Capsid polypeptides and methods of use thereof
Mutated capsid polypeptides enhance biodistribution and transduction efficiency in CNS, muscle, and cardiac muscle, addressing limitations of existing AAV vectors for targeted gene delivery.
Patent Information
- Application Number
- PCT/US2025/014959
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-10-14
- Filing Date
- 2025-02-07
- Publication Date
- 2025-08-14
AI Technical Summary
Existing dependoparvovirus vectors, such as AAVs, face challenges in achieving efficient biodistribution and transduction in specific tissues like the central nervous system, muscle, and cardiac muscle, limiting their therapeutic efficacy.
Development of capsid polypeptides with specific mutations, such as those at positions corresponding to Q579, Q592, T593, W595, V596, and N598 of the VP1 capsid polypeptide, enhancing biodistribution and transduction efficiency in CNS, muscle, and cardiac muscle.
The mutated capsid polypeptides improve biodistribution and transduction efficiency in CNS, muscle, and cardiac muscle, leading to more effective gene delivery and therapeutic outcomes.
Smart Images

Figure IMGF000010_0001 
Figure IMGF000060_0001 
Figure IMGF000061_0001
Abstract
Description
CAPSID POLYPEPTIDES AND METHODS OF USE THEREOF1 . CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the priority benefit of U.S. provisional application no. 63 / 551 ,418, filed February 8, 2024, and U S provisional application no. 63 / 707,055, filed October 14, 2024, the contents of each of which are incorporated herein in their entireties by reference thereto.2. SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML Sequence Listing, created on February 6, 2025, is named DYN-005WO_SL.xml and is 97,346 bytes in size.3. BACKGROUND
[0003] Dependoparvoviruses, e.g., adeno-associated dependoparvoviruses, e.g., adeno-associated viruses (AAVs), are of interest as vectors for delivering various payloads to cells, including in human subjects.4. SUMMARY
[0004] The present disclosure relates, in part, to improved dependoparvovirus capsid polypeptides, such as VP1 , VP2 and / or VP3 capsid polypeptides, methods of producing a dependoparvovirus comprising capsid polypeptides, compositions for use in the same, as well as viral particles produced by the same. In certain aspects, the present disclosure relates to viral particles comprising the improved dependoparvovirus capsid polypeptides, with increased central nervous system (CNS) biodistribution and / or transduction as compared to viral particles, e g., without the mutations in the improved dependoparvovirus capsid polypeptides. In certain aspects, the present disclosure relates to viral particles comprising the improved dependoparvovirus capsid polypeptides, with increased muscle biodistribution and / or transduction as compared to viral particles, e g., without the mutations in the improved dependoparvovirus capsid polypeptides. In certain aspects, the present disclosure relates to viral particles comprising the improved dependoparvovirus capsid polypeptides, with increased skeletal muscle biodistribution and / or transduction as compared to viral particles, e.g., without the mutations in the improved dependoparvovirus capsid polypeptides. In certain aspects, the present disclosure relates to viral particles comprising the improved dependoparvovirus capsid polypeptides, with increased cardiac muscle biodistribution and / or transduction as compared to viral particles, e.g., without the mutations in the improved dependoparvovirus capsid polypeptides.
[0005] The present disclosure provides a capsid polypeptide comprising a threonine at a position corresponding to Q579 of the VP1 capsid polypeptide of SEQ ID NOU , a valine at a position corresponding to Q592 of the VP1 capsid polypeptide of SEQ ID NOU , an alanine at a position corresponding to T593 of the VP1 capsid polypeptide of SEQ ID NOU, an alanine at a position corresponding to W595 of the VP1 capsid polypeptide of SEQ ID NO: 1 , a leucine at a position corresponding to V596 of the VP1 capsid polypeptide of SEQ ID NOU , a serine at a position corresponding to N598 of the VP1 capsid polypeptide of SEQ ID NOU , and an alanine at a position corresponding to 1601 of the VP1 capsid polypeptide of SEQ ID NOU.
[0006] In some embodiments, the capsid polypeptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to a VP1 polypeptide of SEQ ID NO: 12 or to a VP2 or VP3 portion thereof. In some embodiments, the percentage sequence identity is calculated excluding any targeting peptide sequence insertion(s) in the capsid polypeptide sequence relative to the reference polypeptide sequence. In other embodiments, the percentage sequence identity is calculated including any targeting peptide sequence insertion(s) in the capsid polypeptide sequence relative to the reference polypeptide sequence.
[0007] An exemplary VP1 amino acid sequence of the disclosure is set forth in SEQ ID NO:12. Additional exemplary capsid polypeptides are disclosed in Section 6.2 and numbered embodiments 1 to 130
[0008] The present disclosure further provides a nucleic acid comprising a nucleotide sequence encoding a capsid polypeptide as provided for herein, e.g., a capsid polypeptide disclosed in Section 6 2 or any one of numbered embodiments 1 to 130. In some embodiments, the nucleic acid molecule comprises a nucleotide sequence of SEQ ID NO:13, a fragment thereof (e.g., a fragment thereof encoding a VP2 or VP3 polypeptide), or a variant of any of the foregoing having at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity thereto. In some embodiments, the percentage sequence identity is calculated excluding any nucleotide sequence(s) encoding targeting peptide sequence insertion(s). In some embodiments, the percentage sequence identity is calculated including any nucleotide sequence(s) encoding targeting peptide sequence insertion(s) relative to the polypeptide encoded by the nucleotide sequence of SEQ ID NO:13. In some embodiments, the nucleic acid is a vector, e.g., a plasmid. Exemplary nucleic acids are disclosed in Section 6.2 and numbered embodiments 131 to 150
[0009] The present disclosure further provides a dependoparvovirus particle comprising a capsid polypeptide and / or a nucleic acid described herein, e.g., a capsid polypeptide disclosed in Section 6.2 or any one of numbered embodiments 1 to 130 and / or a nucleic acid described herein, e.g., a nucleic acid disclosed in Section 6 2 or any one of numbered embodiments 131 to 150 or a nucleic acid comprising a transgene / payload as disclosed in Section 6.6.1. In some embodiments, the dependoparvovirus is an adeno-associated dependoparvovirus (AAV). In some embodiments, the AAV is AAV9, e.g., a variant AAV9. In some embodiments, the AAV comprises a capsid polypeptide comprising the amino acid sequence of SEQ ID NO:12 or the VP2 or VP3 portion thereof and a nucleic acid comprising AAV inverted terminal repeat sequences (ITRs) and a heterologous transgene operably linked to one or more regulatory elements (e g., a promoter), e.g., for delivery of the transgene to a cell (e.g., human cell) when used for gene therapy Exemplary virus particles are disclosed in Section 6 3 and numbered embodiments 151 to 188. In some embodiments, the virus particles have one or more characteristics disclosed in Section 6.4 and numbered embodiments 151 to 188
[0010] In some embodiments, the disclosure is directed, in part, to a cell, cell-free system, or other translation system comprising a nucleic acid or vector described herein, e.g., comprising a sequence encoding a capsid polypeptide having one or more mutations described herein, for example a capsid polypeptide disclosed in Section 6.2 or any one of numbered embodiments 1 to 130. In some embodiments, the cell, cell-free system, or other translation system comprises a dependoparvovirus particle described herein, e.g., wherein the particle comprises a nucleic acid comprising a sequenceencoding a capsid polypeptide, e g., a capsid polypeptide disclosed in Section 6.2 or any one of numbered embodiments 1 to 130 and / or a nucleic acid described herein, e.g., a nucleic acid disclosed in Section 6.2 or any one of numbered embodiments 131 to 150 or a nucleic acid comprising a transgene as disclosed in Section 6.6.1 Exemplary cells, cell-free and other translation systems and their use to produce dependoparvovirus particles are disclosed in Section 6.5 and in numbered embodiments 1291 to 1301 and 1305 to 1316.
[0011] The present disclosure further provides methods of using a dependoparvovirus disclosed herein, e.g., for delivering a payload to a cell or treating a disease or condition in a subject. The methods typically comprise contacting the cell or administering to the subject a dependoparvovirus particle described herein in an amount effective to treat the disease or condition Exemplary methods are disclosed in Section 6.6 and numbered embodiments 189 to 1290. The dependoparvovirus particles may be in the form of a composition, e.g., a pharmaceutical composition comprising the dependoparvovirus particles and a pharmaceutically acceptable carrier or excipient, for example as described in Section 6.6.2 and numbered embodiment 1302. The disclosure further provides compositions disclosed herein for use in treating a disease or condition in a subject and for use in the manufacture of a medicament for use in treating a disease or condition in a subject. Exemplary compositions for use are described in numbered embodiments 1303 and 1304
[0012] Additional features, advantages and applications of the capsid polypeptides, nucleic acids, dependoparvovirus particles of the disclosure and methods of their production and use are more particularly described below.5. BRIEF DESCRIPTION OF THE DRAWINGS
[0013] FIGS. 1 A-1C. Illustration of exemplary AAV serotype alignments. Amino acids that are present only in VP1 polypeptides are in normal text; amino acids that are present only in VP1 and VP2 polypeptides are in bold; amino acids that are present in VP1 , VP2 and VP3 polypeptides are underlined. FIGs. 1A-1C disclose SEQ ID NOS: 5, 3, 1 , 7 and 9, respectively, in order of appearance.
[0014] FIG. 2: Transduction rates for V1 relative to VAR-1 in cell types of the prefrontal cortex, obtained via single nuclei RNA sequencing and analysis (Example 1).
[0015] FIG. 3: Transduction rates for V1 relative to VAR-1 in cell types of the motor cortex, obtained via single nuclei RNA sequencing and analysis (Example 1 )
[0016] FIG. 4: T ransduction rates for V1 relative to VAR-1 in cell types of the putamen, obtained via single nuclei RNA sequencing and analysis (Example 1 )
[0017] FIGS. 5A-5B: Payload gene expression normalized to endogenous RPP30 expression (FIG. 5A) and vector genome biodistribution (FIG. 5B) in NHPs (Example 2).
[0018] FIGS. 6A-6H: Tissue immunofluorescence images and quantified values of transduction in various NHP tissues FIG. 6A shows V1 distribution and tissue-specific marker staining in muscle tissues. FIG. 6B shows V1 distribution and tissue-specific marker staining in brain tissues. FIG. 6C shows the percentage of cardiomyocyte nuclei transduced FIG 6D shows the percentage of all nuclei transduced in cardiac muscle tissues. FIG. 6E shows the percentage of myofibers transduced. FIG. 6F shows the percentage of all nuclei transduced in skeletal muscle tissues. FIG. 6G shows the percentage of cellstransduced in brain tissues. FIG. 6H shows the percentage of Fox3+ neurons transduced in brain tissues. (Example 2).6. DETAILED DESCRIPTION6.1. Definitions
[0019] Unless otherwise defined herein, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure. In case of conflict, the present specification, including definitions, will control. Generally, nomenclature used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics, analytical chemistry, synthetic organic chemistry, medicinal and pharmaceutical chemistry, and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art Enzymatic reactions and purification techniques are performed according to manufacturer’s specifications, as commonly accomplished in the art or as described herein. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Throughout this specification and embodiments, the words “have” and “comprise,” or variations such as “has,” “having,” “comprises,” or “comprising,” will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers All publications and other references mentioned herein are incorporated by reference in their entirety. Although a number of documents are cited herein, this citation does not constitute an admission that any of these documents forms part of the common general knowledge in the art.
[0020] A, An, The: As used herein, the singular forms “a,” “an” and “the” include plural referents unless the context clearly dictates otherwise
[0021] About, Approximately: As used herein, the terms “about” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 15 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values. Any disclosure herein of a value preceded by the term “about” or “approximately” is also a disclosure of the value per se. For example, disclosure of “about 10 pg / ml” is a disclosure of the value “10 pg / ml.”
[0022] CNS: As used herein, “CNS” means one or more regions of the central nervous system. In embodiments, the CNS includes one or more of: brain and spinal cord.
[0023] Corresponds to: As used herein, the term “corresponds to” as used in reference to a position in a sequence, such as an amino acid or nucleic acid sequence, can be used in reference to an entire capsid polypeptide or polynucleotide sequence, such as the full-length sequence of the capsid polypeptide that comprises a VP1 , VP2, and VP3 polypeptide, or a nucleic acid molecule encoding the same In some embodiments, the term “corresponds to” can be used in reference to a region or domain of the capsid polypeptide. For example, a position that corresponds to a position in the VP1 section of the reference capsid polypeptide can correspond to the VP1 portion of the polypeptide of the variant capsid polypeptide. Thus, when aligning the two sequences to determine whether a positioncorresponds to another position the full-length polypeptide can be used or domains (regions) can be used to determine whether a position corresponds to a specific position. In some embodiments, the region is the VP1 polypeptide. In some embodiments, the region is the VP2 polypeptide. In some embodiments, the region is the VP3 polypeptide. In some embodiments, when the reference polypeptide is the wildtype sequence (e.g., full-length or region) of a certain serotype of AAV, the variant polypeptide can be of the same serotype with a mutation made at such corresponding position as compared to the reference sequence (e.g., full-length or region). In some embodiments, the variant capsid polypeptide is a different serotype as compared to the reference sequence.
[0024] Dependoparvovirus capsid: As used herein, the term “dependoparvovirus capsid” refers to an assembled viral capsid comprising dependoparvovirus polypeptides In some embodiments, a dependoparvovirus capsid is a functional dependoparvovirus capsid, e.g., is fully folded and / or assembled, is competent to infect a target cell, or remains stable (e.g., folded / assembled and / or competent to infect a target cell) for at least a threshold time.
