 disulfide bonds, or more.

[0098] In some embodiments, the peptide has at most about 20 disulfide bonds, at most about 19 disulfide bonds, at most about 18 disulfide bonds, at most about 17 disulfide bonds, at most about 16 disulfide bonds, at most about 15 disulfide bonds, at most about 14 disulfide bonds, at most about 13 disulfide bonds, at most about 12 disulfide bonds, at most about 11 disulfide bonds, at most about ten disulfide bonds, at most about nine disulfide bonds, at most about eight disulfide bonds, at most about seven disulfide bonds, at most about six disulfide bonds, at most about five disulfide bonds, at most about four disulfide bonds, at most about three disulfide bonds, at most about two disulfide bonds, at most about one disulfide bond, or less.

[0099] In some embodiments, the peptide has about one disulfide bond, about two disulfide bonds, about three disulfide bonds, about four disulfide bonds, about five disulfide bonds, about six disulfide bonds, about seven disulfide bonds, about eight disulfide bonds, about nine disulfide bonds, about ten disulfide bonds, about 11 disulfide bonds, about 12 disulfide bonds, about 13 disulfide bonds, about 14 disulfide bonds, about 15 disulfide bonds, about 16 disulfide bonds, about 17 disulfide bonds, about 18 disulfide bonds, about 19 disulfide bonds, or about 20 disulfide bonds.

[0100] In some embodiments, the at least one disulfide bond is an internal disulfide bond. In some embodiments, the internal disulfide bond is a disulfide bond involving at least one internal cysteine amino acid. In some embodiments, the at least one disulfide bond is an external disulfide bond. In some embodiments, the external disulfide bond is between the N-terminal and the C-terminal of the peptide. In some embodiments, the peptide has two or more disulfide bonds. In some embodiments, the two or more disulfide bonds are internal disulfide bonds and / or external disulfide bonds.

[0101] In some embodiments, the peptide is positively charged at physiological pH. In some embodiments, the peptide is negatively charged at physiological pH. In some embodiments, the peptide has a neutral charge at physiological pH. In some embodiments, the physiological pH isWSGR Docket No.63634-702.601 between about 6 to about 6.5, between about 6.5 to about 7, between about 7 to about 7.5, or between about 7.5 to about 8. In some embodiments, the physiological pH is at least about 6, at least about 6.25, at least about 6.5, at least about 6.75, at least about 7, at least about 7.25, at least about 7.5, at least about 7.75, at least about 8, or more. In some embodiments, the physiological pH is at most about 8, at most about 7.75, at most about 7.5, at most about 7.25, at most about 7, at most about 6.75, at most about 6.5, at most about 6.25, at most about 6, or less. In some embodiments, the physiological pH is about 6, about 6.25, about 6.5, about 6.75, about 7, about 7.25, about 7.5, about 7.75, or about 8.

[0102] In some embodiments, the peptide is positively charged at acidic pH. In some embodiments, the peptide is negatively charged at acidic pH. In some embodiments, the peptide has a neutral charge at acidic pH. In some embodiments, the acidic pH is between about 1 to about 1.5, between about 1.5 to about 2, between about 2 to about 2.5, between about 2.5 to about 3, between about 3 to about 3.5, between about 3.5 to about 4, between about 4 to about 4.5, between about 4.5 to about 5, between about 5 to about 5.5, or between about 5.5 to about 6. In some embodiments, the acidic pH is at least about 1, at least about 1.5, at least about 2, at least about 2.5, at least about 3, at least about 3.5, at least about 4, at least about 4.5, at least about 5, at least about 5.5, at least about 6, or more. In some embodiments, the acidic pH is at most about 6, at most about 5.5, at most about 5, at most about 4.5, at most about 4, at most about 3.5, at most about 3, at most about 2.5, at most about 2, at most about 1.5, at most about 1, or less. In some embodiments, the acidic pH is about 1, about 1.5, about 2, about 2.5, about 3, about 3.5, about 4, about 4.5, about 5, about 5.5, or about 6.

[0103] In some embodiments, the peptide is positively charged at basic pH. In some embodiments, the peptide is negatively charged at basic pH. In some embodiments, the peptide has a neutral charge at basic pH. In some embodiments, the basic pH is between about 8 to about 8.5, between about 8.5 to about 9, between about 9 to about 9.5, between about 9.5 to about 10, between about 10 to about 10.5, between about 10.5 to about 11, between about 11 to about 11.5, between about 11.5 to about 12, between about 12 to about 12.5, between about 12.5 to about 13, between about 13 to about 13.5, or between 13.5 to about 14. In some embodiments, the basic pH is at least about 8, at least about 8.5, at least about 9, at least about 9.5, at least about 10, at least about 10.5, at least about 11, at least about 11.5, at least about 12, at least about 12.5, at least about 13, at least about 13.5, at least about 14, or more. In some embodiments, the basic pH is at most about 14, at most about 13.5, at most about 13, at most about 12.5, at most about 12, at most about 11.5, at most about 11, at most about 10.5, at most about 10, at most about 9.5, at most about 9, at most about 8.5, at most about 8, or less. In someWSGR Docket No.63634-702.601 embodiments, the basic pH is about 8, about 8.5, about 9, about 9.5, about 10, about 10.5, about 11, about 11.5, about 12, about 12.5, about 13, about 13.5, or about 14.

[0104] In some embodiments, the peptide has from about one amino acid residue to about 200 amino acids residues. In some embodiments, the peptide has from about one amino acid residue to about ten amino acid residues, from about ten amino acid residues to about 20 amino acid residues, from about 20 amino acid residues to about 30 amino acid residues, from about 30 amino acid residues to about 40 amino acid residues, from about 40 amino acid residues to about 50 amino acid residues, from about 50 amino acid residues to about 60 amino acid residues, from about 60 amino acid residues to about 70 amino acid residues, from about 70 amino acid residues to about 80 amino acid residues, from about 80 amino acid residues to about 90 amino acid residues, from about 90 amino acid residues to about 100 amino acid residues, from about 100 amino acid residues to about 110 amino acid residues, from about 110 amino acid residues to about 120 amino acid residues, from about 120 amino acid residues to about 130 amino acid residues, from about 130 amino acid residues to about 140 amino acid residues, from about 140 amino acid residues to about 150 amino acid residues, from about 150 amino acid residues to about 160 amino acid residues, from about 160 amino aid residues to about 170 amino acid residues, from about 170 amino acid residues to about 180 amino acid residues, from about 180 amino acid residues to about 190 amino acid residues, or from about 190 amino acid residues to about 200 amino acid residues.

[0105] In some embodiments, the peptide has at least about one amino acid residue, at least about two amino acid residues, at least about three amino acid residues, at least about four amino acid residues, at least about five amino acid residues, at least about six amino acid residues, at least about seven amino acid residues, at least about eight amino acid residues, at least about nine amino acid residues, at least about ten amino acid residues, at least about 11 amino acid residues, at least about 12 amino acid residues, at least about 13 amino acid residues, at least about 14 amino acid residues, at least about 15 amino acid residues, at least about 16 amino acid residues, at least about 17 amino acid residues, at least about 18 amino acid residues, at least about 19 amino acid residues, at least about 20 amino acid residues, at least about 25 amino acid residues, at least about 30 amino acid residues, at least about 35 amino acid residues, at least about 40 amino acid residues, at least about 45 amino acid residues, at least about 50 amino acid residues, at least about 55 amino acid residues, at least about 60 amino acid residues, at least about 65 amino acid residues, at least about 70 amino acid residues, at least about 75 amino acid residues, at least about 80 amino acid residues, at least about 85 amino acid residues, at least about 90 amino acid residues, at least about 95 amino acid residues, at least about 100WSGR Docket No.63634-702.601 amino acid residues, at least about 105 amino acid residues, at least about 110 amino acid residues, at least about 115 amino acid residues, at least about 120 amino acid residues, at least about 125 amino acid residues, at least about 130 amino acid residues, at least about 135 amino acid residues, at least about 140 amino acid residues, at least about 145 amino acid residues, at least about 150 amino acid residues, at least about 155 amino acid residues, at least about 160 amino acid residues, at least about 165 amino acid residues, at least about 170 amino acid residues, at least about 175 amino acid residues, at least about 180 amino acid residues, at least about 185 amino acid residues, at least about 190 amino acid residues, at least about 195 amino acid residues, at least about 200 amino acid residues, or more.

[0106] In some embodiments, the peptide has about 10 amino acids. In some embodiments, the peptide has about 12 amino acid residues. In some embodiments, the peptide has about 14 amino acid residues. In some embodiments, the peptide has about 19 amino acid residues. In some embodiments, the peptide has about 20 amino acid residues. In some embodiments, the peptide has about 50 amino acid residues. In some embodiments, the peptide has about 100 amino acid residues.

[0107] In some embodiments, the peptide has no more than about 200 amino acid residues, no more than about 195 amino acid residues, no more than about 190 amino acid residues, no more than about 185 amino acid residues, no more than about 180 amino acid residues, no more than about 175 amino acid residues, no more than about 170 amino acid residues, no more than about 165 amino acid residues, no more than about 160 amino acid residues, no more than about 155 amino acid residues, no more than about 150 amino acid residues, no more than about 145 amino acid residues, no more than about 140 amino acid residues, no more than about 135 amino acid residues, no more than about 130 amino acid residues, no more than about 125 amino acid residues, no more than about 120 amino acid residues, no more than about 115 amino acid residues, no more than about 110 amino acid residues, no more than about 105 amino acid residues, no more than about 100 amino acid residues, no more than about 95 amino acid residues, no more than about 90 amino acid residues, no more than about 85 amino acid residues, no more than about 80 amino acid residues, no more than about 75 amino acid residues, no more than about 70 amino acid residues, no more than about 65 amino acid residues, no more than about 60 amino acid residues, no more than about 55 amino acid residues, no more than about 50 amino acid residues, no more than about 45 amino acid residues, no more than about 40 amino acid residues, no more than about 35 amino acid residues, no more than about 30 amino acid residues, no more than about 25 amino acid residues, no more than about 20 amino acid residues, no more than about 19 amino acidWSGR Docket No.63634-702.601 residues, no more than about 18 amino acid residues, no more than about 17 amino acid residues, no more than about 16 amino acid residues, no more than about 15 amino acid residues, no more than about 14 amino acid residues, no more than about 13 amino acid residues, no more than about 12 amino acid residues, no more than about 11 amino acid residues, no more than about ten amino acid residues, no more than about nine amino acid residues, no more than about eight amino acid residues, no more than about seven amino acid residues, no more than about six amino acid residues, no more than about five amino acid residues, no more than about four amino acid residues, no more than about three amino acid residues, no more than about two amino acid residues, or no more than about one amino acid residue.

[0108] In some embodiments, the peptide has no more than about 20 amino acid residues. In some embodiments, the peptide has no more than about 50 amino acid residues. In some embodiments, the peptide has no more than about 100 amino acid residues.