[0025] Dependoparvovirus particle: As used herein, the term “dependoparvovirus particle” refers to an assembled viral capsid comprising dependoparvovirus polypeptides and a packaged nucleic acid, e.g., comprising a payload, one or more components of a dependoparvovirus genome (e.g., a whole dependoparvovirus genome), or both In some embodiments, a dependoparvovirus particle is a functional dependoparvovirus particle, e.g., comprises a desired payload, is fully folded and / or assembled, is competent to infect a target cell, or remains stable (e.g., folded / assembled and / or competent to infect a target cell) for at least a threshold time.
[0026] Dependoparvovirus X particle / capsid: As used herein, the term “dependoparvovirus X particle / capsid” refers to a dependoparvovirus particle / capsid comprising at least one polypeptide or polypeptide encoding nucleic acid sequence derived from a naturally occurring dependoparvovirus X species or serotype. For example, a dependoparvovirus B particle refers to a dependoparvovirus particle comprising at least one polypeptide or polypeptide encoding nucleic acid sequence derived from a naturally occurring dependoparvovirus B sequence Derived from, as used in this context, means having at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to the sequence in question. Correspondingly, an AAVX particle / capsid, as used herein, refers to an AAV particle / capsid comprising at least one polypeptide or polypeptide encoding nucleic acid sequence derived from a naturally occurring AAV X serotype For example, an AAV9 particle refers to an AAV particle comprising at least one polypeptide or polypeptide encoding nucleic acid sequence derived from a naturally occurring AAV9 sequence. Sometimes, a dependoparvovirus X capsid is referred to as “Wild Type” or “wt” when such capsid comprises capsid polypeptides from a specified sequence identifier associated with such dependoparvovirus X capsid. Thus, for example, the terms wild-type AAV9 capsid or wtAAV9 capsid (or simply wtAAV9) are used interchangeably and refer to a capsid that comprises capsid polypeptides of SEQ ID NO:1 (e.g., a VP1 capsid of SEQ ID NO:1 and VP2 and VP3 portions thereof).
[0027] Edit Distance: Sequences disclosed herein may be described in terms of “edit distance.” The minimum number of sequence edits, i.e. , additions, substitutions, or deletions of a single amino acid (for amino acid sequence) or a single nucleotide (for nucleotide sequences), which change one sequence into another sequence is the edit distance between the two sequences. The term “edit distance” is often used interchangeably with the term “Levenshtein distance.”
[0028] Exogenous: As used herein, the term “exogenous” refers to a feature, sequence, or component present in a circumstance (e.g., in a nucleic acid, polypeptide, or cell) that does not naturally occur in said circumstance. For example, a nucleic acid sequence encoding a polypeptide can comprise an exogenous codon (e.g., codon encoding for an amino acid that does not naturally occur in that position, for example in a reference sequence), such as provided for herein. Use of the term exogenous in this fashion means that the codon in question at this position does not occur naturally, e.g., is not present in AAV9, e.g., is not present in SEQ ID NOU . In some embodiments, the codon replaces an endogenous codon. In some embodiments, the exogenous codon is inserted into the nucleic acid sequence, for example, relative to a reference sequence. A person of skill will readily understand that a sequence (e.g., a codon) can be exogenous when provided in a particular sequence (e.g., that does not naturally comprise the codon at the site in question) but may not be exogenous in a second sequence (e.g., that does naturally comprise that particular codon at the site in question).
[0029] Functional: As used herein in reference to a polypeptide component of a dependoparvovirus capsid (e.g., Cap (e.g., VP1 , VP2, and / or VP3) or Rep), the term “functional” refers to a polypeptide which provides at least 50, 60, 70, 80, 90, or 100% of the activity of a naturally occurring version of that polypeptide component (e.g., when present in a host cell). For example, a functional VP1 polypeptide can stably fold and assemble into a dependoparvovirus capsid (e g., that is competent for packaging and / or secretion). As used herein in reference to a dependoparvovirus capsid or particle, “functional” refers to a capsid or particle comprising one or more of the following production characteristics: comprises a desired payload, is fully folded and / or assembled, is competent to infect a target cell, or remains stable (e.g., folded / assembled and / or competent to infect a target cell) for at least a threshold time
[0030] Mutation Difference: As used herein with respect to a polypeptide sequence, means a single amino acid mutation (e.g., substitution, insertion or deletion) present in a subject polypeptide sequence, relative to a reference polypeptide sequence. In various embodiments, the reference polypeptide sequence is a polypeptide of any one of SEQ ID NOU , SEQ ID NO:3, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11 , SEQ ID NO:12, or a VP2 or VP3 portion thereof. In a preferred embodiment, the reference polypeptide is a polypeptide of SEQ ID NOU . In various embodiments, the subject polypeptide is SEQ ID NOU 2 or a VP2 or VP3 portion thereof.
[0031] Mutation Set: As used herein, the term “mutation set” refers to the complete set of single amino acid mutations (substitutions, deletions and / or insertions) in a variant capsid polypeptide sequence (e.g., a polypeptide sequence of SEQ ID NOU 2 or a VP2 or VP3 portion thereof) relative to a reference sequence (e.g., a wild-type reference sequence). In some embodiments, the reference sequence is wildtype AAV9 VP1 capsid polypeptide (SEQ ID NOU) or a VP2 or VP3 portion thereof In some cases, part of the mutation set (i.e , more than one single amino acid mutation) is notated collectively, however, it will be understood that even when referred to in this way, the mutation set is a collection of single amino acid mutations For example, an insertion of amino acid 1 , 2, and 3 between amino acid N at position nn and amino acid W at position ww of a reference sequence may be notated as "Nnn_3aa_Www_123," and it will be understood that each of amino acids 1 , 2 and 3 represent separate single amino acid mutations within the mutation set In some embodiments, a variant capsid polypeptide of the disclosure comprises a mutation set not consisting solely of a mutation set present in a capsid polypeptide of SEQ ID NO: 12
[0032] Nucleic Acid: As used herein, in its broadest sense, the term “nucleic acid” refers to any compound and / or substance that is or can be incorporated into an oligonucleotide chain In some embodiments, a nucleic acid is a compound and / or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage. As will be clear from context, in some embodiments, “nucleic acid" refers to an individual nucleic acid monomer (e.g., a nucleotide and / or nucleoside); in some embodiments, “nucleic acid" refers to an oligonucleotide chain comprising individual nucleic acid monomers or a longer polynucleotide chain comprising many individual nucleic acid monomers. In some embodiments, a “nucleic acid" is or comprises RNA; in some embodiments, a “nucleic acid" is or comprises DNA. In some embodiments, a nucleic acid is, comprises, or consists of one or more natural nucleic acid residues. In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleic acid analogs In some embodiments, a nucleic acid is, comprises, or consists of one or more modified, synthetic, or non-naturally occurring nucleotides. In some embodiments, a nucleic acid analog differs from a nucleic acid in that it does not utilize a phosphodiester backbone. For example, in some embodiments, a nucleic acid is, comprises, or consists of one or more “peptide nucleic acids”, which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention. Alternatively or additionally, in some embodiments, a nucleic acid has one or more phosphorothioate and / or 5'-N-phosphoramidite linkages rather than phosphodiester bonds. In some embodiments, a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or protein. In some embodiments, a nucleic acid is partly or wholly single stranded; in some embodiments, a nucleic acid is partly or wholly double stranded.
[0033] Or: Unless indicated otherwise, an “or” conjunction is intended to be used in its correct sense as a Boolean logical operator, encompassing both the selection of features in the alternative (A or B, where the selection of A is mutually exclusive from B) and the selection of features in conjunction (A or B, where both A and B are selected) In some places in the text, the term “and / or” is used for the same purpose, which shall not be construed to imply that “or” is used with reference to mutually exclusive alternatives.
[0034] Percent Identity: Sequences disclosed herein may be described in terms of “percent identity” (% identity). For calculating percent identity between two amino acid sequences or two nucleic acid sequences, the two sequences to be compared are aligned using the EMBOSS Needle Pairwise Sequence Alignment software tool based on the Needleman and Wunsch algorithm (Needleman & Wunsch, 1970, J. Mol. Biol. 48(3):443-53) (available at www.ebi.ac.uk / Tools / psa / emboss_needle / ) using the following parameters: Matrix: BLOSUM62 (for amino acid sequences) or DNAfull (for DNA sequences); Gap Open: 10; Gap Extend: 0.5; End Gap Penalty: false; End Gap Open: 10; and End Gap Extend: 0.5. Percent identity is determined by dividing the number of amino acid or nucleotide matches in the alignment by the length of the alignment and multiplying by 100. For example, if an alignment of two amino acid sequences has 95 matching amino acids and an alignment length of 100 amino acids, the two sequences have 95% identity.
[0035] When calculating percent identity of two capsid polypeptides, one or both of which contain(s) one or more targeting peptide insertions, percent identity can be determined without removing the targeting peptide insertion sequence(s) from the capsid polypeptide sequence(s) or, alternatively, percent identity can be determined after removing the targeting peptide insertion sequence(s) from the capsid polypeptide sequence(s). For example, if a first capsid polypeptide has an identical sequence to asecond capsid polypeptide, except that the first capsid polypeptide has a 7-mer targeting peptide insertion, the two capsid polypeptides have less than 100% sequence identity when percent identity is determined without removal of the targeting peptide insertion sequence from the first capsid polypeptide sequence, whereas the two capsid polypeptides have 100% sequence identity when the targeting peptide insertion sequence is removed from the first capsid polypeptide sequence prior to calculating percent identity. References herein to percent identity of capsid polypeptides without mention of a targeting peptide refer to percent identity of the capsid polypeptides determined following removal of targeting polypeptide insertion sequence(s), if any, present in both capsid polypeptides, unless required otherwise by context. References herein to percent identity calculated “taking targeting peptide insertions into account” means that the percent identity is calculated without removal of targeting polypeptide insertion sequence(s), if any, present in both capsid polypeptides References herein to percent identity calculated “without taking targeting peptide insertions into account” means that the percent identity is calculated following removal of targeting polypeptide insertion sequence(s), if any, present in both capsid polypeptides.
[0036] PNS: as used herein, “PNS” means one or more regions of the peripheral nervous system that does not include the CNS. In embodiments, the PNS includes dorsal root ganglia. In embodiments, the PNS includes sensory neurons and motor neurons
[0037] Polypeptide, peptide, and protein: The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
[0038] Targeting Peptide: As used herein, a “targeting peptide” refers to a peptide inserted into, or attached to, a capsid polypeptide to alter the tropism of the capsid polypeptide. A targeting peptide can be inserted into an AAV capsid sequence for enhanced targeting to a desired cell-type, tissue, or organ, for example for enhanced targeting to the CNS. A targeting peptide is typically 3 to 20 amino acids in length, for example, 3 to 12 amino acids, 4 to 10 amino acids, 5 to 12 amino acids, 5 to 10 amino acids, or 7 to 10 amino acids in length
[0039] Treating: As used herein, the term “treating a disease or condition” refers to treating a manifest disease or condition, for example, where the subject is already suffering from one or more symptoms of the disease or condition, or refers to treating a pre-manifest disease or condition, for example, where the subject is identified as having a disease or condition but is not yet exhibiting one or more symptoms of the disease or condition. Pre-manifest conditions may be identified by, for example, genetic testing.
[0040] Variant: As used herein, a “variant capsid polypeptide” refers to a polypeptide that differs from a reference sequence (e g., SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:7, SEQ ID NO:9 or SEQ ID NO:11, preferably SEQ ID NO:1 , or sequence subunit thereof such as a VP2 or VP3 portion thereof). The variant capsid polypeptide can, for example, comprise a mutation (e g , substitution, deletion, or insertion). In some embodiments, the variant is about, or at least, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the reference sequence It will be clear to the skilled artisan from this disclosure that any capsid polypeptide, for example any capsid polypeptide disclosed herein, for example, a capsid polypeptide of SEQ ID NO: 12, is a variant capsid polypeptide with respect to another capsid polypeptide having a different amino acidsequence, e.g., another capsid polypeptide with a reference sequence as set forth above. Thus, the term “variant capsid polypeptide” herein means, and is used interchangeably with, “capsid polypeptide,” and does not require any comparison to a specific reference sequence. In some embodiments, the reference sequence is a polypeptide comprising SEQ ID NO:1 In some embodiments, the reference sequence comprises or consists of a VP1, VP2 or VP3 polypeptide, e.g., of SEQ ID NO:1. In some contexts used herein, the term “variant” refers to a virus particle that includes a variant capsid polypeptide, e.g., described herein.6.2. Capsid Polypeptides and Nucleic Acids Encoding the Same
[0041] The disclosure is directed, in part, to a variant capsid polypeptide, and to a nucleic acid comprising a sequence encoding the variant capsid polypeptide, wherein the variant capsid polypeptide comprises a mutation (insertion, deletion, or substitution) as compared to the wild-type sequence. In some embodiments, the wild-type sequence is SEQ ID NO:1. The disclosure is directed, in part, to a variant capsid polypeptide comprising SEQ ID NO:1 with mutations as compared to SEQ ID NO:1 , and nucleic acid molecules encoding the variant capsid polypeptide. A mutation can be, for example, an insertion, deletion, or substitution as compared to the wild-type sequence In some embodiments, the wild-type sequence is SEQ ID NO:1.
[0042] Mutations associated with Variant 1 (“V1”) (corresponding to a capsid polypeptide of SEQ ID NO:12) are shown in Table 1 in relation to a VP1 polypeptide of SEQ ID NO:1.
[0043] In some embodiments, the disclosure provides a variant capsid polypeptide (and nucleic acids encoding said capsid polypeptide) that comprises all of the mutation differences associated with the variant capsid polypeptide of SEQ ID NO: 12 or comprises mutations which corresponds to all of the mutation differences associated with the variant capsid polypeptide of SEQ ID NO: 12.
[0044] In some embodiments, the variant capsid polypeptide is, but for the mutation differences described in or corresponding to the mutation differences associated with a capsid polypeptide described herein, e g., associated with SEQ ID NO: 12, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a reference AAV serotype described herein.
[0045] In some embodiments, the variant capsid polypeptide described herein is, but for the mutation differences associated with a capsid polypeptide described herein, e.g., associated with SEQ ID NO:12, or which correspond to the mutation differences associated with a capsid polypeptide described herein, e.g., associated with SEQ ID NO:12, comprised within such variant capsid polypeptide, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a capsid polypeptide of SEQ ID NO:1 (e.g., a VP1, VP2 or VP3 sequence of SEQ ID NO:1).
[0046] In some embodiments, the variant capsid polypeptide described herein is, but for the mutation differences associated with a capsid polypeptide described herein, e g , associated with SEQ ID NO:12,or which correspond to the mutation differences associated with a capsid polypeptide described herein, e.g., associated with SEQ ID NO:12, comprised within such variant capsid polypeptide, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a capsid polypeptide of SEQ ID NO:3 (e.g., a VP1, VP2 or VP3 sequence of SEQ ID NO:3).
[0047] In some embodiments, the variant capsid polypeptide described herein is, but for the mutation differences associated with SEQ ID NO:12, or which correspond to the mutation differences associated with SEQ ID NO:12, comprised within such variant capsid polypeptide, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a capsid polypeptide of SEQ ID NO:5 (e.g., a VP1, VP2 or VP3 sequence of SEQ ID NO:5).
[0048] In some embodiments, the variant capsid polypeptide described herein is, but for the mutation differences associated with SEQ ID NO:12, or which correspond to the mutation differences associated with SEQ ID NO:12, comprised within such variant capsid polypeptide, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a capsid polypeptide of SEQ ID NO:7 (e.g., a VP1, VP2 or VP3 sequence of SEQ ID NO:7).
[0049] In some embodiments, the variant capsid polypeptide described herein is, but for the mutation differences associated with SEQ ID NO:12, or which correspond to the mutation differences associated with SEQ ID NO:12, comprised within such variant capsid polypeptide, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a capsid polypeptide of SEQ ID NO:9 (e.g., a VP1, VP2 or VP3 sequence of SEQ ID NO:9)
[0050] In some embodiments, the variant capsid polypeptide described herein is, but for the mutation differences associated with SEQ ID NO:12, or which correspond to the mutation differences associated with SEQ ID NO:12, comprised within such variant capsid polypeptide, at least 90%, at least 95%, 96%, 97%, 98%, 99%, or 100% identical to a capsid polypeptide of SEQ ID NO:11 (e.g., a VP1, VP2 or VP3 sequence of SEQ ID NO: 11 ).
[0051] In some embodiments, a variant capsid polypeptide is provided that comprises a variant capsid polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a variant capsid polypeptide as provided herein.
[0052] In some embodiments, a variant capsid polypeptide is provided that comprises a variant capsid polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical (not including targeting peptide insertions) to a variant capsid polypeptide as provided herein.
[0053] In some embodiments, the variant capsid polypeptide comprises a VP1 , VP2, VP3, or any combination thereof, that is each at least, or about, 95, 96, 97, 98 or 99% identical to a polypeptide of SEQ ID NO:12, and comprises all of the mutation differences of SEQ ID NO:12.
[0054] In some embodiments, the variant capsid polypeptide comprises a VP1 , VP2, VP3, or any combination thereof, that is each at least, or about, 95, 96, 97, 98 or 99% identical (not including target peptide insertions) to a polypeptide of SEQ ID NO: 12, and comprises all of the mutation differences of SEQ ID NO:12.
[0055] In some embodiments, the variant capsid polypeptide comprises a VP1 , VP2, VP3, or any combination thereof, that each has about 1 to about 20 mutations as compared to a polypeptide of SEQ ID NO: 12, and comprises all of the mutation differences of such SEQ ID NO: 12. In some embodiments the variant capsid polypeptide comprises a VP1 , VP2, VP3, or any combination thereof, that each has 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, or 20 mutations as compared to a polypeptide of SEQ ID NO: 12, and comprises all of the mutation differences of such SEQ ID NO: 12.
[0056] In some embodiments, the variant capsid polypeptide comprises a VP1 , VP2, VP3, or any combination thereof, that each has about 1 to about 10 mutations as compared to a polypeptide of SEQ ID NO: 12, and comprises all of the mutation differences of such SEQ ID NO: 12.
[0057] In some embodiments, the variant capsid polypeptide comprises a VP1 , VP2, VP3, or any combination thereof, that each has 1 to 5 mutations as compared to a polypeptide of SEQ ID NO: 12, and comprises all of the mutation differences of SEQ ID NO:12.
[0058] In aspects, provided herein are nucleic acid molecules encoding a variant capsid polypeptide as provided herein. In aspects, the nucleic acid molecule comprises sequence encoding a variant capsid polypeptide (e.g , a VP1 , VP2 or VP3 capsid polypeptide) of SEQ ID NO: 12, or fragment thereof. In aspects, the nucleic acid molecule comprises SEQ ID NO:13, or fragment thereof (e.g., a VP1-encoding, VP2-encoding or VP3-encoding fragment thereof).
[0059] In some embodiments, the nucleic acid molecule encodes a variant capsid polypeptide that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a variant capsid polypeptide as provided herein
[0060] In some embodiments, the nucleic acid molecule or the nucleic acid molecule encoding the reference polypeptide for purposes of % identity, comprises a nucleotide sequence of SEQ ID NO:13.
[0061] In some embodiments, the nucleic acid molecule or the nucleic acid molecule encoding the reference polypeptide for purposes of % identity, comprises a nucleotide sequence that encodes a sequence of a variant capsid polypeptide, e g., as described herein, e.g., encodes SEQ ID NO:12.
[0062] In some embodiments, the variant capsid polypeptide, or the reference polypeptide for purposes of % identity, comprises a sequence of SEQ ID NO:12, that is encoded by a nucleotide sequence of SEQ ID NO:13, respectively.
[0063] In some embodiments, the variant capsid polypeptide is a VP1 capsid polypeptide. In some embodiments, the variant capsid polypeptide is a VP2 capsid polypeptide. In some embodiments, the variant capsid polypeptide is a VP3 capsid polypeptide. With respect to reference sequence SEQ ID NO:1 , a VP1 capsid polypeptide comprises amino acids 1-736 of SEQ ID NO:1. With respect to reference sequence SEQ ID NO:1, a VP2 capsid polypeptide comprises amino acids 138-736 of SEQ ID NO:1. With respect to reference sequence SEQ ID NO:1, a VP3 capsid polypeptide comprises amino acids 203-736 of SEQ ID NO:1.
[0064] With respect to a variant capsid polypeptide sequence of SEQ ID NO: 12, a VP1 capsid polypeptide comprises all of the amnio acids of SEQ ID NO:12 With respect to a sequence of SEQ ID NO: 12, a VP2 capsid polypeptide comprises, e.g., consists of, a sequence that begins with the threonine corresponding to the threonine at position 138 of SEQ ID NO:1, and continuing to the C-terminus of SEQID N0:12. With respect to a sequence of SEQ ID NO:12, a VP3 capsid polypeptide comprises, e.g., consists of, a sequence that begins with the methionine corresponding to methionine at position 203 of SEQ ID NO:1 and continuing to the C-terminus of SEQ ID NO:12.
[0065] In some embodiments, the nucleic acid molecule encodes a variant capsid polypeptide that has at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99%, or 100% identity to a VP1, VP2, or VP3 sequence of SEQ ID NO: 12.
[0066] In some embodiments, the nucleic acid molecule encodes a variant capsid polypeptide that has at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99%, or 100% identity (not including targeting peptide insertions) to a VP1 , VP2, or VP3 sequence of SEQ ID NO:12.6.2.1. Variant Capsid Polypeptides (Corresponding Positions)
[0067] The mutations to capsid polypeptide sequences described herein are described in relation to a position and / or amino acid at a position within a reference sequence, e.g., SEQ ID NO:1. Thus, in some embodiments, the capsid polypeptides described herein are variant capsid polypeptides of the reference sequence, e.g., SEQ ID NO:1, e.g., include capsid polypeptides comprising at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the reference capsid polypeptide sequence (e.g., reference capsid polypeptide VP1 , VP2 and / or VP3 sequence), e g, SEQ ID NO:1 (or VP2 or VP3 sequence comprised therein) and include the mutations described herein.
[0068] It will be understood by the skilled artisan, and without being bound by theory, that each amino acid position within a reference sequence corresponds to a position within the sequence of other reference capsid polypeptides such as capsid polypeptides derived from dependoparvoviruses with different serotypes. Such corresponding positions are identified using sequence alignment tools known in the art. A particularly preferred sequence alignment tool is EMBOSS Needle Pairwise Sequence Alignment software tool based on the Needleman and Wunsch algorithm (Needleman & Wunsch, 1970, J. Mol. Biol. 48(3):443-53) (available at www.ebi.ac.uk / Tools / psa / emboss_needle / ). An alignment of exemplary reference capsid polypeptides is shown in FIGS.1A-1C. Thus, in some embodiments, the variant capsid polypeptides of the invention include variants of reference capsid polypeptides that include mutations described herein in such reference capsid polypeptides at positions corresponding to the position of the mutations described herein in relation to a different reference capsid polypeptide. Thus, for example, a mutation described as XnnnY relative to SEQ ID NO:1 (where X is the amino acid present at position nnn in SEQ ID NO:1 and Y is the amino acid mutation at that position, e.g., described herein), the disclosure provides variant capsid polypeptides comprising at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a reference capsid polypeptide sequence (e.g., reference capsid polypeptide VP1, VP2 and / or VP3 sequence) other than SEQ ID NO:1 (or VP2 or VP3 sequence comprised therein) and further comprising the disclosed mutation at a position corresponding to position nnn of SEQ ID NO:1 (e.g., comprising Y at the position in the new variant capsid polypeptide sequence that corresponds to position nnn of SEQ ID NO:1 ). As described above, such corresponding position is determined using a sequence alignment tool, such as, for example, the clustal omega tool described above. Examples of corresponding amino acid positions of exemplary known AAV serotypes is provided in FIG.1A-1C. In some embodiments, the variant is a variant of theAAV9 capsid polypeptide, which can be referred to as a “AAV9 variant capsid polypeptide” or “variantAAV9 capsid polypeptide.”
[0069] Thus, in some embodiments, the disclosure provides variant capsid polypeptide sequences that are variants of a reference sequence other than SEQ ID NO:1, e.g., a reference sequence other than SEQ ID NO:1 as described herein, which include mutations corresponding to the mutations described herein. Such variants include mutations corresponding to all of the mutations associated with SEQ ID NO:12.