[0109] In some embodiments, the peptide has about one amino acid residue, about two amino acid residues, about three amino acid residues, about four amino acid residues, about five amino acid residues, about six amino acid residues, about seven amino acid residues, about eight amino acid residues, about nine amino acid residues, about ten amino acid residues, about 11 amino acid residues, about 12 amino acid residues, about 13 amino acid residues, about 14 amino acid residues, about 15 amino acid residues, about 16 amino acid residues, about 17 amino acid residues, about 18 amino acid residues, about 19 amino acid residues, about 20 amino acid residues, about 25 amino acid residues, about 30 amino acid residues, about 35 amino acid residues, about 40 amino acid residues, about 45 amino acid residues, about 50 amino acid residues, about 55 amino acid residues, about 60 amino acid residues, about 65 amino acid residues, about 70 amino acid residues, about 75 amino acid residues, about 80 amino acid residues, about 85 amino acid residues, about 90 amino acid residues, about 95 amino acid residues, about 100 amino acid residues, about 105 amino acid residues, about 110 amino acid residues, about 115 amino acid residues, about 120 amino acid residues, about 125 amino acid residues, about 130 amino acid residues, about 135 amino acid residues, about 140 amino acid residues, about 145 amino acid residues, about 150 amino acid residues, about 155 amino acid residues, about 160 amino acid residues, about 165 amino acid residues, about 170 amino acid residues, about 175 amino acid residues, about 180 amino acid residues, about 185 amino acid residues, about 190 amino acid residues, about 195 amino acid residues, or about 200 amino acid residues.

[0110] In some embodiments, the peptide has at least about 10 amino acid residues. In someWSGR Docket No.63634-702.601 embodiments, the peptide has at least 12 amino acid residues. In some embodiments, the peptide has at least about 14 amino acid residues. In some embodiments, the peptide has at least about 19 amino acid residues.

[0111] In some embodiments, the amino acid sequence is derived from a protein. In some embodiments, the protein is a protease inhibitor. Non-limiting examples of protease inhibitors include aspartic protease inhibitor, cysteine protease inhibitor, metalloprotease inhibitor, serine protease inhibitor, threonine protease inhibitor, and trypsin inhibitors. In some embodiments, the protein is a cysteine protease inhibitor. In some embodiments, the cysteine protease inhibitor is a serpin. In some embodiments, the serpin is thrombin. In some embodiments, the serpin is trypsin. In some embodiments, the serpin is human neutrophil elastase. In some embodiments, the cysteine protease inhibitor is a cystatin. In some embodiments, the cystatin is cystatin A. In some embodiments, the cystatin is cystatin B. In some embodiments, the cystatin is cystatin C. In some embodiments, the cystatin is cystatin D. In some embodiments, the cystatin is cystatin S. In some embodiments, the cystatin is cystatin SA. In some embodiments, the cystatin is cystatin SN. In some embodiments, the cysteine protease inhibitor is an inhibitor of apoptosis protein (IAP). In some embodiments, the IAP is XIAP.

[0112] In some embodiments, the amino acid sequence has natural amino acids. Non-limiting examples of natural amino acids include arginine, histidine, lysine, aspartic acid, glutamic acid, serine, threonine, asparagine, glutamine, cysteine, glycine, proline, alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, and tryptophan. In some embodiments, the amino acid sequence has unnatural amino acids. Non-limiting examples of unnatural amino acids include β-alanine, γ-aminobutyric acid, δ-aminolevulinic acid, 4-aminobenzoic acid, L- Tryptazan, 5-Fluoro-L-tryptophan, L-Ethionine, L-Selenomethionine, Trifluoro-L-methionine, L-Norleucine, L-Homopropargylglycine, (2S)-2-amino-5-(methylsulfanyl) pentanoic acid, (2S)- 2-amino-6-(methylsulfanyl) hexanoic acid, Para-fluoro-L-phenylalanine, Para-iodo-L- phenylalanine, Para-azido-L-phenylalanine, Para-acetyl-L-phenylalanine, Para-benzoyl-L- phenylalanine, Meta-fluoro-L-tyrosine, O-methyl-L-tyrosine, Para-propargyloxy-L- phenylalanine, (2S)-2-aminooctanoic acid, (2S)-2-aminononanoic acid, (2S)-2-aminodecanoic acid, (2S)-2-aminohept-6-enoic acid, (2S)-2-aminooct-7-enoic acid, L-Homocysteine, (2S)-2- amino-5-sulfanylpentanoic acid, (2S)-2-amino-6-sulfanylhexanoic acid, L-S-(2-nitrobenzyl) cysteine, L-S-ferrocenyl-cysteine, L-O-crotylserine, L-O-(pent-4-en-1-yl)serine, L-O-(4,5- dimethoxy-2-nitrobenzyl)serine, (2S)-2-amino-3-({[5-(dimethylamino)naphthalen-1- yl]sulfonyl}amino)propanoic acid, (2S)-3-[(6-acetyl-naphthalen-1-yl)amino]-2-aminopropanoic acid, L-Pyrrolysine, N6-[(propargyloxy)carbonyl]-L-lysine, L-N6-acetyllysine, N6-WSGR Docket No.63634-702.601 trifluoroacetyl-L-lysine, N6-{[1-(6-nitro-1,3-benzodioxol-5-yl)ethoxy]carbonyl}-L-lysine, N6- {[2-(3-methyl-3H-diaziren-3-yl)ethoxy]carbonyl}-L-lysine, p-azidophenylalanine, and 2- aminoisobutyric acid. In some embodiments, the amino acid sequence has natural amino acids and unnatural amino acids.

[0113] In some embodiments, the peptide is labeled. In some embodiments, the peptide is labeled with a fluorescent protein or peptide. Non-limiting examples of fluorescent proteins or peptides include CFP (cyan fluorescent protein), YFP (yellow fluorescent protein), mVenus, cyan ECFP (enhanced cyan fluorescent protein), yellow EYFP (enhanced yellow fluorescent protein), green EGFP (enhanced green fluorescent protein), GFP, BPF (blue fluorescent protein), blue EBFP (enhanced blue fluorescent protein), red mCherry, SYTO®9, propidium iodide, mCitrine, YPet, aquamarine, mTurquoise2, mCeruean3, LUMP (lumazine binding protein), mTFP1 (monomeric teal fluorescent protein), NowGFP, Clover, mClover3, mNeonGreen, mRuby2 mRuby3, mPlum, eqFP650, mCardinal, IFP1.4m, iRFPm, mAmetrine, LSS-mOrange, tdTomato, mKate2, ShadowG, REACh1 (Resonance Energy-Accepting Chromoprotein 1), REACh2, sREACh, rsTagRFP, PA-GFP (photo activatable green fluorescent protein), Phanta, T-Sapphire, mTagBFP, sfGFP (superfolder GFP), CyOFP1, mOrange2, mKOκ, TagRFP, DsRed, muGFP, AF660 (Alex Fluor 660), or Ni-NTA-Atto, and fragments thereof. In some embodiments, the peptide is labeled with a luminescent polypeptide. Non-limiting examples of luminescent polypeptides include flirefly luciferase, renilla luciferase, guassia luciferase, NanoLuc luciferase, and aequorin luciferase.

[0114] In some embodiments, the amino acid sequence has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 50% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 60% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 70% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 80% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 90% sequence identity to XQIVGGTICT (SEQ ID NO:WSGR Docket No.63634-702.601 1). In some embodiments, the amino acid sequence has at least about 95% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 98% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has at least about 99% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence is XQIVGGTICT (SEQ ID NO: 1).

[0115] In some embodiments, X in XQIVGGTICT (SEQ ID NO: 1) is an amino acid residue with an ionizable side chain. In some embodiments, X is a polar amino acid residue. Non- limiting examples of polar amino acid residues include tyrosine, serine, threonine, asparagine, glutamine, and cysteine. In some embodiments, X is tyrosine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X is asparagine. In some embodiments, X is glutamine. In some embodiments, X is cysteine. In some embodiments, X is a basic amino acid residue. Non-limiting examples of basic amino acid residues include lysine, arginine, and histidine. In some embodiments, X is lysine. In some embodiments, X is arginine. In some embodiments, X is histidine.

[0116] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 50% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 60% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 70% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 80% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 90% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 95% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 98% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has at least about 99% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide is XQIVGGTICT (SEQ ID NO: 1).

[0117] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, atWSGR Docket No.63634-702.601 least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 50% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 60% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 70% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 80% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 90% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 95% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 98% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has at least about 99% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide is KQIVGGTICT (SEQ ID NO: 2).

[0118] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 50% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 60% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 70% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 80% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 90% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 95% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 98% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has at least about 99% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide is CREQIVGGTICT (SEQ ID NO: 3).WSGR Docket No.63634-702.601

[0119] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 50% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 60% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 70% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 80% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 90% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 95% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 98% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has at least about 99% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide is KREQIVGGTICT (SEQ ID NO: 4).

[0120] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 50% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 60% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 70% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 80% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 90% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 95% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 98% sequence identity toWSGR Docket No.63634-702.601 KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has at least about 99% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide is KRAREQIVGGTICT (SEQ ID NO: 5).

[0121] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 50% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 60% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 70% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 80% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 90% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 95% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 98% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has at least about 99% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide is KLCTLLRAREQIVGGTICT (SEQ ID NO: 6).

[0122] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 50% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 60% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least aboutWSGR Docket No.63634-702.601 70% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 80% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 90% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 95% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 98% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has at least about 99% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition is (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32).

[0123] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 50% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 60% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 70% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 80% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 90% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 95% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 98% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has at least about 99% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition is (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33).

[0124] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least aboutWSGR Docket No.63634-702.601 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 50% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 60% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 70% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 80% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 90% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 95% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 98% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has at least about 99% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition is (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34).

[0125] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11).

[0126] In some embodiments, the composition has at least about 50% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least about 60% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least about 70% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least about 80% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least about 90% sequence identity to (fatty acyl group)- KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least aboutWSGR Docket No.63634-702.601 95% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least about 98% sequence identity to (fatty acyl group)- KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has at least about 99% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition is (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11).

[0127] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12).

[0128] In some embodiments, the composition has at least about 50% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 60% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 70% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 80% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 90% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 95% sequence identity to (fatty acyl group)- KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 98% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has at least about 99% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition is (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12).

[0129] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identityWSGR Docket No.63634-702.601 to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13).

[0130] In some embodiments, the composition has at least about 50% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 60% sequence identity to (fatty acyl group)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 70% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 80% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 90% sequence identity to (fatty acyl group)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 95% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 98% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has at least about 99% sequence identity to (fatty acyl group)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition is (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13).

[0131] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35).

[0132] In some embodiments, the composition has at least about 50% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has at least about 60% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has at least about 70% sequence identity to palmitoyl- XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has at least about 80% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has at least about 90% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has at least about 95% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has at least about 98% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In someWSGR Docket No.63634-702.601 embodiments, the composition has at least about 99% sequence identity to palmitoyl- XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition is palmitoyl- XQIVGGTICT (SEQ ID NO: 35).

[0133] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36).

[0134] In some embodiments, the composition has at least about 50% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 60% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 70% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 80% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 90% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 95% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 98% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has at least about 99% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition is (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36).

[0135] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37).

[0136] In some embodiments, the composition has at least about 50% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has atWSGR Docket No.63634-702.601 least about 60% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has at least about 70% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has at least about 80% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has at least about 90% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has at least about 95% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has at least about 98% sequence identity to (palmitoyl)-KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has at least about 99% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition is (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37).