[0070] The variant capsid polypeptides described herein are optionally variants of reference capsids serotypes known in the art. Non-limiting examples of such reference AAV serotypes include AAV1 , AAVrhIO, AAV-DJ, AAV-DJ8, AAV5, AAVPHP.B (PHP.B), AAVPHP.A (PHP.A), AAVG2B-26, AAVG2B- 13, AAVTH1.1-32, AAVTH1.1- 35, AAVPHP.B2 (PHP.B2), AAVPHP.B3 (PHP.B3), AAVPHP.N / PHP.B- DGT, AAVPHP.B-EST, AAVPHP B-GGT, AAVPHP.B-ATP, AAVPHP.B-ATT-T, AAVPHP.B-DGT-T, AAVPHP.B-GGT-T, AAVPHP.B-SGS, AAVPHP B-AQP, AAVPHP.B-QQP, AAVPHP.B-SNP(3), AAVPHP.B-SNP, AAVPHP.B-QGT, AAVPHP.B-NQT, AAVPHP.B- EGS, AAVPHP.B-SGN, AAVPHP.B- EGT, AAVPHP.B-DST, AAVPHP B-DST, AAVPHP.B-STP, AAVPHP.B-PQP, AAVPHP.B-SQP, AAVPHP.B-QLP, AAVPHP.B-TMP, AAVPHP.B-TTP, AAVPHP.eB, AAVPHP.S / G2A12, AAVG2A15 / G2A3 (G2A3), AAVG2B4 (G2B4), AAVG2B5 (G2B5), PHP S, AAV2, AAV2G9, AAV3, AAV3a, AAV3b, AAV3-3, AAV4, AAV4-4, AAV6, AAV6.1, AAV6.2, AAV6.1.2, AAV7, AAV7.2, AAV8, AAV9.11 , AAV9.13, AAV9, AAV9 K449R (or K449R AAV9), AAV9.16, AAV9.24, AAV9.45, AAbiodisV9.47, AAV9.61, AAV9.68, AAV9.84, AAV9.9, AAV10, AAV11, AAV12, AAV16.3, AAV24.1 , AAV27.3, AAV42.12, AAV42- 1b, AAV42-2, AAV42-3a, AAV42-3b, AAV42-4, AAV42-5a, AAV42-5b, AAV42-6b, AAV42-8, AAV42-10, AAV42-11, AAV42-12, AAV42-13, AAV42-15, AAV42-aa, AAV43-1, AAV43-12, AAV43-20, AAV43-21, AAV43-23, AAV43-25, AAV43-5, AAV44.1 , AAV44.2, AAV44.5, AAV223.1, AAV223.2, AAV223.4, AAV223.5, AAV223 6, AAV223.7, AAV1-7 / rh.48, AAV1-8 / rh 49, AAV2- 15 / rh.62, AAV2-3 / rh.61 , AAV2-4 / rh.5O, AAV2-5 / rh.51, AAV3.1 / hu.6, AAV3.1 / hu.9, AAV3-9 / rh.52, AAV3- 11 / rh.53, AAV4- 8 / r11 .64, AAV4-9 / rh.54, AAV4-19 / rh.55, AAV5-3 / rh.57, AAV5-22 / rh.58, AAV7 3 / hu.7, AAV16.8 / hu.1O, AAV16.12 / hu.11, AAV29.3 / bb.1, AAV29.5 / bb.2, AAV106 1 / hu.37, AAV114.3 / hu.4O, AAV127.2 / hu.41, AAV127.5 / hu.42, AAV128.3 / hu.44, AAV130.4 / hu 48, AAV145 1 / hu.53, AAV145.5 / hu.54, AAV145.6 / hu.55, AAV161.1O / hu.6O, AAV161.6 / hu.61, AAV33 12 / hu 17, AAV33.4 / hu.15, AAV33.8 / hu.16, AAV52 / hu.19, AAV52.1 / hu.2O, AAV58.2 / hu.25, AAVA3.3, AAVA3 4, AAVA3.5, AAVA3.7, AAVC1 , AAVC2, AAVC5, AAVF3, AAVF5, AAVH2, AAVrh.72, AAVhu.8, AAVrh.68, AAVrh.70, AAVpi.1 , AAVpi 3, AAVpi.2, AAVrh.60, AAVrh.44, AAVrh.65, AAVrh.55, AAVrh.47, AAVrh.69, AAVrh.45, AAVrh.59, AAVhu.12, AAVH6, AAVH-1 / hu.1, AAVH-5 / hu.3, AAVLG- 10 / rh.40, AAVLG-4 / rh.38, AAVLG-9 / hu.39, AAVN721-8 / rh.43, AAVCh 5, AAVCh 5R1, AAVcy.2, AAVcy.3, AAVcy.4, AAVcy.5, AAVCy.5R1, AAVCy.5R2, AAVCy.5R3, AAVCy.5R4, AAVcy.6, AAVhu.1, AAVhu.2, AAVhu.3, AAVhu.4, AAVhu.5, AAVhu.6, AAVhu.7, AAVhu.9, AAVhu.10, AAVhu.11 , AAVhu.13, AAVhu.15, AAVhu.16, AAVhu.17, AAVhu.18, AAVhu.20, AAVhu 21 , AAVhu.22, AAVhu.23.2, AAVhu.24, AAVhu.25, AAVhu.27, AAVhu.28, AAVhu.29, AAVhu.29R, AAVhu.31, AAVhu.32, AAVhu.34, AAVhu.35, AAVhu.37, AAVhu 39, AAVhu.40, AAVhu.41 , AAVhu.42, AAVhu 43, AAVhu.44, AAVhu.44R1 , AAVhu.44R2, AAVhu.44R3, AAVhu.45, AAVhu.46, AAVhu.47, AAVhu 48, AAVhu.48R1, AAVhu.48R2, AAVhu.48R3, AAVhu.49, AAVhu.51, AAVhu.52, AAVhu.54, AAVhu 55, AAVhu.56, AAVhu.57, AAVhu.58, AAVhu.60, AAVhu.61 ,AAVhu.63, AAVhu.64, AAVhu.66, AAVhu 67, AAVhu.14 / 9, AAVhu.t 19, AAVrh.2, AAVrh.2R, AAVrh.8, AAVrh.8R, AAVrh.10, AAVrh 12, AAVrh.13, AAVrh.13R, AAVrh.14, AAVrh.17, AAVrh.18, AAVrh 19, AAVrh.20, AAVrh.21, AAVrh.22, AAVrh 23, AAVrh.24, AAVrh.25, AAVrh.31, AAVrh.32, AAVrh.33, AAVrh.34, AAVrh.35, AAVrh.36, AAVrh 37, AAVrh.37R2, AAVrh.38, AAVrh 39, AAVrh.40, AAVrh.46, AAVrh.48, AAVrh.48.1 , AAVrh.48.1.2, AAVrh.48.2, AAVrh.49, AAVrh 51, AAVrh.52, AAVrh.53, AAVrh.54, AAVrh.56, AAVrh.57, AAVrh.58, AAVrh 61 , AAVrh.64, AAVrh.64R1, AAVrh 64R2, AAVrh.67, AAVrh.73, AAVrh.74 (also referred to as AAVrh74), AAVrh8R, AAVrh8R A586R mutant, AAVrh8R R533A mutant, AAAV, BAAV, caprine AAV, bovine AAV, AAVhE1.1, AAVhEr1.5, AAVhER1.14, AAVhEr1.8, AAVhEr1.16, AAVhEr1.18, AAVhEr1.35, AAVhEr1.7, AAVhEr1.36, AAVhEr2.29, AAVhEr2.4, AAVhEr2.16, AAVhEr2.30, AAVhEr2.31, AAVhEr2.36, AAVhER1.23, AAVhEr3.1 , AAV2 5T , AAV-PAEC, AAV-LK01 , AAV-LK02, AAV- LK03, AAV-LK04, AAV-LK05, AAV-LK06, AAV-LK07, AAV-LK08, AAV- LK09, AAV- LK10, AAV-LK11, AAV-LK12, AAV-LK13, AAV-LK14, AAV-LK15, AAV-LK16, AAV- LK17, AAV-LK18, AAV-LK19, AAV-PAEC2, AAV-PAEC4, AAV-PAEC6, AAV-PAEC7, AAV-PAEC8, AAV- PAEC11, AAV-PAEC12, AAV-2-pre-miRNA-101 , AAV-8h, AAV- 8b, AAV-h, AAV-b, AAV SM 10-2 , AAV Shuffle 100-1 , AAV Shuffle 100-3, AAV Shuffle 100-7, AAV Shuffle 10-2, AAV Shuffle 10-6, AAV Shuffle 10-8, AAV Shuffle 100- 2, AAV SM 10-1 , AAV SM 10-8 , AAV SM 100-3, AAV SM 100-10, BNP61 AAV, BNP62 AAV, BNP63 AAV, AAVrh.50, AAVrh.43, AAVrh.62, AAVrh.48, AAVhu.19, AAVhu.11 , AAVhu.53, AAV4-8 / rh.64, AAVLG-9 / hu.39, AAV54.5 / hu.23, AAV54.2 / hu.22, AAV54.7 / hu.24, AAV54.1 / hu.21, AAV54.4R / hu.27, AAV46.2 / hu.28, AAV46.6 / hu.29, AAV128.1 / hu.43, true type AAV (ttAAV), UPENN AAV 10, Japanese AAV 10 serotypes, AAV CBr-7.1 , AAV CBr-7.10, AAV CBr-7.2, AAV CBr-7.3, AAV CBr-7.4, AAV CBr-7.5, AAV CBr-7.7, AAV CBr-7.8, AAV CBr-B7.3, AAV CBr-B7.4, AAV CBr-E1 , AAV CBr- E2, AAV CBr-E3, AAV CBr-E4, AAV CBr-E5, AAV CBr-e5, AAV CBr-E6, AAV CBr-E7, AAV CBr-E8, AAV CHt-1, AAV CHt-2, AAV CHt-3, AAV CHt-6.1 , AAV CHt-6.10, AAV CHt-6.5, AAV OHt-6.6, AAV CHt-6.7, AAV CHt-6.8, AAV CHt-P1, AAV CHt-P2, AAV CHt-P5, AAV CHt-P6, AAV CHt-P8, AAV CHt-P9, AAV CKd-1, AAV CKd-10, AAV CKd-2, AAV CKd-3, AAV CKd-4, AAV CKd-6, AAV CKd-7, AAV CKd-8, AAV CKd-B1, AAV CKd-B2, AAV CKd-B3, AAV CKd-B4, AAV CKd-B5, AAV CKd-B6, AAV CKd-B7, AAV CKd-B8, AAV CKd-H1 , AAV CKd-H2, AAV CKd-H3, AAV CKd-H4, AAV CKd- H5, AAV CKd-H6, AAV CKd-N3, AAV CKd-N4, AAV CKd-N9, AAV CLg-F1 , AAV CLg-F2, AAV CLg-F3, AAV CLg-F4, AAV CLg- F5, AAV CLg-F6, AAV CLg-F7, AAV CLg-F8, AAV CLv-1 , AAV CLv1-1, AAV Clv1-10, AAV CLv1-2, AAV CLv-12, AAV CLv1-3, AAV CLv-13, AAV CLv1-4, AAV Clv1 -7, AAV Clv1 -8, AAV Clv1-9, AAV CLv-2, AAV CLv-3, AAV CLv-4, AAV CLv-6, AAV CLv-8, AAV CL.V-D1, AAV CLv-D2, AAV CLv-D3, AAV CLv- D4, AAV CLv-D5, AAV CLv-D6, AAV CLv-D7, AAV CLv-D8, AAV CL.V-E1, AAV CL.V-K1, AAV CLv-K3, AAV CLv-K6, AAV CLv-L4, AAV CLv-L5, AAV CLv-L6, AAV CL.V-M1, AAV CL.V-M11, AAV CLv-M2, AAV CLV-M5, AAV CLV-M6, AAV CLv-M7, AAV CLv-M8, AAV CLv-M9, AAV CL.V-R1, AAV CLv-R2, AAV CLv- R3, AAV CLV-R4, AAV CLv-R5, AAV CLv-R6, AAV CLv-R7, AAV CLv-R8, AAV CLv-R9, AAV CSp-1, AAV CSp-10, AAV CSp-11, AAV CSp-2, AAV CSp-3, AAV CSp-4, AAV CSp-6, AAV CSp-7, AAV CSp-8, AAV CSp-8.10, AAV CSp-8.2, AAV CSp-8.4, AAV CSp-8.5, AAV CSp-8.6, AAV CSp-8.7, AAV CSp-8.8, AAV CSp-8.9, AAV CSp-9, AAV.hu.48R3, AAV.VR-355, AAV3B, AAV4, AAV5, AAVF1 / HSC1, AAVF11 / HSC11, AAVF12 / HSC12, AAVF13 / HSC13, AAVF14 / HSC14, AAVF15 / HSC15, AAVF16 / HSC16, AAVF17 / HSC17, AAVF2 / HSC2, AAVF3 / HSC3, AAVF4 / HSC4, AAVF5 / HSC5, AAVF6 / HSC6, AAVF7 / HSC7, AAVF8 / HSC8, and / or AAVF9 / HSC9, 7m8, SparklOO, AAVMYO and variants thereof.
[0071] In some embodiments, the reference AAV capsid sequence comprises an AAV2 sequence. In some embodiments, the reference AAV capsid sequence comprises an AAV5 sequence. In some embodiments, the reference AAV capsid sequence comprises an AAV8 sequence. In some embodiments, the reference AAV capsid sequence comprises an AAV9 sequence. In some embodiments, the reference AAV capsid sequence comprises an AAVrh74 sequence. While not wishing to be bound by theory, it is understood that a reference AAV capsid sequence comprises a VP1 region In certain embodiments, a reference AAV capsid sequence comprises a VP1 , VP2 and / or VP3 region, or any combination thereof. A reference VP1 sequence may be considered synonymous with a reference AAV capsid sequence.
[0072] The wild-type reference sequence of AAV9, SEQ ID NOU is as follows:MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNA ADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAA KTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTM ASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISNSTSGGSSN DNAYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIANNLT STVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYGYLTLNDGSQAVGRSSFYCLEYFPSQMLRTG NNFQFSYEFENVPFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGQNQQTLKFSVAGPSNMAVQGRN YIPGPSYRQQRVSTTVTQNNNSEFAWPGASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGK QGTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQAQAQTGWVQNQGILPGMVWQDRDV YLQGPIWAKIPHTDGNFHPSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFITQYSTGQVSVEI EWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVYSEPRPIGTRYLTRNL (SEQ ID NOU)
[0073] Unless otherwise noted, SEQ ID NOU is the reference sequence. In the sequence above, the sequence found in VP1, VP2 and VP3 is underlined (e.g., a VP3 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 203-736 of SEQ ID NOU), the sequence found in both VP1 and VP2 is in bold (e g., a VP2 capsid polypeptide includes, e.g., consists of, the sequence corresponding to amino acids 138-736 of SEQ ID NOU) and the sequence that is not underlined or bold is found only in VP1 (e.g , a VP1 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 1-736 of SEQ ID NOU ).
[0074] The wild-type reference sequence of SEQ ID NOU can be encoded by a reference nucleic acid molecule sequence of SEQ ID NO:2.
[0075] An exemplary reference sequence of wild-type AAV2, SEQ ID NO:3 (wild-type AAV2) is as follows:MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPVNE ADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEP VKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAPSGLGTN TMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQSGASN DNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNDGTTTIANNLT STVQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMVPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRT GNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTNTPSGTTTQSRLQFSQAGASDIRDQS RNWLPGPCYRQQRVSKTSADNNNSEYSWTGATKYHLNGRDSLVNPGPAMASHKDDEEKFFPQSGVLI FGKQGSEKTNVDIEKVMITDEEEIRTTNPVATEQYGSVSTNLQRGNRQAATADVNTQGVLPGMVWQDR DVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPSTTFSAAKFASFITQYSTGQVSV EIEWELQKENSKRWNPEIQYTSNYNKSVNVDFTVDTNGVYSEPRPIGTRYLTRNL (SEQ ID NO:3)
[0076] In the sequence above, the sequence found in VP1 , VP2 and VP3 is underlined (e.g., a VP3 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 203-735 of SEQID NOY), the sequence found in both VP1 and VP2 is in bold (e.g., a VP2 capsid polypeptide includes, e.g., consists of, the sequence corresponding to amino acids 138-735 of SEQ ID NOY) and the sequence that is not underlined or bold is found only in VP1 (e.g., a VP1 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 1-735 of SEQ ID NO:3).
[0077] An example nucleic acid sequence encoding SEQ ID NO:3 is SEQ ID NO:4
[0078] An exemplary reference sequence of wild type AAV5, SEQ ID NO:5 (wild-type AAV5), is as follows:MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNGLDRGEPVNRA DEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLGKAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPSGSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTP WGYFDFNRFHSHWSPRDWQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDD YQLPYVVGNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFTYN FEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQG WNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSNTYALENTMIFNSQPANPGTTATY LEGNMLITSESETQPVNRVAYNVGGQMATNNQSSTTAPATGTYNLQEIVPGSVWMERDVYLQGPIWAKI PETGAHFHPSPAMGGFGLKHPPPMMLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENS KRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIGTRYLTRPL (SEQ ID NO:5)
[0079] In the sequence above, the sequence found in VP1 , VP2 and VP3 is underlined (e.g., a VP3 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 193-724 of SEQID NOY), the sequence found in both VP1 and VP2 is in bold (e.g., a VP2 capsid polypeptide includes, e.g., consists of, the sequence corresponding to amino acids 137-724 of SEQ ID NO:5) and the sequence that is not underlined or bold is found only in VP1 (e.g., a VP1 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 1-724 of SEQ ID NO:5).
[0080] An example nucleic acid sequence encoding SEQ ID NO:5 is SEQ ID NO:6
[0081] An exemplary reference sequence of wild-type AAV8, SEQ ID NOY (wild-type AAV8), is as follows:MAADGYLPDWLEDNLSEGIREWWALKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLDKGEPVNA ADAAALEHDKAYDQQLQAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVEEGAKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPARKRLNFGQTGDSESVPDPQPLGEPPAAPSGVGPNTMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGA TNDNTYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLSFKLFNIQVKEVTQNEGTKTIANN LTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRT GNNFQFTYTFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQTTGGTANTQTLGFSQGGPNTMANQ AKNWLPGPCYRQQRVSTTTGQNNNSNFAWTAGTKYHLNGRNSLANPGIAMATHKDDEERFFPSNGILIF GKQNAARDNADYSDVMLTSEEEIKTTNPVATEEYGIVADNLQQQNTAPQIGTVNSQGALPGMVWQNRD VYLQGPIWAKIPHTDGNFHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFNQSKLNSFITQYSTGQVSVE IEWELQKENSKRWNPEIQYTSNYYKSTSVDFAVNTEGVYSEPRPIGTRYLTRNL (SEQ ID NOY)
[0082] In the sequence above, the sequence found in VP1 , VP2 and VP3 is underlined (e.g., a VP3 capsid polypeptide includes, e g , consists of, amino acids corresponding to amino acids 204-738 of SEQID NOY), the sequence found in both VP1 and VP2 is in bold (e.g., a VP2 capsid polypeptide includes, e.g., consists of, the sequence corresponding to amino acids 138-738 of SEQ ID NOY) and the sequence that is not underlined or bold is found only in VP1 (e.g., a VP1 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 1-738 of SEQ ID NOY).
[0083] An example nucleic acid sequence encoding SEQ ID NOY is SEQ ID NOY
[0084] An exemplary reference sequence of wild-type AAVrh74, SEQ ID NO:9 (wild-type AAVrh74), is as follows:MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDNGRGLVLPGYKYLGPFNGLDKGEPVNA ADAAALEHDKAYDQQLQAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVESP VKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPAKKRLNFGQTGDSESVPDPQPIGEPPAGPSGLGSG TMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGS TNDNTYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNEGTKTIANN LTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRT GNNFEFSYNFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQSTGGTAGTQQLLFSQAGPNNMSAQ AKNWLPGPCYRQQRVSTTLSQNNNSNFAWTGATKYHLNGRDSLVNPGVAMATHKDDEERFFPSSGVL MFGKQGAGKDNVDYSSVMLTSEEEIKTTNPVATEQYGVVADNLQQQNAAPIVGAVNSQGALPGMVWQ NRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFNQAKLASFITQYSTGQV SVEIEWELQKENSKRWNPEIQYTSNYYKSTNVDFAVNTEGTYSEPRPIGTRYLTRNL (SEQ ID NO: 9)
[0085] An alternative exemplary reference sequence of SEQ ID NO: 11 (alternate wild-type AAVrh74) is as follows:MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDNGRGLVLPGYKYLGPFNGLDKGEPVNA ADAAALEHDKAYDQQLQAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQAKKRVLEPLGLVESP VKTAPGKKRPVEPSPQRSPDSSTGIGKKGQQPAKKRLNFGQTGDSESVPDPQPIGEPPAGPSGLGSG TMAAGGGAPMADNNEGADGVGSSSGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISNGTSGGS TNDNTYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTQNEGTKTIANN LTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRT GNNFEFSYNFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSRTQSTGGTAGTQQLLFSQAGPNNMSAQ AKNWLPGPCYRQQRVSTTLSQNNNSNFAWTGATKYHLNGRDSLVNPGVAMATHKDDEERFFPSSGVL MFGKQGAGKDNVDYSSVMLTSEEEIKTTNPVATEQYGVVADNLQQQNAAPIVGAVNSQGALPGMVWQ NRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGLKHPPPQILIKNTPVPADPPTTFTKAKLASFITQYSTGQV SVEIEWELQKENSKRWNPEIQYTSNYYKSTNVDFAVNTEGTYSEPRPIGTRYLTRNL (SEQ ID NO:11)
[0086] In the sequences above (SEQ ID NO:9 or SEQ ID NO:11 ), the sequence found in VP1, VP2 and VP3 is underlined (e.g., a VP3 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 204-738 of SEQ ID NO:9), the sequence found in both VP1 and VP2 is in bold (e g , a VP2 capsid polypeptide includes, e.g, consists of, the sequence corresponding to amino acids 138-738 of SEQ ID NO:9) and the sequence that is not underlined or bold is found only in VP1 (e.g , a VP1 capsid polypeptide includes, e.g., consists of, amino acids corresponding to amino acids 1-738 of SEQ ID NO:9).
[0087] An example nucleic acid sequence encoding SEQ ID NO:9 is SEQ ID NO:10
[0088] The present disclosure refers to structural capsid proteins (including VP1 , VP2 and VP3) which are encoded by capsid (Cap) genes. These capsid proteins form an outer protein structural shell (i.e. capsid) of a viral vector such as AAV. VP capsid proteins synthesized from Cap polynucleotides generally include a methionine as the first amino acid in the peptide sequence (Met1), which is associated with the start codon (AUG or ATG) in the corresponding Cap nucleotide sequence. However, it is common for a first-methionine (Met1 ) residue or generally any first amino acid (AA1 ) to be cleaved off after or during polypeptide synthesis by protein processing enzymes such as Met-aminopeptidases. This “Met / AA-clipping” process often correlates with a corresponding acetylation of the second amino acid in the polypeptide sequence (e.g., alanine, valine, serine, threonine, etc.). Met-clipping commonly occurs with VP1 and VP3 capsid proteins but can also occur with VP2 capsid proteins. Where the Met / AA- clipping is incomplete, a mixture of one or more (one, two or three) VP capsid proteins comprising the viral capsid can be produced, some of which include a Met1 / AA1 amino acid (Met+ / AA+) and some ofwhich lack a Met1 / AA1 amino acid as a result of Met / AA-clipping (Met- / AA-). For further discussion regarding Met / AA-clipping in capsid proteins, see Jin, et al Direct Liquid Chromatography / Mass Spectrometry Analysis for Complete Characterization of Recombinant Adeno-Associated Virus Capsid Proteins. Hum Gene Ther Methods 2017 Oct.28(5):255-267; Hwang, et al. N- Terminal Acetylation of Cellular Proteins Creates Specific Degradation Signals. Science. 2010 February 19.327(5968): 973-977; the contents of which are each incorporated herein by reference in its entirety. According to the present disclosure, references to capsid polypeptides is not limited to either clipped (Met- / AA-) or unclipped (Met+ / AA+) and, in context, also refer to independent capsid polypeptides, viral capsids comprised of a mixture of capsid proteins, and / or polynucleotide sequences (or fragments thereof) which encode, describe, produce or result in capsid polypeptides of the present disclosure A direct reference to a “capsid polypeptide” (such as VP1 , VP2 or VP3) also comprise VP capsid proteins which include a Met1 / AA1 amino acid (Met+ / AA+) as well as corresponding VP capsid polypeptide which lack the Met1 / AA1 amino acid as a result of Met / AA-clipping (Met- / AA-). Further according to the present disclosure, a reference to a specific SEQ ID NO:(whether a protein or nucleic acid) which comprises or encodes, respectively, one or more capsid polypeptides which include a Met1 / AA1 amino acid (Met+ / AA+) should be understood to teach the VP capsid polypeptides which lack the Met1 / AA1 amino acid as upon review of the sequence, it is readily apparent any sequence which merely lacks the first listed amino acid (whether or not Met1 / AA1). As a non-limiting example, reference to a VP1 polypeptide sequence which is 736 amino acids in length and which includes a “Met1” amino acid (Met+) encoded by the AUG / ATG start codon is also understood to teach a VP1 polypeptide sequence which is 735 amino acids in length and which does not include the “Met1” amino acid (Met-) of the 736 amino acid Met+ sequence As a second non-limiting example, reference to a VP1 polypeptide sequence which is 736 amino acids in length and which includes an “AA1” amino acid (AA1+) encoded by any NNN initiator codon can also be understood to teach a VP1 polypeptide sequence which is 735 amino acids in length and which does not include the “AA1” amino acid (AA1-) of the 736 amino acid AA1+ sequence. References to viral capsids formed from VP capsid proteins (such as reference to specific AAV capsid serotypes), can incorporate VP capsid proteins which include a Met1 / AA1 amino acid (Met+ / AA1+), corresponding VP capsid proteins which lack the Met1 / AA1 amino acid as a result of Met / AA1 -clipping (Met- / AA1-), and combinations thereof (Met+ / AA1+ and Met- / AA1-). As a non-limiting example, an AAV capsid serotype can include VP1 (Met+ / AA1+), VP1 (Met- / AA1-), or a combination of VP1 (Met+ / AA1+) and VP1 (Met- / AA1-). An AAV capsid serotype can also include VP3 (Met+ / AA1+), VP3 (Met- / AA1-), or a combination of VP3 (Met+ / AA1+) and VP3 (Met- / AA1-); and can also include similar optional combinations of VP2 (Met+ / AA1 ) and VP2 (Met- / AA1-).
[0089] In some embodiments, the reference AAV capsid sequence comprises an amino acid sequence with 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any of the those described above
[0090] In some embodiments, the reference AAV capsid sequence is encoded by a nucleotide sequence with 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%,83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any of those described above. In certain embodiments, the reference sequence is not an AAV capsid sequence and is instead a different vector (e.g., lentivirus, plasmid, etc.).
[0091] In some embodiments, a nucleic acid of the disclosure (e.g., encoding an AAV9 variant capsid protein) comprises conventional control elements or sequences which are operably linked to the nucleic acid molecule in a manner which permits transcription, translation and / or expression in a cell transfected with the nucleic acid (e.g., a plasmid vector comprising said nucleic acid) or infected with a virus comprising said nucleic acid. As used herein, “operably linked” sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest
[0092] Expression control sequences include efficient RNA processing signals such as splicing and polyadenylation (polyA) signals; appropriate transcription initiation, termination, promoter and enhancer sequences; sequences that stabilize cytoplasmic mRNA; sequences that enhance protein stability; sequences that enhance translation efficiency (e.g., Kozak consensus sequence); and in some embodiments, sequences that enhance secretion of the encoded transgene product. Expression control sequences, including promoters which are native, constitutive, inducible and / or tissue-specific, are known in the art and can be utilized with the compositions and methods disclosed herein
[0093] In some embodiments, the native promoter for the transgene is used. Without wishing to be bound by theory, the native promoter can mimic native expression of the transgene, or provide temporal, developmental, or tissue-specific expression, or expression in response to specific transcriptional stimuli. In some embodiments, the transgene is operably linked to other native expression control elements, such as enhancer elements, polyadenylation sites or Kozak consensus sequences, e.g., to mimic the native expression.
[0094] In some embodiments, the transgene is operably linked to a tissue-specific promoter, e.g., a promoter active specifically in one or more CNS cell types. In some embodiments, the transgene is operably linked to a promoter active in muscle (e.g., skeletal muscle and / or cardiac muscle). The promoter active in skeletal muscle can be specific to skeletal muscle, or expressed more broadly in other muscle types (e.g., cardiac muscle, smooth muscle) In some embodiments, the transgene is operably linked to a promoter active in cardiac muscle. The promoter active in cardiac muscle can be specific to cardiac muscle, or expressed more broadly in other muscle types (e.g., skeletal muscle, smooth muscle).
[0095] In some embodiments, a vector, e.g., a plasmid, carrying a transgene includes a selectable marker or a reporter gene. Such selectable reporters or marker genes can be used to signal the presence of the vector, e.g., plasmid, in bacterial cells. Other components of the vector, e.g., plasmid, include an origin of replication. Selection of these and other promoters and vector elements are conventional and many such sequences are available (see, e g, Sambrook et al, and references cited therein)
[0096] In some embodiments, the viral particle comprising a variant capsid polypeptide, e.g., a variant capsid polypeptide described herein, exhibits increased CNS transduction as compared to a viral particle with the wild-type capsid polypeptide (SEQ ID NO:1 ).