[0137] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19).

[0138] In some embodiments, the composition has at least about 50% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 60% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 70% sequence identity to (palmitoyl)- KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 80% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 90% sequence identity to (palmitoyl)- KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 95% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 98% sequence identity to (palmitoyl)- KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has at least about 99% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition is (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19).

[0139] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%,WSGR Docket No.63634-702.601 at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20).

[0140] In some embodiments, the composition has at least about 50% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 60% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 70% sequence identity to (palmitoyl)- KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 80% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 90% sequence identity to (palmitoyl)- KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 95% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 98% sequence identity to (palmitoyl)- KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has at least about 99% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition is (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20).

[0141] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21).

[0142] In some embodiments, the composition has at least about 50% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has at least about 60% sequence identity to (palmitoyl)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has at least about 70% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has at least about 80% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, theWSGR Docket No.63634-702.601 composition has at least about 90% sequence identity to (palmitoyl)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has at least about 95% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has at least about 98% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has at least about 99% sequence identity to (palmitoyl)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition is (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21).

[0143] In some embodiments, the peptide or composition is packaged. In some embodiments, the peptide or composition is packaged in a lipid nanoparticle. In some embodiments, the lipid nanoparticle is a solid lipid nanoparticle. In some embodiments, the lipid nanoparticle is a nanostructured lipid carrier.

[0144] Alternatively, the peptide or composition is not packaged.

[0145] One aspect of the present disclosure provides a composition comprising a peptide. In some embodiments, the peptide has at least about one region. In some embodiments, the peptide has from about one region to about ten regions. In some embodiments, the peptide has at least one region, at least about two regions, at least about three regions, at least about four regions, at least about five regions, at least about six regions, at least about seven regions, at least about eight regions, at least about nine regions, at least about ten regions, or more. In some embodiments, the peptide has at most about ten regions, at most about nine regions, at most about eight regions, at most about seven regions, at most about six regions, at most about five regions, at most about four regions, at most about three regions, at most about two regions, or at most about one region. In some embodiments, peptide has about one region, about two regions, about three regions, about four regions, about five regions, about six regions, about seven regions, about eight regions, about nine regions, or about ten regions.

[0146] In some embodiments, the peptide is linear. In some embodiments, the peptide is circular. In some embodiments, the peptide is a cyclic peptide. In some embodiments, the peptide has about two portions. In some embodiments, the two portions are a first portion and a second portion. In some embodiments, the first portion is linear and the second portion is circular. In some embodiments, the first portion is circular and the second portion is linear. In some embodiment, the peptide has three portions. In some embodiments, the three portions are a first portion, a second portion, and a third portion. In some embodiments, the first portion is linear, the second portion is circular, and the third portion is linear. In some embodiments, the first portion is circular, the second portion is linear, and the third portion is circular.WSGR Docket No.63634-702.601

[0147] In some embodiments, the at least one region has at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or at least about 99.5% identity to SEQ ID NO: 7 (MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKA TEDEYYRRLLRVLRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQL CSFQIYEVPWEDRMSLVNSRCQEA). In some embodiments, the at least one region has at least about 50% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 60% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 70% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 80% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 90% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to SEQ ID NO: 7.

[0148] In some embodiments, the at least one region has about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 98%, about 99%, about 99.5% identity to SEQ ID NO: 7. In some embodiments, the at least one region has about 50% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 60% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 70% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 80% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 90% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 95% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 98% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 99% identity to SEQ ID NO: 7. In some embodiments, the at least about one region has about 99.5% identity to SEQ ID NO: 7.

[0149] In some embodiments, the at least one region has at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or at least about 99.5% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 50% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 60% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 70% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 80% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the atWSGR Docket No.63634-702.601 least one region has at least about 90% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence of SEQ ID NO: 7.

[0150] In some embodiments, the at least one region has about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 98%, about 99%, about 99.5% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least one region has about 50% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 60% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 70% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 80% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 90% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 95% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 98% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 99% identity to a subsequence of SEQ ID NO: 7. In some embodiments, the at least about one region has about 99.5% identity to a subsequence of SEQ ID NO: 7.

[0151] In some embodiments, the subsequence of SEQ ID NO: 7 is from about 1 contiguous amino acid residue to about 10 contiguous amino acid residues, from about 10 contiguous amino acid residues to about 20 contiguous amino acid residues, from about 20 contiguous amino acid residues to about 30 contiguous amino acid residues, from about 30 contiguous amino acid residues to about 40 contiguous amino acid residues, from about 40 contiguous amino acid residues to about 50 contiguous amino acid residues, from about 50 contiguous amino acid residues to about 60 contiguous amino acid residues, from about 60 contiguous amino acid residues to about 70 contiguous amino acid residues, from about 70 contiguous amino acid residues to about 80 contiguous amino acid residues, from about 80 contiguous amino acid residues to about 90 contiguous amino acid residues, from about 90 contiguous amino acid residues to about 100 contiguous amino acid residues, from about 100 contiguous amino acid residues to about 110 contiguous amino acid residues, from about 110 contiguous amino acid residues to about 120 contiguous amino acid residues, from about 120 contiguous amino acid residues to about 130 contiguous amino acid residues, or from about 130 contiguous amino acidWSGR Docket No.63634-702.601 residues to about 141 contiguous amino acid residues.

[0152] In some embodiments, the subsequence of SEQ ID NO:7 is at least about 1 contiguous amino acid residue, at least about 2 contiguous amino acid residues, at least about 3 contiguous amino acid residues, at least about 4 contiguous amino acid residues, at least about 5 contiguous amino acid residues, at least about 6 contiguous amino acid residues, at least about 7 contiguous amino acid residues, at least about 8 contiguous amino acid residues, at least about 9 contiguous amino acid residues, at least about 10 contiguous amino acid residues, at least about 11 contiguous amino acid residues, at least about 12 contiguous amino acid residues, at least about 13 contiguous amino acid residues, at least about 14 contiguous amino acid residues, at least about 15 contiguous amino acid residues, at least about 16 contiguous amino acid residues, at least about 17 contiguous amino acid residues, at least about 18 contiguous amino acid residues, at least about 19 contiguous amino acid residues, at least about 20 contiguous amino acid residues, at least about 30 contiguous amino acid residues, at least about 40 contiguous amino acid residues, at least about 50 contiguous amino acid residues, at least about 60 contiguous amino acid residues, at least about 70 contiguous amino acid residues, at least about 80 contiguous amino acid residues, at least about 90 contiguous amino acid residues, at least about 100 contiguous amino acid residues, at least about 110 contiguous amino acid residues, at least about 120 contiguous amino acid residues, at least about 130 contiguous amino acid residues, or at least about 141 contiguous amino acid residues.

[0153] In some embodiments, the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has at least about 20 contiguous amino acid residues of SEQ ID NO: 7.

[0154] In some embodiments, the subsequence of SEQ ID NO: 7 is about 1 contiguous amino acid residue, about 2 contiguous amino acid residues, about 3 contiguous amino acid residues, about 4 contiguous amino acid residues, about 5 contiguous amino acid residues, about 6 contiguous amino acid residues, about 7 contiguous amino acid residues, about 8 contiguous amino acid residues, about 9 contiguous amino acid residues, about 10 contiguous amino acid residues, about 11 contiguous amino acid residues, about 12 contiguous amino acid residues,WSGR Docket No.63634-702.601 about 13 contiguous amino acid residues, about 14 contiguous amino acid residues, about 15 contiguous amino acid residues, about 16 contiguous amino acid residues, about 17 contiguous amino acid residues, about 18 contiguous amino acid residues, about 19 contiguous amino acid residues, about 20 contiguous amino acid residues, about 30 contiguous amino acid residues, about 40 contiguous amino acid residues, about 50 contiguous amino acid residues, about 60 contiguous amino acid residues, about 70 contiguous amino acid residues, about 80 contiguous amino acid residues, about 90 contiguous amino acid residues, about 100 contiguous amino acid residues, about 110 contiguous amino acid residues, about 120 contiguous amino acid residues, about 130 contiguous amino acid residues, or about 141 contiguous amino acid residues.

[0155] In some embodiments, the subsequence has about 1 contiguous amino acid residue of SEQ ID NO: 7. In some embodiments, the subsequence has about 2 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 3 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the subsequence has about 20 contiguous amino acid residues of SEQ ID NO: 7.

[0156] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ IDWSGR Docket No.63634-702.601 NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0157] In some embodiments, the at least one region has at least about 90% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to at least about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0158] In some embodiments, the at least one region has about 80% identity to a subsequenceWSGR Docket No.63634-702.601 and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0159] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and theWSGR Docket No.63634-702.601 subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0160] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0161] In some embodiments, the at least one region has at least about 90% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ IDWSGR Docket No.63634-702.601 NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to at least about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0162] In some embodiments, the at least one region has about 80% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In someWSGR Docket No.63634-702.601 embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0163] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0164] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ IDWSGR Docket No.63634-702.601 NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0165] In some embodiments, the at least one region has at least about 90% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to at least about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0166] In some embodiments, the at least one region has about 80% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0167] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and theWSGR Docket No.63634-702.601 subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0168] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0169] In some embodiments, the at least one region has at least about 90% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about at least about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0170] In some embodiments, the at least one region has about 80% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In someWSGR Docket No.63634-702.601 embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0171] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In someWSGR Docket No.63634-702.601 embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0172] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0173] In some embodiments, the at least one region has at least about 90% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to at least about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0174] In some embodiments, the at least one region has about 80% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and theWSGR Docket No.63634-702.601 subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0175] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0176] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0177] In some embodiments, the at least one region has at least about 90% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ IDWSGR Docket No.63634-702.601 NO: 7. In some embodiments, the at least one region is identical to at least about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0178] In some embodiments, the at least one region has about 80% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0179] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In someWSGR Docket No.63634-702.601 embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0180] In some embodiments, the at least one region has at least about 80% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 81% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 82% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 83% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 84% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 85% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 86% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 87% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 88% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 89% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0181] In some embodiments, the at least one region has at least about 90% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 91% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 92% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 93% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 94% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 95% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 96% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 97% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 98% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has at least about 99.5% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to at least about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0182] In some embodiments, the at least one region has about 80% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 81% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 82% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 83% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 84% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 85% identity to a subsequence and theWSGR Docket No.63634-702.601 subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 86% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 87% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 88% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 89% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0183] In some embodiments, the at least one region has about 90% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 91% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 92% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 93% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 94% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 95% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 96% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 97% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 98% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region has about 99.5% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one region is identical to about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0184] In some embodiments, the peptide further comprises at least one additional regionWSGR Docket No.63634-702.601 attached the region. In some embodiments, the peptide further comprises at least one additional region, at least two additional regions, at least three additional regions, at least four additional regions, at least five additional regions, at least six five additional regions, at least seven additional regions, at least eight additional regions, at least nine additional regions, at least ten additional regions, or more. In some embodiments, the peptide further comprises about one additional region, about two additional regions, about three additional regions, about four additional regions, about five additional regions, about six additional regions, about seven additional regions, about eight additional regions, about nine additional regions, or about ten additional regions.