[0097] In some embodiments, the viral particle comprising a variant capsid polypeptide, e.g., a variant capsid polypeptide described herein, exhibits increased CNS transduction as compared to a viral particle with the VAR-1 capsid polypeptide (SEQ ID NO:38). In some embodiments, the viral particle comprising a variant capsid polypeptide, e.g., a variant capsid polypeptide described herein, exhibits increased transduction in one or more CNS regions (e.g , motor cortex, prefrontal cortex, putamen) and / or CNS cell types (e.g., astrocytes, excitatory neurons, interneurons, oligodendrocytes, medium spiny neurons) as compared to a viral particle with the VAR-1 capsid polypeptide (SEQ ID NO:38)
[0098] In some embodiments, the viral particle comprising a variant capsid polypeptide, e.g., a variant capsid polypeptide described herein, exhibits increased muscle transduction as compared to a viral particle with the wild-type capsid polypeptide (SEQ ID NO:1 )
[0099] In some embodiments, the viral particle comprising a variant capsid polypeptide, e.g., a variant capsid polypeptide described herein, exhibits increased skeletal muscle transduction as compared to a viral particle with the wild-type capsid polypeptide (SEQ ID NO:1 ).
[0100] In some embodiments, the viral particle comprising a variant capsid polypeptide, e.g., a variant capsid polypeptide described herein, exhibits increased cardiac muscle transduction as compared to a viral particle with the wild-type capsid polypeptide (SEQ ID NO:1 ).
[0101] In some embodiments, the capsid polypeptide is an isolated or purified polypeptide (e.g., isolated or purified from a cell, other biological component, or contaminant). In some embodiments, the variant polypeptide is present in a dependoparvovirus particle, e.g., described herein In some embodiments, the variant capsid polypeptide is present in a cell, cell-free system, or translation system, e.g., described herein.
[0102] In some embodiments, the capsid polypeptide is present in a dependoparvovirus B (e.g., AAV9) particle. In some embodiments, the capsid particle has increased CNS transduction In some embodiments, the capsid particle has increased skeletal muscle transduction. In some embodiments, the capsid particle has increased cardiac muscle transduction.
[0103] In some embodiments, a dependoparvovirus particle comprises an amino acid sequence that has at least 80, 85, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to the amino acid sequences provided for herein (e.g., SEQ ID NO:12). In some embodiments, the variant capsid polypeptide comprises an amino acid sequence that differs by no more than 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acids from the amino acid sequence of a variant capsid polypeptide provided for herein.6.2.1. Targeting Peptides
[0104] The capsid polypeptides of the disclosure can include (but do not necessarily include) a targeting peptide to alter the tropism of the capsid polypeptides, for example to enhance targeting to the CNS or muscle (e.g., skeletal or cardiac muscle) Thus, in some embodiments, a capsid polypeptide of the disclosure includes a targeting peptide. In other embodiments, a capsid polypeptide of the disclosure does not include a targeting peptide.6.2.1.1. CNS Targeting Peptides
[0105] Various targeting peptides for enhancing CNS tropism, and which can be included in capsid polypeptides of the disclosure, are described in the art, for example in WO 2017 / 197355, WO 2019 / 006182, WO 2019 / 060454, WO 2012 / 145601 , WO 2018 / 022905, WO 2021 / 243085, WO 2019 / 076856, WO2015 / 038958, WO 2015 / 191508, WO 2020 / 068990, WO 2020 / 210655, WO 2020 / 198737, WO 2020 / 028751 , WO 2019 / 028306, WO 2017 / 100671 A1, WO 2020 / 028751 A2, WO 2020 / 072683 A1, WO 2020 / 160337 A1 , WO 2020 / 223280 A1, WO 2021 / 025995 A1, WO 2021 / 202651 A1 , WO 2021 / 230987 A1, WO 2022 / 235702 A1 , WO 2020 / 014471, WO 2018 / 189244, WO 2019 / 141765, WO 2019 / 207132, WO 2019 / 210267, WO 2018 / 156654, WO 2010 / 093784, WO 2015 / 048534, WO 2017 / 058892, WO 2019 / 169132, WO 2021 / 108468, WO 2021 / 102234, WO 2022 / 173847, WO 2021 / 077000, WO 2020 / 160337, WO 2021 / 050974, WO 2021 / 222831 , WO 2022 / 020616, WO 2020 / 193799, WO 2021 / 072197, WO 2022 / 126188, WO 2022 / 126189, WO 2021 / 165544, WO 2021 / 084133, WO 2022 / 040527, WO 2022 / 221400, WO 2022 / 221404, WO 2022 / 221420, WO 2021 / 216456, WO 2021 / 009684, WO 2021 / 242909, WO 2019 / 158619, WO 2021 / 226267, WO 2023 / 283962, WO 2021 / 219762, WO 2022 / 226374, WO 2022 / 226375, WO 2022 / 229703, and WO 2022 / 229702, the contents of which are incorporated herein by reference in their entireties. Targeting peptides are typically 3 to 20 amino acids in length. In some embodiments, a targeting peptide is 3 to 12 amino acids in length. In other embodiments, a targeting peptide is 5 to 12 amino acids in length In other embodiments, a targeting peptide is 5 to 10 amino acids in length. In other embodiments, a targeting peptide is 7 to 10 amino acids in length. In some embodiments, a targeting peptide is 7 amino acids in length. In other embodiments, a targeting peptide is 9 amino acids in length.
[0106] In some embodiments, the targeting peptide comprises at least 3, 4, 5, 6, 7, 8, or 9 consecutive amino acids from the amino acid sequence of PLNGAVHLY (SEQ ID NO:16). In some embodiments, the targeting peptide comprises the amino acid sequence PLNGAVHLY (SEQ ID NO:16). In some embodiments, the targeting peptide comprises at least 3, 4, 5, 6, or 7 consecutive amino acids from the amino acid sequence of IVMNSLK (SEQ ID NO:17). In some embodiments, the targeting peptide comprises the amino acid sequence IVMNSLK (SEQ ID NO:17). In some embodiments, the targeting peptide comprises at least 3, 4, 5, 6, or 7 consecutive amino acids from the amino acid sequence of RDSPKGW (SEQ ID NO: 18) In some embodiments, the targeting peptide comprises the amino acid sequence RDSPKGW (SEQ ID NO: 18). In some embodiments, the targeting peptide comprises at least 3, 4, 5, 6, or 7 consecutive amino acids from the amino acid sequence of YSTDVRM (SEQ ID NO:19). In some embodiments, the targeting peptide comprises the amino acid sequence YSTDVRM (SEQ ID NO:19). In some embodiments, the targeting peptide comprises at least 3, 4, 5, 6, or 7 consecutive amino acids from the amino acid sequence of RESPRGL (SEQ ID NO:20). In some embodiments, the targeting peptide comprises the amino acid sequence RESPRGL (SEQ ID NO:20). In some embodiments, the targeting peptide comprises 4, 5, 6, or 7 consecutive amino acids from GNNTRSV (SEQ ID NO:21), GNNTRDT (SEQ ID NO:22) or TNSTRPV (SEQ ID NO:23). In some embodiments, the targeting peptide comprises the amino acid sequence GNNTRSV (SEQ ID NO:21 ). In some embodiments, the targeting peptide comprises the amino acid sequence GNNTRDT (SEQ ID NO:22). In some embodiments, the targeting peptide comprises the amino acid sequence TNSTRPV (SEQ ID NO:23).6.2.1.2. Muscle Targeting Peptides
[0107] Various targeting peptides for enhancing muscle (e.g., skeletal and / or cardiac) tropism, and which can be included in capsid polypeptides of the disclosure, are described in the art, for example in WO 2020 / 206189A1, WO 2022 / 226374 A1 , WO 2022 / 053630 A1 , and WO 2019 / 207132 A1.
[0108] In some embodiments, the muscle targeting peptide comprises at least 3, 4, 5, 6, or 7 consecutive amino acids from the amino acid sequence ASSLNIA (SEQ ID NO:24).
[0109] In some aspects, the targeting peptide targets the insulin receptor (INSR) In some embodiments, the peptide targeting the INSR comprises an amino acid sequence having at least 80%, 87%, 91%, 94%, 97%, or 100% sequence identity to SLEEEWAQVECEVYGRGCPSGSLDESFYDWFERQL (SEQ ID NO:25), or which has at least 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34 or 35 consecutive amino acids from the amino acid sequence SLEEEWAQVECEVYGRGCPSGSLDESFYDWFERQL (SEQ ID NO:25).
[0110] In some aspects, the targeting peptide targets muscle-specific kinase (MUSK). In some embodiments, the inserted MUSK-targeting peptide is from the acetylcholinesterase collagenic tail peptide (CoIQ), e.g., a C-terminal portion of CoIQ (CoIQ CTD). In some embodiments, the CoIQ CTD peptide comprises an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to TPFYPVGYTVKQPGTCGDGVLQPGEECDDGNPDVSDGCIDCHRAYCGDGYRHQGVEDCDGSDFGYLT CETYLPGSYGDLRCTQYCSIDSTPCRYFT (SEQ ID NO:26), or which has at least 70, 80, 85, 90, 91, 92, 93, 94, 95, or 96 consecutive amino acids from the amino acid sequence TPFYPVGYTVKQPGTCGDGVLQPGEECDDGNPDVSDGCIDCHRAYCGDGYRHQGVEDCDGSDFGYLT CETYLPGSYGDLRCTQYCSIDSTPCRYFT (SEQ ID NO:26).
[0111] In some aspects, the targeting peptide targets integrin, for example via an RGD-motif. In some embodiments, the RGD peptide comprises a subsequence Y or F amino acid to produce an RGDY (SEQ ID NO: 40) or RGDF motif (SEQ ID NO: 41 ). In some embodiments, integrin targeting peptides have the motif RGDX1X2X3X4, with Xi to X4 each being any amino acid. In various aspects of SEQ ID NO:28, Xi, X2, and X3 are each independently selected from L, G, V, and A and / or X4 is S, V, A, G, or L. In some embodiments, at least one of X2 and X3 is G. In some embodiments, the targeting peptide comprises the amino acid sequence RGDLGLS (SEQ ID NO: 28). In some embodiments, the targeting peptide comprises the amino acid sequence RGDLSTP (SEQ ID NO:29). In some embodiments, the targeting peptide comprises the amino acid sequence SNSRGDYNSL (SEQ ID NO:30). In some embodiments, the targeting peptide comprises the amino acid sequence ENRRGDFNNT (SEQ ID NO:31 ). In some embodiments, the targeting peptide comprises the amino acid sequence SRGDYNSL (SEQ ID NO:32). In some embodiments, the targeting peptide comprises the amino acid sequence RGDYNSL (SEQ ID NO:33). In some embodiments, the targeting peptide comprises the amino acid sequence RGDLST (SEQ ID NO: 34). In some embodiments, the targeting peptide comprises the amino acid sequence RGDYVGL (SEQ ID NO:35). In some embodiments, the targeting peptide comprises the amino acid sequence RGDAVGV (SEQ ID NO:36). The RGD peptides can be inserted in a linker, e g., a flexible linker such as GGGS (SEQ ID NO: 42), scaffold. Other suitable linker scaffolds can be found in WO 2022 / 226374 A1 , pages 26-28 of which are, scaffold. Other suitable linker scaffolds can be found in WO 2022 / 226374 A1 , pages 26-28 of which are incorporated herein by reference.
[0112] In some embodiments, the muscle-targeting (e.g., skeletal and / or cardiac) peptide is present in, e.g., inserted into, loop VIII of the capsid polypeptide. In some embodiments, the targeting peptide is inserted at any amino acid position corresponding to positions 586-592, inclusive, of SEQ ID NO:1. For example, the targeting peptide can be inserted between amino acids 588-589 of SEQ ID NO:1. In some embodiments, the targeting peptide is present, e.g., inserted, immediately subsequent to the position corresponding to 586, 588, or 589 of SEQ ID NO: 1. In some embodiments, the capsid polypeptide further comprises a deletion at the position corresponding to 587 and / or a deletion at the position corresponding to 588 of SEQ ID NO:1.6.2.2. Nucleic Acids and Polypeptides
[0113] The disclosure is further directed, in part, to a nucleic acid comprising a sequence encoding a variant capsid polypeptide as provided for herein. In embodiments the nucleic acid encodes a VP1 variant capsid polypeptide, e g., as described herein. In embodiments, the nucleic acid encodes a VP2 variant capsid polypeptide, e g., as described herein. In embodiments, the nucleic acid encodes a VP3 variant capsid polypeptide, e g., as described herein. In embodiments, the nucleic acid encodes a VP1 ,VP2 and VP3 variant capsid polypeptide, e g , as described herein In some embodiments, the variant capsid polypeptide comprises a sequence of SEQ ID NO: 12. In some embodiments, the nucleic acid comprises a sequence of SEQ ID NO: 13.6.3. Dependoparvovirus Particles
[0114] The disclosure is also directed, in part, to a dependoparvovirus particle (e.g , a functional dependoparvovirus particle) comprising a nucleic acid or polypeptide described herein or produced by a method described herein.
[0115] Dependoparvovirus is a single-stranded DNA parvovirus that grows only in cells in which certain functions are provided, e.g , by a co-infecting helper virus. Several species of dependoparvovirus are known, including dependoparvovirus A and dependoparvovirus B, which include serotypes known in the art as adeno-associated viruses (AAV). At least thirteen serotypes of AAV that have been characterized. General information and reviews of AAV can be found in, for example, Carter, Handbook of Parvoviruses, Vol. 1, pp. 169-228 (1989), and Berns, Virology, pp. 1743-1764, Raven Press, (New York, 1990). AAV serotypes, and to a degree, dependoparvovirus species, are significantly interrelated structurally and functionally (See, for example, Blacklowe, pp 165-174 of Parvoviruses and Human Disease, J R Pattison, ed (1988); and Rose, Comprehensive Virology 3:1-61 (1974)). For example, all AAV serotypes apparently exhibit very similar replication properties mediated by homologous rep genes; and all bear three related capsid proteins. In addition, heteroduplex analysis reveals extensive cross-hybridization between serotypes along the length of the genome, further suggesting interrelatedness.Dependoparvoviruses genomes also comprise self-annealing segments at the termini that correspond to “inverted terminal repeat sequences” (ITRs).