[0185] In some embodiments, the at least one additional region has at least about 80% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0186] In some embodiments, the at least one additional region has at least about 90% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91%WSGR Docket No.63634-702.601 identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 96% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to at least about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0187] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 85% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7.WSGR Docket No.63634-702.601 In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0188] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 91% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99.5% identity to a subsequence and the subsequence has about 4 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 4 contiguous amino acid residues of SEQ ID NO: 7.

[0189] In some embodiments, the at least one additional region has at least about 80% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues ofWSGR Docket No.63634-702.601 SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0190] In some embodiments, the at least one additional region has at least about 90% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 96% identity to a subsequence and the subsequenceWSGR Docket No.63634-702.601 has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to at least about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0191] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 85% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0192] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 91% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99.5% identity to a subsequence and the subsequence has about 5 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 5 contiguous amino acid residues of SEQ ID NO: 7.

[0193] In some embodiments, the at least one additional region has at least about 80% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the atWSGR Docket No.63634-702.601 least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0194] In some embodiments, the at least one additional region has at least about 90% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 96% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to at least about 6 contiguous amino acid residues of SEQ ID NO: 7.WSGR Docket No.63634-702.601

[0195] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 85% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0196] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 91% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7.WSGR Docket No.63634-702.601 In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99.5% identity to a subsequence and the subsequence has about 6 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 6 contiguous amino acid residues of SEQ ID NO: 7.

[0197] In some embodiments, the at least one additional region has at least about 80% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0198] In some embodiments, the at least one additional region has at least about 90% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues ofWSGR Docket No.63634-702.601 SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 96% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about at least about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0199] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 85% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0200] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 91% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the additional region has about 99.5% identity to a subsequence and the subsequence has about 7 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 7 contiguous amino acid residues of SEQ ID NO: 7.

[0201] In some embodiments, the at least one additional region has at least about 80% identityWSGR Docket No.63634-702.601 to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0202] In some embodiments, the at least one additional region has at least about 90% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the atWSGR Docket No.63634-702.601 least one additional region has at least about 96% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to at least about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0203] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 85% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0204] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7.WSGR Docket No.63634-702.601 In some embodiments, the at least one additional region has about 91% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99.5% identity to a subsequence and the subsequence has about 8 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 8 contiguous amino acid residues of SEQ ID NO: 7.

[0205] In some embodiments, the at least one additional region has at least about 80% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has atWSGR Docket No.63634-702.601 least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0206] In some embodiments, the at least one additional region has at least about 90% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 96% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to at leastWSGR Docket No.63634-702.601 about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0207] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 85% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0208] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 91% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to aWSGR Docket No.63634-702.601 subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99.5% identity to a subsequence and the subsequence has about 9 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 9 contiguous amino acid residues of SEQ ID NO: 7.

[0209] In some embodiments, the at least one additional region has at least about 80% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 81% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 82% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 83% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 84% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 85% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 86% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 87% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 88% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 89% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0210] In some embodiments, the at least one additional region has at least about 90% identityWSGR Docket No.63634-702.601 to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 91% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 92% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 93% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 94% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 95% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 96% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 97% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 98% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has at least about 99.5% identity to a subsequence and the subsequence has at least about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to at least about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0211] In some embodiments, the at least one additional region has about 80% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 81% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 82% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 83% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 84% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO:WSGR Docket No.63634-702.601 7. In some embodiments, the at least one additional region has about 85% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 86% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 87% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 88% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 89% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7.

[0212] In some embodiments, the at least one additional region has about 90% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 91% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 92% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 93% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 94% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 95% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 96% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 97% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 98% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region has about 99.5% identity to a subsequence and the subsequence has about 10 contiguous amino acid residues of SEQ ID NO: 7. In some embodiments, the at least one additional region is identical to about 10 contiguousWSGR Docket No.63634-702.601 amino acid residues of SEQ ID NO: 7.

[0213] In some embodiments, the peptide has an amino acid sequence. In some embodiments, amino acid sequence inhibits an enzyme. In some embodiments, the peptide inhibits the enzyme by binding to the enzyme. In some embodiments, the amino acid sequence of the peptide binds to the enzyme.

[0214] In some embodiments, the amino acid sequence of the peptide binds to at least about one active site on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to from about one active site to about 10 active sites on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least about one active site, at least about two active sites, at least about three active sites, at least about four active sites, at least about five active sites, at least about six active sites, at least about seven active sites, at least about eight active sites, at least about nine active sites, at least about ten active sites, or more on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at most about ten active sites, at most about nine active sites, at most about eight active sites, at most about seven active sites, at most about six active sites, at most about five active sites, at most about four active sites, at most about three active sites, at most about two active sites, at most about one active site, or less on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to about one active site, about two active sites, about three active sites, about four active sites, about five active sites, about six active sites, about seven active sites, about eight active sites, about nine active sites, or about ten active sites on the enzyme.

[0215] In some embodiments, the amino acid sequence of the peptide binds to at least one non- active site location on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to from about one non-active site to about ten non-active site locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least about one non-active site, at least about two non-active sites, at least about three non-active sites, at least about four non-active sites, at least about five non-active sites, at least about six non-active sites, at least about seven non-active sites, at least about eight non-active sites, at least about nine non-active sites, at least about ten non-active sites, or more locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at most about ten non- active sites, at most about nine non-active sites, at most about eight non-active sites, at most about seven non-active sites, at most about six non-active sites, at most about five non-active sites, at most about four non-active sites, at most about three non-active sites, at most about two non-active sites, at most about one non-active site, or less locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to about one non-active site, aboutWSGR Docket No.63634-702.601 two non-active sites, about three non-active sites, about four non-active sites, about five non- active sites, about six non-active sites, about seven non-active sites, about eight non-active sites, about nine non-active sites, or about ten non-active sites on the enzyme. Binding to at least one active site and / or at least one non-active site location on the enzyme can prevent the activity / function of the enzyme. In some embodiments, the amino acid sequence of the peptide inhibits the enzyme.

[0216] In some embodiments, the enzyme is a hydrolase enzyme. Non-limiting examples of hydrolase enzymes include esterases, lipases, phosphatases, glycosidases, peptidases, and nucleosidases. In some embodiments, the hydrolase enzyme is a lipase (e.g., a lipid hydrolase). Non-limiting examples of lipid hydrolases include pancreatic lipase, lysosomal lipase, acid ceramidase, lipoprotein lipase, gastric lipase, and lingual lipase. In some embodiments, the lipase is acid ceramidase. In some embodiments, the enzyme is a protease. Non-limiting examples of proteases include trypsin, chymotrypsin, elastase, papain, calpain, cathepsins, pepsin, rennin, thermolysin, and carboxypeptidase A. In some embodiments, the protease is a serine protease, a cysteine protein, an aspartic protease, or a metallo-protease. In some embodiments, the protease is a serine protease. In some embodiments, the serine protease is trypsin, chymotrypsin, or elastase. In some embodiments, the serine protease is trypsin. In some embodiments, the serine protease is chymotrypsin. In some embodiments, the serine protease is elastase. In some embodiments, the protease is a cysteine protease. In some embodiments, the cysteine protease is papain or a papain-like protease, caspase-1, calpain, or cathepsins. In some embodiments, the cysteine protease is papain or a papain-like protease. In some embodiments, the cysteine protease is caspase-1. In some embodiments, the cysteine protease is calpain. In some embodiments, the cysteine protease is a cathepsin protease. Non-limiting examples of cathepsins include cathepsin B, cathepsin H, cathepsin L, cathepsin C, cathepsin X, cathepsin V, cathepsin O, cathepsin K, cathepsin S, cathepsin E, and cathepsin W. In some embodiments, the protease is an aspartic protease. In some embodiments, the aspartic protease is pepsin or rennin. In some embodiments, the aspartic protease is pepsin. In some embodiments, the aspartic protease is rennin. In some embodiments, the protease is a metallo-protease. In some embodiments, the metallo-protease is thermolysin or carboxypeptidase A. In some embodiments, the metallo-protease is thermolysin. In some embodiments, the metalo-protease is carboxypeptidase A.

[0217] In some embodiments, a non-peptidal hydrophobic moiety is attached to the peptide. In some embodiments, the non-peptidal hydrophobic moiety is a C6-20alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C6alkyl group. In some embodiments,WSGR Docket No.63634-702.601 the non-peptidal hydrophobic moiety is a C7alkyl group. In some embodiments, the non- peptidal hydrophobic moiety is a C8alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C9alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C10alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C11alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C12alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C13alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C14alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C15alkyl group. In some embodiments, the non- peptidal hydrophobic moiety is a C16alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C17alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C18alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C19alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C20alkyl group.

[0218] In some embodiments, the non-peptidal hydrophobic moiety is a lipid. In some embodiments, the lipid is fatty acyl group. Non-limiting examples of fatty acyl groups include arachidonoyl, behenoyl, butyryl, cerotoyl, decanoyl, docosenoyl, dodecanoyl, eleostearoyl, heptanoyl, heptatrienoyl, hexanoyl, icosanoyl, icosenoyl, lignoceroyl, linoleoyl, lipoyl, margaroyl, melissoyl, mycolyl, myristoleoyl, nervonoyl, nonanoyl, obtusiloyl, octadic-9-ynoyl, octadecenoyl, octanoyl, palmitoleoyl, palmitoyl, parinaroyl, stearoyl, tetradecanoyl, undecanoyl, and valeryl.

[0219] In some embodiments, the fatty acyl group is a short-chain acyl group. Non-limiting examples of short-chain acyl groups include formate, acetate, propionate, butyrate, isobutyrate, valerate, isovalerate, and 2-Methylbutanoate. In some embodiments, the short-chain fatty acyl group is formate. In some embodiments, the short-chain fatty acyl group is acetate. In some embodiments, the short-chain fatty acyl group is propionate. In some embodiments, the short- chain fatty acyl group is butyrate. In some embodiments, the short-chain fatty acyl group is isobutyrate. In some embodiments, the short-chain fatty acyl group is valerate. In some embodiments, the short-chain fatty acyl group is isovalerate. In some embodiments, the short- chain fatty acyl group is 2-Methylbutanoate. In some embodiments, the fatty acyl group is a medium-chain acyl group. Non-limiting examples of medium-chain acyl groups include hexanoate, octanoate, decanoate, caproic acid, caprylic acid, capric acid, lauric acid, and dodecanoate. In some embodiments, the medium-chain fatty acyl group is hexanoate. In some embodiments, the medium-chain fatty acyl group is octanoate. In some embodiments, the medium-chain fatty acyl group is decanoate. In some embodiments, the medium-chain fatty acyl group is caproic acid. In some embodiments, the medium-chain fatty acyl group is caprylic acid.WSGR Docket No.63634-702.601 In some embodiments, the medium-chain fatty acyl group is capric acid. In some embodiments, the medium-chain fatty acyl group is lauric acid. In some embodiments, the medium-chain fatty acyl group is dodecanoate. In some embodiments, the fatty acyl group is a long-chain fatty acyl group. Non-limiting examples of long-chain fatty acyl groups include myrisate, stearoyl, palmitoyl, arachidonoyl, oleate, palmitoleoyl, nervonoyl, linoleoyl, docosahexaenoic acid, and eicosapentaenoic acid. In some embodiments, the long-chain fatty acyl group is myrisate. In some embodiments, the long-chain fatty acyl group is stearoyl. In some embodiments, the long- chain fatty acyl group is palmitoyl. In some embodiments, the long-chain fatty acyl group is arachidonoyl. In some embodiments, the long-chain fatty acyl group is oleate. In some embodiments, the long-chain fatty acyl group is palmitoleoyl. In some embodiments, the long- chain fatty acyl group is nervonoyl. In some embodiments, the long-chain fatty acyl group is linoleoyl. In some embodiments, the long-chain fatty acyl group is docosahexaenoic acid. In some embodiments, the long-chain fatty acyl group is eicosapentaenoic acid.

[0220] In some embodiments, the non-peptidal hydrophobic moiety is a short-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is a medium-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is a long-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is palmitoyl.

[0221] Alternatively, in some embodiments, the peptide is not attached to a non-peptidal hydrophobic moiety.

[0222] In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the N-terminal and / or C-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the N-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the C-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to a non- terminal amino acid residue. In some embodiments, the non-peptidal hydrophobic moiety is attached to the region. In some embodiments, the non-peptidal hydrophobic moiety is attached to the additional region.

[0223] In some embodiments, the peptide is linear. In some embodiments, the peptide is circular. In some embodiments, the peptide is a cyclic peptide. In some embodiments, the peptide has about two portions. In some embodiments, the two portions are a first portion and a second portion. In some embodiments, the first portion is linear and the second portion is circular. In some embodiments, the first portion is circular and the second portion is linear. In some embodiment, the peptide has three portions. In some embodiments, the three portions are a first portion, a second portion, and a third portion. In some embodiments, the first portion isWSGR Docket No.63634-702.601 linear, the second portion is circular, and the third portion is linear. In some embodiments, the first portion is circular, the second portion is linear, and the third portion is circular.

[0224] In some embodiments, the peptide has at least one disulfide bond. In some embodiments, the peptide has from about one disulfide bond to about 20 disulfide bonds. In some embodiments, the peptide has at least about one disulfide bond, at least about two disulfide bonds, at least about three disulfide bonds, at least about four disulfide bonds, at least about five disulfide bonds, at least about six disulfide bonds, at least about seven disulfide bonds, at least about eight disulfide bonds, at least about nine disulfide bonds, at least about ten disulfide bonds, at least about 11 disulfide bonds, at least about 12 disulfide bonds, at least about 13 disulfide bonds, at least about 14 disulfide bonds, at least about 15 disulfide bonds, at least about 16 disulfide bonds, at least about 17 disulfide bonds, at least about 18 disulfide bonds, at least about 19 disulfide bonds, at least about 20 disulfide bonds, or more.

[0225] In some embodiments, the peptide has at most about 20 disulfide bonds, at most about 19 disulfide bonds, at most about 18 disulfide bonds, at most about 17 disulfide bonds, at most about 16 disulfide bonds, at most about 15 disulfide bonds, at most about 14 disulfide bonds, at most about 13 disulfide bonds, at most about 12 disulfide bonds, at most about 11 disulfide bonds, at most about ten disulfide bonds, at most about nine disulfide bonds, at most about eight disulfide bonds, at most about seven disulfide bonds, at most about six disulfide bonds, at most about five disulfide bonds, at most about four disulfide bonds, at most about three disulfide bonds, at most about two disulfide bonds, at most about one disulfide bond, or less.

[0226] In some embodiments, the peptide has about one disulfide bond, about two disulfide bonds, about three disulfide bonds, about four disulfide bonds, about five disulfide bonds, about six disulfide bonds, about seven disulfide bonds, about eight disulfide bonds, about nine disulfide bonds, about ten disulfide bonds, about 11 disulfide bonds, about 12 disulfide bonds, about 13 disulfide bonds, about 14 disulfide bonds, about 15 disulfide bonds, about 16 disulfide bonds, about 17 disulfide bonds, about 18 disulfide bonds, about 19 disulfide bonds, or about 20 disulfide bonds.

[0227] In some embodiments, the at least one disulfide bond is an internal disulfide bond. In some embodiments, the at least one disulfide bond is an external disulfide bond. In some embodiments, the peptide has two or more disulfide bonds. In some embodiments, the two or more disulfide bonds are internal disulfide bonds and / or external disulfide bonds.

[0228] In some embodiments, the peptide is positively charged at physiological pH. In some embodiments, the peptide is negatively charged at physiological pH. In some embodiments, the peptide has a neutral charge at physiological pH. In some embodiments, the physiological pH isWSGR Docket No.63634-702.601 between about 6 to about 6.5, between about 6.5 to about 7, between about 7 to about 7.5, or between about 7.5 to about 8. In some embodiments, the physiological pH is at least about 6, at least about 6.25, at least about 6.5, at least about 6.75, at least about 7, at least about 7.25, at least about 7.5, at least about 7.75, at least about 8, or more. In some embodiments, the physiological pH is at most about 8, at most about 7.75, at most about 7.5, at most about 7.25, at most about 7, at most about 6.75, at most about 6.5, at most about 6.25, at most about 6, or less. In some embodiments, the physiological pH is about 6, about 6.25, about 6.5, about 6.75, about 7, about 7.25, about 7.5, about 7.75, or about 8.

[0229] In some embodiments, the peptide is positively charged at acidic pH. In some embodiments, the peptide is negatively charged at acidic pH. In some embodiments, the peptide has a neutral charge at acidic pH. In some embodiments, the acidic pH is between about 1 to about 1.5, between about 1.5 to about 2, between about 2 to about 2.5, between about 2.5 to about 3, between about 3 to about 3.5, between about 3.5 to about 4, between about 4 to about 4.5, between about 4.5 to about 5, between about 5 to about 5.5, or between about 5.5 to about 6. In some embodiments, the acidic pH is at least about 1, at least about 1.5, at least about 2, at least about 2.5, at least about 3, at least about 3.5, at least about 4, at least about 4.5, at least about 5, at least about 5.5, at least about 6, or more. In some embodiments, the acidic pH is at most about 6, at most about 5.5, at most about 5, at most about 4.5, at most about 4, at most about 3.5, at most about 3, at most about 2.5, at most about 2, at most about 1.5, at most about 1, or less. In some embodiments, the acidic pH is about 1, about 1.5, about 2, about 2.5, about 3, about 3.5, about 4, about 4.5, about 5, about 5.5, or about 6.

[0230] In some embodiments, the peptide is positively charged at basic pH. In some embodiments, the peptide is negatively charged at basic pH. In some embodiments, the peptide has a neutral charge at basic pH. In some embodiments, the basic pH is between about 8 to about 8.5, between about 8.5 to about 9, between about 9 to about 9.5, between about 9.5 to about 10, between about 10 to about 10.5, between about 10.5 to about 11, between about 11 to about 11.5, between about 11.5 to about 12, between about 12 to about 12.5, between about 12.5 to about 13, between about 13 to about 13.5, or between 13.5 to about 14. In some embodiments, the basic pH is at least about 8, at least about 8.5, at least about 9, at least about 9.5, at least about 10, at least about 10.5, at least about 11, at least about 11.5, at least about 12, at least about 12.5, at least about 13, at least about 13.5, at least about 14, or more. In some embodiments, the basic pH is at most about 14, at most about 13.5, at most about 13, at most about 12.5, at most about 12, at most about 11.5, at most about 11, at most about 10.5, at most about 10, at most about 9.5, at most about 9, at most about 8.5, at most about 8, or less. In someWSGR Docket No.63634-702.601 embodiments, the basic pH is about 8, about 8.5, about 9, about 9.5, about 10, about 10.5, about 11, about 11.5, about 12, about 12.5, about 13, about 13.5, or about 14.

[0231] In some embodiments, the peptide has from about one amino acid residue to about 200 amino acids residues. In some embodiments, the peptide has at least about one amino acid residue, at least about two amino acid residues, at least about three amino acid residues, at least about four amino acid residues, at least about five amino acid residues, at least about six amino acid residues, at least about seven amino acid residues, at least about eight amino acid residues, at least about nine amino acid residues, at least about ten amino acid residues, at least about 11 amino acid residues, at least about 12 amino acid residues, at least about 13 amino acid residues, at least about 14 amino acid residues, at least about 15 amino acid residues, at least about 16 amino acid residues, at least about 17 amino acid residues, at least about 18 amino acid residues, at least about 19 amino acid residues, at least about 20 amino acid residues, at least about 25 amino acid residues, at least about 30 amino acid residues, at least about 35 amino acid residues, at least about 40 amino acid residues, at least about 45 amino acid residues, at least about 50 amino acid residues, at least about 55 amino acid residues, at least about 60 amino acid residues, at least about 65 amino acid residues, at least about 70 amino acid residues, at least about 75 amino acid residues, at least about 80 amino acid residues, at least about 85 amino acid residues, at least about 90 amino acid residues, at least about 95 amino acid residues, at least about 100 amino acid residues, at least about 105 amino acid residues, at least about 110 amino acid residues, at least about 115 amino acid residues, at least about 120 amino acid residues, at least about 125 amino acid residues, at least about 130 amino acid residues, at least about 135 amino acid residues, at least about 140 amino acid residues, at least about 145 amino acid residues, at least about 150 amino acid residues, at least about 155 amino acid residues, at least about 160 amino acid residues, at least about 165 amino acid residues, at least about 170 amino acid residues, at least about 175 amino acid residues, at least about 180 amino acid residues, at least about 185 amino acid residues, at least about 190 amino acid residues, at least about 195 amino acid residues, at least about 200 amino acid residues, or more.

[0232] In some embodiments, the peptide has about 10 amino acids. In some embodiments, the peptide has about 12 amino acid residues. In some embodiments, the peptide has about 14 amino acid residues. In some embodiments, the peptide has about 19 amino acid residues. In some embodiments, the peptide has about 20 amino acid residues. In some embodiments, the peptide has about 50 amino acid residues. In some embodiments, the peptide has about 100 amino acid residues.

[0233] In some embodiments, the peptide has no more than about 200 amino acid residues, noWSGR Docket No.63634-702.601 more than about 195 amino acid residues, no more than about 190 amino acid residues, no more than about 185 amino acid residues, no more than about 180 amino acid residues, no more than about 175 amino acid residues, no more than about 170 amino acid residues, no more than about 165 amino acid residues, no more than about 160 amino acid residues, no more than about 155 amino acid residues, no more than about 150 amino acid residues, no more than about 145 amino acid residues, no more than about 140 amino acid residues, no more than about 135 amino acid residues, no more than about 130 amino acid residues, no more than about 125 amino acid residues, no more than about 120 amino acid residues, no more than about 115 amino acid residues, no more than about 110 amino acid residues, no more than about 105 amino acid residues, no more than about 100 amino acid residues, no more than about 95 amino acid residues, no more than about 90 amino acid residues, no more than about 85 amino acid residues, no more than about 80 amino acid residues, no more than about 75 amino acid residues, no more than about 70 amino acid residues, no more than about 65 amino acid residues, no more than about 60 amino acid residues, no more than about 55 amino acid residues, no more than about 50 amino acid residues, no more than about 45 amino acid residues, no more than about 40 amino acid residues, no more than about 35 amino acid residues, no more than about 30 amino acid residues, no more than about 25 amino acid residues, no more than about 20 amino acid residues, no more than about 19 amino acid residues, no more than about 18 amino acid residues, no more than about 17 amino acid residues, no more than about 16 amino acid residues, no more than about 15 amino acid residues, no more than about 14 amino acid residues, no more than about 13 amino acid residues, no more than about 12 amino acid residues, no more than about 11 amino acid residues, no more than about ten amino acid residues, no more than about nine amino acid residues, no more than about eight amino acid residues, no more than about seven amino acid residues, no more than about six amino acid residues, no more than about five amino acid residues, no more than about four amino acid residues, no more than about three amino acid residues, no more than about two amino acid residues, or no more than about one amino acid residue.