[0116] The genomic organization of naturally occurring dependoparvoviruses, e.g., AAV serotypes, is very similar. For example, the genome of AAV is a linear, single-stranded DNA molecule that is approximately 5,000 nucleotides (nt) in length or less. Inverted terminal repeats (ITRs) flank the unique coding nucleotide sequences for the non-structural replication (Rep) proteins and the structural capsid (Cap) proteins. Three different viral particle (VP) proteins form the capsid The terminal approximately 145 nt of the genome are self-complementary and are organized so that an energetically stableintramolecular duplex forming a T-shaped hairpin may be formed. These hairpin structures function as an origin for viral DNA replication, serving as primers for the cellular DNA polymerase complex. The Rep genes encode the Rep proteins: Rep78, Rep68, Rep52, and Rep40. Rep78 and Rep68 are transcribed from the p5 promoter, and Rep 52 and Rep40 are transcribed from the p19 promoter. The cap genes encode the VP proteins, VP1, VP2, and VP3. The cap genes are transcribed from the p40 promoter.
[0117] In some embodiments, a dependoparvovirus particle of the disclosure comprises a nucleic acid comprising a variant capsid polypeptide provided for herein. In some embodiments, the particle comprises a polypeptide as provided for herein.
[0118] In some embodiments, the dependoparvovirus particle of the disclosure is an AAV9 particle. In some embodiments, the AAV9 particle comprises a variant capsid polypeptide as provided for herein or a nucleic acid molecule encoding the same.
[0119] In some embodiments the dependoparvovirus particle comprises a variant capsid comprising a variant capsid polypeptide described herein In embodiments, the dependoparvovirus particle comprises variant capsid polypeptide described herein and a nucleic acid molecule. In embodiments, the dependoparvovirus particle comprises variant capsid polypeptide described herein and a nucleic acid molecule comprising one or more inverted terminal repeat sequences (ITRs), for example, ITRs derived from an AAV9 dependoparvovirus or an AAV2 dependoparvovirus, one or more regulatory elements (for example, a promoter), and a payload (e.g., as described herein, e.g., a heterologous transgene). In embodiments, at least one of the ITRs is modified In embodiments, the nucleic acid molecule is singlestranded. In embodiments, the nucleic acid molecule is double stranded, for example, self- complementary.6.4. Improved Biodistribution and Transduction Characteristics
[0120] The disclosure is directed, in part, to nucleic acids, polypeptides, cells, cell free systems, translation systems, viral particles, and methods associated with using and making the same to produce viral particles that have increased distribution to tissues and cells of the CNS and / or CNS transduction as compared to a viral particle comprising a reference sequence that does not otherwise comprise the mutations described herein (or mutations corresponding thereto), for example, as compared with a viral particle comprising a capsid polypeptide sequence of SEQ ID NO:1. In some embodiments, a use of a viral particle comprising the variant capsid polypeptides as described in Section 6.2 or any one of numbered embodiments 1 to 130 (e.g., a viral particle as described in Section 6.3 or any one of numbered embodiments 151 to 188) leads to increased CNS biodistribution of the viral particle and / or increased transduction of a transgene virus particle in the cells of the CNS broadly or brain specifically, and, therefore, increased expression of the payload (transgene) in the CNS or brain. In some embodiments, use of a viral particle comprising the variant capsid polypeptides as described in Section 6.2 or any one of numbered embodiments 1 to 130 (e.g., a viral particle as described in Section 6.3 or any one of numbered embodiments 151 to 188) further leads to reduced (or non-increased) biodistribution of the viral particle and / or reduced (or non-increased) transduction of the transgene in one or more peripheral tissues, e g., liver, spleen, dorsal root ganglia, or any combination of two or more of the foregoing peripheral tissue types. In certain embodiments, use of a viral particle comprising the variant capsid polypeptides as described in Section 6.2 or any one of numbered embodiments 1 to 130(e.g., a viral particle as described in Section 6 3 or any one of numbered embodiments 151 to 188) leads to reduced biodistribution and / or reduced transduction of the transgene in liver tissue.
[0121] In some embodiments, biodistribution and transduction (e g , of the tissue types described in this section) are measured by relative quantification (e.g., via qPCR) of transgene mRNA in one or more samples isolated from the relevant tissue type, e.g., CNS, skeletal muscle, or cardiac muscle), for example using the procedures described in Section 8. In some embodiments, biodistribution and / or transduction of a virus particle having a variant capsid polypeptide can be measured using virus particles having a transgene operably linked to a promoter that is active in a target cell or tissue type of interest. In some embodiments, the promoter is a ubiquitous promoter. In other embodiments, the promoter is selective or specific to a target cell or tissue type (e g , CNS and / or muscle (either broad muscle expression or skeletal muscle or cardiac muscle)), and, optionally, is less (or not) active in a cell or tissue type where transgene expression is not desired (e.g , liver, spleen, PNS, or any combination of two or all of the foregoing). A promoter that is selective for a first cell or tissue type over a second cell or tissue type is active in the first cell or tissue type and less active or silent in the second cell or tissue type. In some embodiments, the promoter is a CNS-specific or CNS-selective promoter. In some embodiments, the promoter is a muscle-specific promoter-specific or muscle-selective promoter. In some embodiments, the promoter is active in both CNS and muscle tissue In some embodiments, biodistribution and / or transduction of a virus particle having a variant capsid polypeptide can be measured using virus particles having a transgene operably linked to a ubiquitous promoter or a CNS- specific promoter. For example, biodistribution can be measured using virus particles having a transgene operably linked to CBh promoter or a hSYN promoter. In various embodiments, the transgene is a transgene encoding a capsid polypeptide or any other suitable heterologous transgene, for example a nucleic acid sequence encoding a synthetic, mammalian or human therapeutic protein or nucleic acid (e g., mRNA or RNAi) or reporter gene such as, for example a nucleic acid encoding a GFP or mCherry reporter.
[0122] In embodiments, the virus particle, e.g., as described herein, e.g., comprising a variant capsid polypeptide described herein, is capable of crossing the blood-brain barrier. In embodiments the virus particle, e g., as described herein, e.g., comprising a variant capsid polypeptide described herein, exhibits increased crossing of the blood-brain barrier relative to a virus particle comprising a reference capsid polypeptide, e.g., a reference capsid polypeptide of SEQ ID NO:1. In embodiments, the virus particle, e g., as described herein, e.g., comprising a variant capsid polypeptide described herein, exhibits increased transduction of neurons (e.g., excitatory neurons, interneurons, or medium spiny neurons), astrocytes, glial cells, oligodendrocytes or combinations thereof, relative to a virus particle comprising a reference capsid polypeptide, e.g., a reference capsid polypeptide of SEQ ID NO:1 or SEQ ID NO:38.
[0123] In some embodiments, a viral particle comprising the variant capsid polypeptide, e.g., the variant capsid polypeptide described herein, exhibits improved properties, e.g., improved biodistribution, transduction and / or production. Unless indicated otherwise, improvement rates are presented as foldimprovement over the rates exhibited by a virus particle comprising capsid polypeptides of SEQ ID NO:1. In some embodiments, improvement means an increase, e g , in the case of CNS biodistribution or CNStransduction. In other embodiments, improvement means a decrease, e.g., in the case of liver biodistribution or liver transduction.
[0124] In some embodiments, one or more improved properties (e g , increased or decreased biodistribution and / or transduction) is exhibited in a mammal, e.g., a primate, e.g., a human. In embodiments, the increased or decreased biodistribution and / or transduction is exhibited upon administration of the virus particle or pharmaceutical composition comprising the virus particle, e g., as described herein, by systemic administration, e.g., intravenous administration6.5. Methods of Making Compositions Described Herein
[0125] The disclosure is directed, in part, to a method of making a dependoparvovirus particle, e.g., a dependoparvovirus particle described herein. In some embodiments, a method of making dependoparvovirus particle comprises providing a cell, cell-free system, or other translation system, comprising a nucleic acid described encoding a variant capsid polypeptide provided for herein, or a polypeptide provided for herein (e.g., a variant capsid polypeptide); and cultivating the cell, cell-free system, or other translation system under conditions suitable for the production of the dependoparvovirus particle, thereby making the dependoparvovirus particle.6.5.1. Host Cells
[0126] Aspects of the disclosure are directed to a host cell comprising a nucleic acid of the disclosure (e.g., encoding a variant capsid polypeptide as described in Section 6.2). A host cell of the disclosure, e.g., a host cell useful to general AAV virus particles comprising a variant AAV capsid as described herein, generally comprises one or more nucleic acids comprising a coding sequence encoding a variant capsid polypeptide of the disclosure (e.g., as described in Section 6.2), together with a payload (e.g., transgene) and one or more coding sequences encoding additional components useful for promoting packaging of the payload into a dependoparvovirus capsid Additional components include, for example, coding sequences for a rep protein and dependoparvovirus inverted terminal repeats (ITRs), as well as helper sequences which promote dependoparvovirus particle production and / or secretion. Examples of helper sequences include E1a, E1 b, E2a, E4, and VA. Such helper sequences may be included endogenously within the host cell (e.g., the host cell may be engineered to express such helper sequences, e.g., integrated into the host cell genome) or may be provided exogenously (e g., transduced on the same or a different nucleic acid as the variant capsid polypeptide, payload, rep, and / or ITRs)
[0127] In some embodiments, the helper sequences include AdV5 helper sequences. An exemplary AdV5 genome is disclosed in the art as NCBI Reference Sequence AC_000008.1 (disclosed as SEQ ID NO:1 of PCT Patent Application Publication No. WO / 2022 / 079429 A1 ). In some embodiments, a host cell disclosed herein comprises a portion of an AdV5 genome encoding for one or more helper protein sequences (e.g., E1a, E1 b, E2a, E4) or RNA sequences (e.g., VA) In some embodiments, a host cell disclosed herein comprises a nucleic acid sequence encoding one or more AdV5 helper protein sequences. Certain exemplary AdV5 helper protein sequences are provided below.
[0128] AdV5 E1A:MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVML AVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEE FVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP (SEQ ID NO:43)
[0129] AdV5 E1B 19K:MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLG HQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSS VRPAIIPTEEQQQQQEEARRRRQEQSPWNPRAGLDPRE (SEQ ID NO:44)
[0130] AdV5 E1B 55K:MERRNPSERGVPAGFSGHASVESGCETQESPATVVFRPPGDNTDGGAAAAAGGSQAAAAGAEPMEPESRPGPSGMNWQVAELYPELRRILTITEDGQGLKGVKRERGACEATEEARNLAFSLMTRHRPECITFQQIKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAE VEIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAW TDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVL ACTRAEFGSSDEDTD (SEQ ID NO:45)
[0131] AdV5 E3 12.5K:MLSGEAEQLRLKHLVHCRRHKCFARDSGEFCYFELPEDHIEGPAHGVRLTAQGELARSLIREFTQRPLLVERDRGPCVLTVICNCPNLGLHQDLCCHLCAEYNKYRN (SEQ ID NO:46)
[0132] AdV5 E3 CR1-alpha0:MNNSSNSTGYSNSGFSRIGVGVILCLVILFILILTLLCLRLAACCVHICIYCQLFKRWGRHPR (SEQ ID NO:47)
[0133] AdV5 E3 gp19K:MIRYIILGLLTLASAHGTTQKVDFKEPACNVTFAAEANECTTLIKCTTEHEKLLIRHKNKIGKYAVYAIWQPG DTTEYNVTVFQGKSHKTFMYTFPFYEMCDITMYMSKQYKLWPPQNCVENTGTFCCTAMLITVLALVCTL LYIKYKSRRSFIEEKKMP (SEQ ID NO:48)
[0134] AdV5 E3 CR1-beta0:MTNTTNAAAATGLTSTTNTPQVSAFVNNWDNLGMWWFSIALMFVCLIIMWLICCLKRKRARPPIYSPIIVLHPNNDGIHRLDGLKHMFFSLTV (SEQ ID NO:49)
[0135] AdV5 E3 RID-alpha:MIPRVFILLTLVALFCACSTLAAVSHIEVDCIPAFTVYLLYGFVTLTLICSLITVVIAFIQCIDWVCVRFAYLRH HPQYRDRTIAELLRIL (SEQ ID NO:50)
[0136] AdV5 E3 RID-beta:MKFTVTFLLIICTLSAFCSPTSKPQRHISCRFTRIWNIPSCYNEKSDLSEAWLYAIISVMVFCSTILALAIYPYLDIGWKRIDAMNHPTFPAPAMLPLQQVVAGGFVPANQPRPTSPTPTEISYFNLTGGDD (SEQ ID NO:51)
[0137] AdV5 E3 14.7K:MTDTLDLEMDGIITEQRLLERRRAAAEQQRMNQELQDMVNLHQCKRGIFCLVKQAKVTYDSNTTGHRLS YKLPTKRQKLVVMVGEKPITITQHSVETEGCIHSPCQGPEDLCTLIKTLCGLKDLIPFN (SEQ ID NO:52)
[0138] AdV5 E4 ORF6 / 7:MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPECNTLTMHNAWTSPSPPVKQ PQVGQQPVAQQLDSDMNLSELPGEFINITDERLARQETVWNITPKNMSVTHDMMLFKASRGERTVYSV CWEGGGRLNTRVL (SEQ ID NO:53)
[0139] AdV5 E4 34K:MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPECNTLTMHNVSYVRGLPCSV GFTLIQEWVVPWDMVLTREELVILRKCMHVCLCCANIDIMTSMMIHGYESWALHCHCSSPGSLQCIAGG QVLASWFRMVVDGAMFNQRFIWYREVVNYNMPKEVMFMSSVFMRGRHLIYLRLWYDGHVGSVVPAMS FGYSALHCGILNNIVVLCCSYCADLSEIRVRCCARRTRRLMLRAVRIIAEETTAMLYSCRTERRRQQFIRAL LQHHRPILMHDYDSTPM (SEQ ID NO:54)
[0140] AdV5 E4 ORF4:MVLPALPAPPVCDSQNECVGWLGVAYSAVVDVIRAAAHEGVYIEPEARGRLDALREWIYYNYYTERSKR RDRRRRSVCHARTWFCFRKYDYVRRSIWHDTTTNTISVVSAHSVQ (SEQ ID NO:55)
[0141] AdV5 E4 ORF3:MIRCLRLKVEGALEQIFTMAGLNIRDLLRDILRRWRDENYLGMVEGAGMFIEEIHPEGFSLYVHLDVRAVC LLEAIVQHLTNAIICSLAVEFDHATGGERVHLIDLHFEVLDNLLE (SEQ ID NO:56)
[0142] AdV5 E4 ORFB:MFERKMVSFSVVVPELTCLYLHEHDYDVLSFLREALPDFLSSTLHFISPPMQQAYIGATLVSIAPSMRVIIS VGSFVMVPGGEVAALVRADLHDYVQLALRRDLRDRGIFVNVPLLNLIQVCEEPEFLQS (SEQ ID NO:57)
[0143] AdV5 E4 ORF1 :MAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLSLRLRVCIPPGYFGRFLALTDVNQ PDVFTESYIMTPDMTEELSWLFNHGDQFFYGHAGMAWRLMLIRWFPWRQASNV (SEQ ID NO:58)
[0144] In some embodiments, the helper sequences include AdV2 helper sequences. An exemplary AdV2 genome is disclosed in the art as NCBI Reference Sequence AC_000007.1 (disclosed as SEQ ID NO:2 of PCT Patent Application Publication No. WO / 2022 / 079429 A1 ). In some embodiments, a host cell disclosed herein comprises a portion of an AdV2 genome encoding for one or more helper protein sequences (e.g., E1a, E1 b, E2a, E4) or RNA sequences (e.g., VA) In some embodiments, a host cell disclosed herein comprises a nucleic acid sequence encoding one or more AdV2 helper protein sequences. Certain exemplary AdV2 helper protein sequences are provided below.