[0234] In some embodiments, the peptide has no more than about 20 amino acid residues. In some embodiments, the peptide has no more than about 50 amino acid residues. In some embodiments, the peptide has no more than about 100 amino acid residues.

[0235] In some embodiments, the peptide has about one amino acid residue, about two amino acid residues, about three amino acid residues, about four amino acid residues, about five amino acid residues, about six amino acid residues, about seven amino acid residues, about eight aminoWSGR Docket No.63634-702.601 acid residues, about nine amino acid residues, about ten amino acid residues, about 11 amino acid residues, about 12 amino acid residues, about 13 amino acid residues, about 14 amino acid residues, about 15 amino acid residues, about 16 amino acid residues, about 17 amino acid residues, about 18 amino acid residues, about 19 amino acid residues, about 20 amino acid residues, about 25 amino acid residues, about 30 amino acid residues, about 35 amino acid residues, about 40 amino acid residues, about 45 amino acid residues, about 50 amino acid residues, about 55 amino acid residues, about 60 amino acid residues, about 65 amino acid residues, about 70 amino acid residues, about 75 amino acid residues, about 80 amino acid residues, about 85 amino acid residues, about 90 amino acid residues, about 95 amino acid residues, about 100 amino acid residues, about 105 amino acid residues, about 110 amino acid residues, about 115 amino acid residues, about 120 amino acid residues, about 125 amino acid residues, about 130 amino acid residues, about 135 amino acid residues, about 140 amino acid residues, about 145 amino acid residues, about 150 amino acid residues, about 155 amino acid residues, about 160 amino acid residues, about 165 amino acid residues, about 170 amino acid residues, about 175 amino acid residues, about 180 amino acid residues, about 185 amino acid residues, about 190 amino acid residues, about 195 amino acid residues, or about 200 amino acid residues.

[0236] In some embodiments, the peptide has at least about 10 amino acid residues. In some embodiments, the peptide has at least 12 amino acid residues. In some embodiments, the peptide has at least about 14 amino acid residues. In some embodiments, the peptide has at least about 19 amino acid residues.

[0237] In some embodiments, the amino acid sequence has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1).

[0238] In some embodiments, X in XQIVGGTICT (SEQ ID NO: 1) is an amino acid residue with an ionizable side chain. In some embodiments, X is a polar amino acid residue. Non- limiting examples of polar amino acid residues include tyrosine, serine, threonine, asparagine, glutamine, and cysteine. In some embodiments, X is tyrosine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X is asparagine. In someWSGR Docket No.63634-702.601 embodiments, X is glutamine. In some embodiments, X is cysteine. In some embodiments, X is a basic amino acid residue. Non-limiting examples of basic amino acid residues include lysine, arginine, and histidine. In some embodiments, X is lysine. In some embodiments, X is arginine. In some embodiments, X is histidine.

[0239] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1).

[0240] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KQIVGGTICT (SEQ ID NO: 2).

[0241] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to CREQIVGGTICT (SEQ ID NO: 3).

[0242] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KREQIVGGTICT (SEQ ID NO: 4).

[0243] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, atWSGR Docket No.63634-702.601 least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5).

[0244] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6).

[0245] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32).

[0246] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33).

[0247] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has about 50%,WSGR Docket No.63634-702.601 about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34).

[0248] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11).

[0249] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12).

[0250] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13).

[0251] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to palmitoyl-XQIVGGTICTWSGR Docket No.63634-702.601 (SEQ ID NO: 35).

[0252] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36).

[0253] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37).

[0254] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KREQIVGGTICT (SEQ ID NO: 19). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19).

[0255] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KRAREQIVGGTICT (SEQ ID NO: 20). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KRAREQIVGGTICT (SEQ ID NO: 20).

[0256] In some embodiments, the composition has at least about 50%, at least about 55%, atWSGR Docket No.63634-702.601 least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 21). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 21).

[0257] One aspect of the present disclosure provides a composition comprising a peptide. In some embodiments, the peptide has an amino acid sequence. In some embodiments, the amino acid sequence has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1).

[0258] In some embodiments, X in XQIVGGTICT (SEQ ID NO: 1) is an amino acid residue with an ionizable side chain. In some embodiments, X is a polar amino acid residue. Non- limiting examples of polar amino acid residues include tyrosine, serine, threonine, asparagine, glutamine, and cysteine. In some embodiments, X is tyrosine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X is asparagine. In some embodiments, X is glutamine. In some embodiments, X is cysteine. In some embodiments, X is a basic amino acid residue. Non-limiting examples of basic amino acid residues include lysine, arginine, and histidine. In some embodiments, X is lysine. In some embodiments, X is arginine. In some embodiments, X is histidine.

[0259] In some embodiments, the peptide comprises an amino acid sequence. In some embodiments, the amino acid sequence inhibits an enzyme. In some embodiments, the peptide inhibits the enzyme by binding to the enzyme. In some embodiments, the amino acid sequence of the peptide binds to the enzyme.

[0260] In some embodiments, the amino acid sequence of the peptide binds to at least about one active site on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to from about one active site to about 10 active sites on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least about one active site, at least about two active sites, at least about three active sites, at least about four active sites, at least about fiveWSGR Docket No.63634-702.601 active sites, at least about six active sites, at least about seven active sites, at least about eight active sites, at least about nine active sites, at least about ten active sites, or more on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at most about ten active sites, at most about nine active sites, at most about eight active sites, at most about seven active sites, at most about six active sites, at most about five active sites, at most about four active sites, at most about three active sites, at most about two active sites, at most about one active site, or less on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to about one active site, about two active sites, about three active sites, about four active sites, about five active sites, about six active sites, about seven active sites, about eight active sites, about nine active sites, or about ten active sites on the enzyme.

[0261] In some embodiments, the amino acid sequence of the peptide binds to at least one non- active site location on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to from about one non-active site to about ten non-active site locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at least about one non-active site, at least about two non-active sites, at least about three non-active sites, at least about four non-active sites, at least about five non-active sites, at least about six non-active sites, at least about seven non-active sites, at least about eight non-active sites, at least about nine non-active sites, at least about ten non-active sites, or more locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to at most about ten non- active sites, at most about nine non-active sites, at most about eight non-active sites, at most about seven non-active sites, at most about six non-active sites, at most about five non-active sites, at most about four non-active sites, at most about three non-active sites, at most about two non-active sites, at most about one non-active site, or less locations on the enzyme. In some embodiments, the amino acid sequence of the peptide binds to about one non-active site, about two non-active sites, about three non-active sites, about four non-active sites, about five non- active sites, about six non-active sites, about seven non-active sites, about eight non-active sites, about nine non-active sites, or about ten non-active sites on the enzyme. Binding to at least one active site and / or at least one non-active site location on the enzyme can prevent the activity / function of the enzyme. In some embodiments, the amino acid sequence of the peptide inhibits the enzyme.

[0262] In some embodiments, the enzyme is a hydrolase enzyme. Non-limiting examples of hydrolase enzymes include esterases, lipases, phosphatases, glycosidases, peptidases, and nucleosidases. In some embodiments, the hydrolase enzyme is a lipase (e.g., a lipid hydrolase). Non-limiting examples of lipid hydrolases include pancreatic lipase, lysosomal lipase, acidWSGR Docket No.63634-702.601 ceramidase, lipoprotein lipase, gastric lipase, and lingual lipase. In some embodiments, the lipase is acid ceramidase. In some embodiments, the enzyme is a protease. Non-limiting examples of proteases include trypsin, chymotrypsin, elastase, papain, calpain, cathepsins, pepsin, rennin, thermolysin, and carboxypeptidase A. In some embodiments, the protease is a serine protease, a cysteine protein, an aspartic protease, or a metallo-protease. In some embodiments, the protease is a serine protease. In some embodiments, the serine protease is trypsin, chymotrypsin, or elastase. In some embodiments, the serine protease is trypsin. In some embodiments, the serine protease is chymotrypsin. In some embodiments, the serine protease is elastase. In some embodiments, the protease is a cysteine protease. In some embodiments, the cysteine protease is papain or a papain-like protease, caspase-1, calpain, or cathepsins. In some embodiments, the cysteine protease is papain or a papain-like protease. In some embodiments, the cysteine protease is caspase-1. In some embodiments, the cysteine protease is calpain. In some embodiments, the cysteine protease is a cathepsin protease. Non-limiting examples of cathepsins include cathepsin B, cathepsin H, cathepsin L, cathepsin C, cathepsin X, cathepsin V, cathepsin O, cathepsin K, cathepsin S, cathepsin E, and cathepsin W. In some embodiments, the protease is an aspartic protease. In some embodiments, the aspartic protease is pepsin or rennin. In some embodiments, the aspartic protease is pepsin. In some embodiments, the aspartic protease is rennin. In some embodiments, the protease is a metallo-protease. In some embodiments, the metallo-protease is thermolysin or carboxypeptidase A. In some embodiments, the metallo-protease is thermolysin. In some embodiments, the metalo-protease is carboxypeptidase A.

[0263] In some embodiments, a non-peptidal hydrophobic moiety is attached to the peptide. In some embodiments, the non-peptidal hydrophobic moiety is a C6-20alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C6alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C7alkyl group. In some embodiments, the non- peptidal hydrophobic moiety is a C8alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C9alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C10alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C11alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C12alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C13alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C14alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C15alkyl group. In some embodiments, the non- peptidal hydrophobic moiety is a C16alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C17alkyl group. In some embodiments, the non-peptidal hydrophobicWSGR Docket No.63634-702.601 moiety is a C18alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C19alkyl group. In some embodiments, the non-peptidal hydrophobic moiety is a C20alkyl group.

[0264] In some embodiments, the non-peptidal hydrophobic moiety is a lipid. In some embodiments, the lipid is fatty acyl group. Non-limiting examples of fatty acyl groups include arachidonoyl, behenoyl, butyryl, cerotoyl, decanoyl, docosenoyl, dodecanoyl, eleostearoyl, heptanoyl, heptatrienoyl, hexanoyl, icosanoyl, icosenoyl, lignoceroyl, linoleoyl, lipoyl, margaroyl, melissoyl, mycolyl, myristoleoyl, nervonoyl, nonanoyl, obtusiloyl, octadic-9-ynoyl, octadecenoyl, octanoyl, palmitoleoyl, palmitoyl, parinaroyl, stearoyl, tetradecanoyl, undecanoyl, and valeryl.

[0265] In some embodiments, the fatty acyl group is a short-chain acyl group. Non-limiting examples of short-chain acyl groups include formate, acetate, propionate, butyrate, isobutyrate, valerate, isovalerate, and 2-Methylbutanoate. In some embodiments, the short-chain fatty acyl group is formate. In some embodiments, the short-chain fatty acyl group is acetate. In some embodiments, the short-chain fatty acyl group is propionate. In some embodiments, the short- chain fatty acyl group is butyrate. In some embodiments, the short-chain fatty acyl group is isobutyrate. In some embodiments, the short-chain fatty acyl group is valerate. In some embodiments, the short-chain fatty acyl group is isovalerate. In some embodiments, the short- chain fatty acyl group is 2-Methylbutanoate. In some embodiments, the fatty acyl group is a medium-chain acyl group. Non-limiting examples of medium-chain acyl groups include hexanoate, octanoate, decanoate, caproic acid, caprylic acid, capric acid, lauric acid, and dodecanoate. In some embodiments, the medium-chain fatty acyl group is hexanoate. In some embodiments, the medium-chain fatty acyl group is octanoate. In some embodiments, the medium-chain fatty acyl group is decanoate. In some embodiments, the medium-chain fatty acyl group is caproic acid. In some embodiments, the medium-chain fatty acyl group is caprylic acid. In some embodiments, the medium-chain fatty acyl group is capric acid. In some embodiments, the medium-chain fatty acyl group is lauric acid. In some embodiments, the medium-chain fatty acyl group is dodecanoate. In some embodiments, the fatty acyl group is a long-chain fatty acyl group. Non-limiting examples of long-chain fatty acyl groups include myrisate, stearoyl, palmitoyl, arachidonoyl, oleate, palmitoleoyl, nervonoyl, linoleoyl, docosahexaenoic acid, and eicosapentaenoic acid. In some embodiments, the long-chain fatty acyl group is myrisate. In some embodiments, the long-chain fatty acyl group is stearoyl. In some embodiments, the long- chain fatty acyl group is palmitoyl. In some embodiments, the long-chain fatty acyl group is arachidonoyl. In some embodiments, the long-chain fatty acyl group is oleate. In some embodiments, the long-chain fatty acyl group is palmitoleoyl. In some embodiments, the long-WSGR Docket No.63634-702.601 chain fatty acyl group is nervonoyl. In some embodiments, the long-chain fatty acyl group is linoleoyl. In some embodiments, the long-chain fatty acyl group is docosahexaenoic acid. In some embodiments, the long-chain fatty acyl group is eicosapentaenoic acid.

[0266] In some embodiments, the non-peptidal hydrophobic moiety is a short-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is a medium-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is a long-chain fatty acyl group. In some embodiments, the non-peptidal hydrophobic moiety is palmitoyl.

[0267] Alternatively, in some embodiments, the peptide is not attached to a non-peptidal hydrophobic moiety.

[0268] In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the N-terminal and / or C-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the N-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to the peptide at the C-terminal of the peptide. In some embodiments, the non-peptidal hydrophobic moiety is attached to a non- terminal amino acid residue.

[0269] In some embodiments, the peptide is linear. In some embodiments, the peptide is circular. In some embodiments, the peptide is a cyclic peptide. In some embodiments, the peptide has about two portions. In some embodiments, the two portions are a first portion and a second portion. In some embodiments, the first portion is linear and the second portion is circular. In some embodiments, the first portion is circular and the second portion is linear. In some embodiment, the peptide has three portions. In some embodiments, the three portions are a first portion, a second portion, and a third portion. In some embodiments, the first portion is linear, the second portion is circular, and the third portion is linear. In some embodiments, the first portion is circular, the second portion is linear, and the third portion is circular.

[0270] In some embodiments, the peptide has at least one disulfide bond. In some embodiments, the peptide has from about one disulfide bond to about 20 disulfide bonds. In some embodiments, the peptide has at least about one disulfide bond, at least about two disulfide bonds, at least about three disulfide bonds, at least about four disulfide bonds, at least about five disulfide bonds, at least about six disulfide bonds, at least about seven disulfide bonds, at least about eight disulfide bonds, at least about nine disulfide bonds, at least about ten disulfide bonds, at least about 11 disulfide bonds, at least about 12 disulfide bonds, at least about 13 disulfide bonds, at least about 14 disulfide bonds, at least about 15 disulfide bonds, at least about 16 disulfide bonds, at least about 17 disulfide bonds, at least about 18 disulfide bonds, at least about 19 disulfide bonds, at least about 20 disulfide bonds, or more.WSGR Docket No.63634-702.601

[0271] In some embodiments, the peptide has at most about 20 disulfide bonds, at most about 19 disulfide bonds, at most about 18 disulfide bonds, at most about 17 disulfide bonds, at most about 16 disulfide bonds, at most about 15 disulfide bonds, at most about 14 disulfide bonds, at most about 13 disulfide bonds, at most about 12 disulfide bonds, at most about 11 disulfide bonds, at most about ten disulfide bonds, at most about nine disulfide bonds, at most about eight disulfide bonds, at most about seven disulfide bonds, at most about six disulfide bonds, at most about five disulfide bonds, at most about four disulfide bonds, at most about three disulfide bonds, at most about two disulfide bonds, at most about one disulfide bond, or less.

[0272] In some embodiments, the peptide has about one disulfide bond, about two disulfide bonds, about three disulfide bonds, about four disulfide bonds, about five disulfide bonds, about six disulfide bonds, about seven disulfide bonds, about eight disulfide bonds, about nine disulfide bonds, about ten disulfide bonds, about 11 disulfide bonds, about 12 disulfide bonds, about 13 disulfide bonds, about 14 disulfide bonds, about 15 disulfide bonds, about 16 disulfide bonds, about 17 disulfide bonds, about 18 disulfide bonds, about 19 disulfide bonds, or about 20 disulfide bonds.

[0273] In some embodiments, the at least one disulfide bond is an internal disulfide bond. In some embodiments, the at least one disulfide bond is an external disulfide bond. In some embodiments, the peptide has two or more disulfide bonds. In some embodiments, the two or more disulfide bonds are internal disulfide bonds and / or external disulfide bonds.

[0274] In some embodiments, the peptide is positively charged at physiological pH. In some embodiments, the peptide is negatively charged at physiological pH. In some embodiments, the peptide has a neutral charge at physiological pH. In some embodiments, the physiological pH is between about 6 to about 6.5, between about 6.5 to about 7, between about 7 to about 7.5, or between about 7.5 to about 8. In some embodiments, the physiological pH is at least about 6, at least about 6.25, at least about 6.5, at least about 6.75, at least about 7, at least about 7.25, at least about 7.5, at least about 7.75, at least about 8, or more. In some embodiments, the physiological pH is at most about 8, at most about 7.75, at most about 7.5, at most about 7.25, at most about 7, at most about 6.75, at most about 6.5, at most about 6.25, at most about 6, or less. In some embodiments, the physiological pH is about 6, about 6.25, about 6.5, about 6.75, about 7, about 7.25, about 7.5, about 7.75, or about 8.

[0275] In some embodiments, the peptide is positively charged at acidic pH. In some embodiments, the peptide is negatively charged at acidic pH. In some embodiments, the peptide has a neutral charge at acidic pH. In some embodiments, the acidic pH is between about 1 to about 1.5, between about 1.5 to about 2, between about 2 to about 2.5, between about 2.5 toWSGR Docket No.63634-702.601 about 3, between about 3 to about 3.5, between about 3.5 to about 4, between about 4 to about 4.5, between about 4.5 to about 5, between about 5 to about 5.5, or between about 5.5 to about 6. In some embodiments, the acidic pH is at least about 1, at least about 1.5, at least about 2, at least about 2.5, at least about 3, at least about 3.5, at least about 4, at least about 4.5, at least about 5, at least about 5.5, at least about 6, or more. In some embodiments, the acidic pH is at most about 6, at most about 5.5, at most about 5, at most about 4.5, at most about 4, at most about 3.5, at most about 3, at most about 2.5, at most about 2, at most about 1.5, at most about 1, or less. In some embodiments, the acidic pH is about 1, about 1.5, about 2, about 2.5, about 3, about 3.5, about 4, about 4.5, about 5, about 5.5, or about 6.

[0276] In some embodiments, the peptide is positively charged at basic pH. In some embodiments, the peptide is negatively charged at basic pH. In some embodiments, the peptide has a neutral charge at basic pH. In some embodiments, the basic pH is between about 8 to about 8.5, between about 8.5 to about 9, between about 9 to about 9.5, between about 9.5 to about 10, between about 10 to about 10.5, between about 10.5 to about 11, between about 11 to about 11.5, between about 11.5 to about 12, between about 12 to about 12.5, between about 12.5 to about 13, between about 13 to about 13.5, or between 13.5 to about 14. In some embodiments, the basic pH is at least about 8, at least about 8.5, at least about 9, at least about 9.5, at least about 10, at least about 10.5, at least about 11, at least about 11.5, at least about 12, at least about 12.5, at least about 13, at least about 13.5, at least about 14, or more. In some embodiments, the basic pH is at most about 14, at most about 13.5, at most about 13, at most about 12.5, at most about 12, at most about 11.5, at most about 11, at most about 10.5, at most about 10, at most about 9.5, at most about 9, at most about 8.5, at most about 8, or less. In some embodiments, the basic pH is about 8, about 8.5, about 9, about 9.5, about 10, about 10.5, about 11, about 11.5, about 12, about 12.5, about 13, about 13.5, or about 14.

[0277] In some embodiments, the peptide has from about one amino acid residue to about 200 amino acids residues. In some embodiments, the peptide has at least about one amino acid residue, at least about two amino acid residues, at least about three amino acid residues, at least about four amino acid residues, at least about five amino acid residues, at least about six amino acid residues, at least about seven amino acid residues, at least about eight amino acid residues, at least about nine amino acid residues, at least about ten amino acid residues, at least about 11 amino acid residues, at least about 12 amino acid residues, at least about 13 amino acid residues, at least about 14 amino acid residues, at least about 15 amino acid residues, at least about 16 amino acid residues, at least about 17 amino acid residues, at least about 18 amino acid residues, at least about 19 amino acid residues, at least about 20 amino acid residues, at least about 25WSGR Docket No.63634-702.601 amino acid residues, at least about 30 amino acid residues, at least about 35 amino acid residues, at least about 40 amino acid residues, at least about 45 amino acid residues, at least about 50 amino acid residues, at least about 55 amino acid residues, at least about 60 amino acid residues, at least about 65 amino acid residues, at least about 70 amino acid residues, at least about 75 amino acid residues, at least about 80 amino acid residues, at least about 85 amino acid residues, at least about 90 amino acid residues, at least about 95 amino acid residues, at least about 100 amino acid residues, at least about 105 amino acid residues, at least about 110 amino acid residues, at least about 115 amino acid residues, at least about 120 amino acid residues, at least about 125 amino acid residues, at least about 130 amino acid residues, at least about 135 amino acid residues, at least about 140 amino acid residues, at least about 145 amino acid residues, at least about 150 amino acid residues, at least about 155 amino acid residues, at least about 160 amino acid residues, at least about 165 amino acid residues, at least about 170 amino acid residues, at least about 175 amino acid residues, at least about 180 amino acid residues, at least about 185 amino acid residues, at least about 190 amino acid residues, at least about 195 amino acid residues, at least about 200 amino acid residues, or more.

[0278] In some embodiments, the peptide has about 10 amino acids. In some embodiments, the peptide has about 12 amino acid residues. In some embodiments, the peptide has about 14 amino acid residues. In some embodiments, the peptide has about 19 amino acid residues. In some embodiments, the peptide has about 20 amino acid residues. In some embodiments, the peptide has about 50 amino acid residues. In some embodiments, the peptide has about 100 amino acid residues.

[0279] In some embodiments, the peptide has no more than about 200 amino acid residues, no more than about 195 amino acid residues, no more than about 190 amino acid residues, no more than about 185 amino acid residues, no more than about 180 amino acid residues, no more than about 175 amino acid residues, no more than about 170 amino acid residues, no more than about 165 amino acid residues, no more than about 160 amino acid residues, no more than about 155 amino acid residues, no more than about 150 amino acid residues, no more than about 145 amino acid residues, no more than about 140 amino acid residues, no more than about 135 amino acid residues, no more than about 130 amino acid residues, no more than about 125 amino acid residues, no more than about 120 amino acid residues, no more than about 115 amino acid residues, no more than about 110 amino acid residues, no more than about 105 amino acid residues, no more than about 100 amino acid residues, no more than about 95 amino acid residues, no more than about 90 amino acid residues, no more than about 85 amino acid residues, no more than about 80 amino acid residues, no more than about 75 amino acidWSGR Docket No.63634-702.601 residues, no more than about 70 amino acid residues, no more than about 65 amino acid residues, no more than about 60 amino acid residues, no more than about 55 amino acid residues, no more than about 50 amino acid residues, no more than about 45 amino acid residues, no more than about 40 amino acid residues, no more than about 35 amino acid residues, no more than about 30 amino acid residues, no more than about 25 amino acid residues, no more than about 20 amino acid residues, no more than about 19 amino acid residues, no more than about 18 amino acid residues, no more than about 17 amino acid residues, no more than about 16 amino acid residues, no more than about 15 amino acid residues, no more than about 14 amino acid residues, no more than about 13 amino acid residues, no more than about 12 amino acid residues, no more than about 11 amino acid residues, no more than about ten amino acid residues, no more than about nine amino acid residues, no more than about eight amino acid residues, no more than about seven amino acid residues, no more than about six amino acid residues, no more than about five amino acid residues, no more than about four amino acid residues, no more than about three amino acid residues, no more than about two amino acid residues, or no more than about one amino acid residue.

[0280] In some embodiments, the peptide has no more than about 20 amino acid residues. In some embodiments, the peptide has no more than about 50 amino acid residues. In some embodiments, the peptide has no more than about 100 amino acid residues.

[0281] In some embodiments, the peptide has about one amino acid residue, about two amino acid residues, about three amino acid residues, about four amino acid residues, about five amino acid residues, about six amino acid residues, about seven amino acid residues, about eight amino acid residues, about nine amino acid residues, about ten amino acid residues, about 11 amino acid residues, about 12 amino acid residues, about 13 amino acid residues, about 14 amino acid residues, about 15 amino acid residues, about 16 amino acid residues, about 17 amino acid residues, about 18 amino acid residues, about 19 amino acid residues, about 20 amino acid residues, about 25 amino acid residues, about 30 amino acid residues, about 35 amino acid residues, about 40 amino acid residues, about 45 amino acid residues, about 50 amino acid residues, about 55 amino acid residues, about 60 amino acid residues, about 65 amino acid residues, about 70 amino acid residues, about 75 amino acid residues, about 80 amino acid residues, about 85 amino acid residues, about 90 amino acid residues, about 95 amino acid residues, about 100 amino acid residues, about 105 amino acid residues, about 110 amino acid residues, about 115 amino acid residues, about 120 amino acid residues, about 125 amino acid residues, about 130 amino acid residues, about 135 amino acid residues, about 140 amino acidWSGR Docket No.63634-702.601 residues, about 145 amino acid residues, about 150 amino acid residues, about 155 amino acid residues, about 160 amino acid residues, about 165 amino acid residues, about 170 amino acid residues, about 175 amino acid residues, about 180 amino acid residues, about 185 amino acid residues, about 190 amino acid residues, about 195 amino acid residues, or about 200 amino acid residues.

[0282] In some embodiments, the peptide has at least about 10 amino acid residues. In some embodiments, the peptide has at least 12 amino acid residues. In some embodiments, the peptide has at least about 14 amino acid residues. In some embodiments, the peptide has at least about 19 amino acid residues.

[0283] In some embodiments, the amino acid sequence has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the amino acid sequence has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1).

[0284] In some embodiments, X in XQIVGGTICT (SEQ ID NO: 1) is an amino acid residue with an ionizable side chain. In some embodiments, X is a polar amino acid residue. Non- limiting examples of polar amino acid residues include tyrosine, serine, threonine, asparagine, glutamine, and cysteine. In some embodiments, X is tyrosine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X is asparagine. In some embodiments, X is glutamine. In some embodiments, X is cysteine. In some embodiments, X is a basic amino acid residue. Non-limiting examples of basic amino acid residues include lysine, arginine, and histidine. In some embodiments, X is lysine. In some embodiments, X is arginine. In some embodiments, X is histidine.

[0285] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to XQIVGGTICT (SEQ ID NO: 1).

[0286] In some embodiments, the peptide has at least about 50%, at least about 55%, at leastWSGR Docket No.63634-702.601 about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KQIVGGTICT (SEQ ID NO: 2). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KQIVGGTICT (SEQ ID NO: 2).

[0287] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to CREQIVGGTICT (SEQ ID NO: 3). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to CREQIVGGTICT (SEQ ID NO: 3).

[0288] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KREQIVGGTICT (SEQ ID NO: 4). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KREQIVGGTICT (SEQ ID NO: 4).

[0289] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KRAREQIVGGTICT (SEQ ID NO: 5).

[0290] In some embodiments, the peptide has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to KLCTLLRAREQIVGGTICT (SEQ ID NO: 6). In some embodiments, the peptide has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to KLCTLLRAREQIVGGTICTWSGR Docket No.63634-702.601 (SEQ ID NO: 6).

[0291] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- XQIVGGTICT (SEQ ID NO: 32). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-XQIVGGTICT (SEQ ID NO: 32).

[0292] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KQIVGGTICT (SEQ ID NO: 33). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KQIVGGTICT (SEQ ID NO: 33).

[0293] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- CREQIVGGTICT (SEQ ID NO: 34). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-CREQIVGGTICT (SEQ ID NO: 34).

[0294] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KREQIVGGTICT (SEQ ID NO: 11). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KREQIVGGTICT (SEQ ID NO: 11).

[0295] In some embodiments, the composition has at least about 50%, at least about 55%, atWSGR Docket No.63634-702.601 least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KRAREQIVGGTICT (SEQ ID NO: 12). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KRAREQIVGGTICT (SEQ ID NO: 12).

[0296] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (fatty acyl group)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 13). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (fatty acyl group)-KLCTLLRAREQIVGGTICT (SEQ ID NO: 13).

[0297] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to palmitoyl-XQIVGGTICT (SEQ ID NO: 35).

[0298] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 36).

[0299] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least aboutWSGR Docket No.63634-702.601 99%, at least about 99.5%, or at least about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37). In some embodiments, the composition has about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 98%, about 99%, about 99.5%, or about 100% sequence identity to (palmitoyl)- KQIVGGTICT (SEQ ID NO: 37).

[0300] In some embodiments, the composition has at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least abo...

Claims

WSGR Docket No.63634-702.601 CLAIMS WHAT IS CLAIMED IS:

1. A composition comprising a peptide, wherein the peptide comprises a region that has at least 90% identity to a subsequence of SEQ ID NO:7, wherein the subsequence is at least 5 contiguous amino acid residues of SEQ ID NO:7, wherein the peptide comprises a disulfide bond.

2. The composition of claim 1, wherein the subsequence is at least 6 contiguous amino acid residues of SEQ ID NO:

7.

3. The composition of claim 1, wherein the subsequence is at least 8 contiguous amino acid residues of SEQ ID NO:

7.

4. The composition of claim 1, wherein the subsequence is at least 10 contiguous amino acid residues of SEQ ID NO:

7.

5. The composition of claim 1, wherein the peptide has at least 90% identity to t he subsequence, wherein the subsequence is at least 10 contiguous amino acid residues of SEQ ID NO:

7.

6. The composition of claim 1, wherein the peptide inhibits the acid ceramidase by binding the acid ceramidase.

7. The composition of claim 1, further comprising a non-peptidal hydrophobic moiety attached to the peptide.

8. The composition of claim 7, wherein the non-peptidal hydrophobic moiety comprises a C6-20alkyl group.

9. The composition of claim 7, wherein the non-peptidal hydrophobic moiety is a fatty acyl group.

10. The composition of claim 7, wherein the non-peptidal hydrophobic moiety is attached to the peptide at a N-terminus of the peptide.

11. The composition of claim 7, wherein the non-peptidal hydrophobic moiety is palmitoyl.

12. The composition of claim 1, wherein the peptide is a cyclic peptide.

13. The composition of claim 1, wherein the peptide has an amino acid sequence that has at least 90% identity to XQIVGGTICT (SEQ ID NO: 1), wherein X is an amino acid residue with an ionizable side chain.

14. The composition of claim 13, wherein X is lysine or glutamine.

15. The composition of claim 14, wherein the peptide is KQIVGGTICT (SEQ ID NO: 2).

16. The composition of claim 1, wherein the peptide is CREQIVGGTICT (SEQ ID NO: 3).WSGR Docket No.63634-702.601 17. The composition of claim 1, wherein the peptide is KREQIVGGTICT (SEQ ID NO: 4).

18. The composition of claim 1, wherein the peptide is KRAREQIVGGTICT (SEQ ID NO: 5).

19. The composition of claim 1, wherein the peptide is KLCTLLRAREQIVGGTICT (SEQ ID NO: 6).

20. The composition of claim 1, wherein the composition is (palmitoyl)-KQIVGGTICT (SEQ ID NO: 36).

21. The composition of claim 1, wherein the composition is (palmitoyl)-CREQIVGGTICT (SEQ ID NO: 37).

22. The composition of claim 1, wherein the composition is (palmitoyl)-KREQIVGGTICT (SEQ ID NO: 19).

23. The composition of claim 1, wherein the composition is (palmitoyl)- KRAREQIVGGTICT (SEQ ID NO: 20).

24. The composition of claim 1, wherein the composition is (palmitoyl)- KLCTLLRAREQIVGGTICT (SEQ ID NO: 21).

25. The composition of claim 1, further comprising a solubility-enhancing agent.

26. The composition of claim 25, wherein the solubility-enhancing agent comprises polyethylene glycol (PEG).

27. The composition of claim 25, wherein the solubility-enhancing agent comprises an amphiphilic copolymer.

28. The composition of claim 27, wherein the amphiphilic copolymer comprises any one of polycaprolactone, polyvinyl acetate, and polyethylene.

Images