[0145] AdV2 E1A:MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPESVML AVQEGIDLFTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEE FVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKL VPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNESGQP LDLSCKRPRP (SEQ ID NO:59)
[0146] AdV2 E1B 19K:MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFDSLNLG HQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSS VRPAIIPTEEQQQEEARRRRRQEQSPWNPRAGLDPRE (SEQ ID NQ:60)
[0147] AdV2 E1B 55K:MERRNPSERGVPAGFSGHASVESGGETQESPATVVFRPPGNNTDGGATAGGSQAAAAAGAEPMEPE SRPGPSGMNVVQVAELFPELRRILTINEDGQGLKGVKRERGASEATEEARNLTFSLMTRHRPECVTFQQ IKDNCANELDLLAQKYSIEQLTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEV EIDTEDRVAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCVEAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRVRHNVASDCGCFMLVKSVAVIKHN MVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHNILTRCSLHLGNRRGVFLPYQCNLSH TKILLEPESMSKVNLNGVFDMTMKIWKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD (SEQ ID NO:61)
[0148] AdV2 E3 12.5K:MTSGEAERLRLTHLDHCRRHKCFARGSGEFCYFELPEEHIEGPAHGVRLTTQVELTRSLIREFTKRPLLVERERGPCVLTVVCNCPNPGLHQDLCCHLCAEYNKYRN (SEQ ID NO:62)
[0149] AdV2 E3 CR1-alphap0:MSNSSNSTSLSNFSGIGVGVILTLVILFILILALLCLRVAACCTHVCTYCQLFKRWGQHPR (SEQ ID NO:63)
[0150] AdV2 E3 gp19K:MRYMILGLLALAAVCSAAKKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPG DTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQKCLENTGTFCSTALLITALALVCTLL YLKYKSRRSFIDEKKMP (SEQ ID NO:64)
[0151] AdV2 E3 CR1-beta0:MTGSTIAPTTDYRNTTATGLTSALNLPQVHAFVNDWASLDMWWFSIALMFVCLIIMWLICCLKRRRARPPIYRPIIVLNPHNEKIHRLDGLKPCSLLLQYD (SEQ ID NO:65)
[0152] AdV2 E3 RID alpha:MIPRVLILLTLVALFCACSTLAAVAHIEVDCIPPFTVYLLYGFVTLILICSLVTVVIAFIQFIDWVCVRIAYLRHH PQYRDRTIADLLRIL (SEQ ID NO:66)
[0153] AdV2 E3 RID beta:MKRSVIFVLLIFCALPVLCSQTSAPPKRHISCRFTQIWNIPSCYNKQSDLSEAWLYAIISVMVFCSTIFALAIY PYLDIGWNAIDAMNHPTFPVPAVIPLQQVIAPINQPRPPSPTPTEISYFNLTGGDD (SEQ ID NO:67)
[0154] AdV2 E3 14.7K:MTESLDLELDGINTEQRLLERRKAASERERLKQEVEDMVNLHQCKRGIFCVVKQAKLTYEKTTTGNRLSY KLPTQRQKLVLMVGEKPITVTQHSAETEGCLHFPYQGPEDLCTLIKTMCGIRDLIPFN (SEQ ID NO:68)
[0155] AdV2 E4 ORF6 / 7:MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPECNTLTMHNAWTSPSPPVEQ PQVGQQPVAQQLDSDMNLSELPGEFINITDERLARQETVWNITPKNMSVTHDMMLFKASRGERTVYSV CWEGGGRLNTRVL (SEQ ID NO:69)
[0156] AdV2 E4 34K:MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPECNTLTMHNVSYVRGLPCSV GFTLIQEWVVPWDMVLTREELVILRKCMHVCLCCANIDIMTSMMIHGYESWALHCHCSSPGSLQCIAGG QVLASWFRMVVDGAMFNQRFIWYREVVNYNMPKEVMFMSSVFMRGRHLIYLRLWYDGHVGSVVPAMSFGYSALHCGILNNIVVLCCSYCADLSEIRVRCCARRTRRLMLRAVRIIAEETTAMLYSCRTERRRQQFIRALLQHHRPILMHDYDSTPM (SEQ ID NO:70)
[0157] AdV2 E4 ORF4:MVLPALPAPPVCDSQNECVGWLGVAYSAVVDVIRAAAHEGVYIEPEARGRLDALREWIYYNYYTERAKRRDRRRRSVCHARTWFCFRKYDYVRRSIWHDTTTNTISVVSAHSVQ (SEQ ID NO:71 )
[0158] AdV2 E4 ORF3:MIRCLRLKVEGALEQIFTMAGLNIRDLLRDILIRWRDENYLGMVEGAGMFIEEIHPEGFSLYVHLDVRAVCL LEAIVQHLTNAIICSLAVEFDHATGGERVHLIDLHFEVLDNLLE (SEQ ID NO:72)
[0159] AdV2 E4 ORF2:MFERKMVSFSVVVPELTCLYLHEHDYDVLAFLREALPDFLSSTLHFISPPMQQAYIGATLVSIAPSMRVIIS VGSFVMVPGGEVAALVRADLHDYVQLALRRDLRDRGIFVNVPLLNLIQVCEEPEFLQS (SEQ ID NO:73)
[0160] AdV2 E4 ORF1 :MAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLSLRLRVCIPPGYFGRFLALTDVNQ PDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIR VFPVVRQASNV (SEQ ID NO:74)
[0161] Additional AAV helper sequences are recognized in the art and include, for example, those described in U.S. Patent Application Publication Nos. 2004 / 0248288 A1 and 2022 / 0259572A1 , and in PCT Patent Application Publication Nos. WO / 1997 / 017458 A1, WQ / 2024 / 143429 A1 , and WO / 2020 / 208379 A1 , each of which is incorporated herein by reference.
[0162] Expression control sequences include efficient RNA processing signals such as splicing and polyadenylation (polyA) signals; appropriate transcription initiation, termination, promoter and enhancer sequences; sequences that stabilize cytoplasmic mRNA; sequences that enhance protein stability; sequences that enhance translation efficiency (e.g., Kozak consensus sequence); and in some embodiments, sequences that enhance secretion of the encoded transgene product. Expression control sequences, including promoters which are native, constitutive, inducible and / or tissue-specific, are known in the art and can be utilized with the compositions and methods disclosed herein
[0163] In some embodiments, the native promoter for the transgene is used. Without wishing to be bound by theory, the native promoter can mimic native expression of the transgene, or provide temporal, developmental, or tissue-specific expression, or expression in response to specific transcriptional stimuli. In some embodiments, the transgene is operably linked to other native expression control elements, such as enhancer elements, polyadenylation sites or Kozak consensus sequences, e g , to mimic the native expression.
[0164] In some embodiments, the transgene is operably linked to a tissue-specific promoter, e.g., a promoter active specifically in one or more CNS cell types or muscle cell types.
[0165] In some embodiments, a vector, e.g., a plasmid, carrying a transgene includes a selectable marker or a reporter gene. Such selectable reporters or marker genes can be used to signal the presence of the vector, e.g., plasmid, in bacterial cells. Other components of the vector, e.g., plasmid, include an origin of replication. Selection of these and other promoters and vector elements are conventional and many such sequences are available (see, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, NY, and references cited therein)
[0166] In some embodiments, an insect cell may be used in production of the compositions described herein or in the methods of making a dependoparvovirus particle described herein. For example, an insect cell line used can be from Spodoptera frugiperda, such as Sf9, SF21 , SF900+, drosophila cell lines, mosquito cell lines, e.g , Aedes albopictus derived cell lines, domestic silkworm cell lines, e.g., Bombyxmori cell lines, Trichoplusia ni cell lines such as High Five cells or Lepidoptera cell lines such as Ascalapha odorata cell lines. In some embodiments, the insect cells are susceptible to baculovirus infection, including High Five, Sf9, Se301 , SelZD2109, SeUCRI, SP900+, Sf21, BTI-TN-5B1-4, MG-1, Tn368, HzAml, BM-N, Ha2302, Hz2E5 and Ao38. Use of insect cells for expression of heterologous proteins is well recognized in the art, as are methods of introducing nucleic acids, such as vectors, e.g., insect-cell compatible vectors, into such cells and methods of maintaining such cells in culture. See, for example, O'Reilly et al , 1994, Baculovirus Expression Vectors, A Laboratory Manual. Oxford Univ. Press; Satnulski et al., 1989, J. Vir.63:3822-8; Kajigaya et al., 1991 PNAS 88:4646-50; Ruffin et al., 1992, J. Vir. 66:6922-30; Kimbauer et al ., 1996, Vir.21.9:37-44; Zhao et al., 2000, Vir.272:382-93; and U.S. Pat. No. 6,204,059, the contents of each of which are incorporated herein by reference in their entireties.
[0167] In certain embodiments, insect host cell systems, in combination with baculoviral systems (e g., as described by Luckow et al , 1988, Bio / Technology 6:47) is used In certain embodiments, the expression system is a Trichoplusia ni, Tn 5B1-4 insect cells / baculoviral system, which can be used for production of high levels of proteins, as described in U.S. Pat. No. 6,660,521 , incorporated herein by reference in its entirety.
[0168] Expansion, culture, transfection, infection, and storage of insect cells can be carried out in any cell culture media, cell transfection media or storage media known in the art. Nonlimiting examples of media are Hyclone SFX Insect Cell Culture Media, Expression System ESF AF Insect Cell Culture Medium, Basal IPL-41 Insect Cell Culture Media, ThermoFisher Sf90011 media, ThermoFisher Sf900111 media, and ThermoFisher Grace's Insect Media Insect cell mixtures and / or media can also comprise appropriate formulation additives or elements, including but not limited to salts, acids, bases, buffers, and surfactants (such as Poloxamer 188 / Pluronic F-68).
[0169] In some embodiments, the methods of the disclosure can be carried out with a mammalian cell type which allows for replication of dependoparvovirus or production of biologic products, and which can be maintained in culture. Host cells include cells derived from mammalian species including but not limited to, human, monkey, mouse, rat, rabbit, and hamster. Host cells can be of any suitable cell type, including but not limited to cell lines, fibroblasts, hepatocytes, tumor cells, and transformed cells. The mammalian cells used can be HEK293, HEK293T, HeLa, CHO, NS0, SP2 / 0, PER C6, Vero, RD, BHK, HT 1080, A549, Cos-7, ARPE-19, MRC-5, WEH1 , 3T3, 1.0T1 / 2, MDCK, COS 1, COS 7, BSC 1 , BSC 40, BMT 10, W138, Saos, C2C12, HepG2, L cells, primary fibroblast, hepatocyte and myoblast cells derived from mammals, COS cells, C127, 3T3, CHO, HeLa cells, KB cells, BHK, and other mammalian cell lines as described in U.S. Pat. Nos. 6,156,303, 5,387,484, 5,741 ,683, 5,691 ,176, 6,428,988 and 5,688,676, 6,541 ,258, the contents of each of which are incorporated herein by reference.
[0170] In some embodiments, the host cell comprises a nucleic acid encoding a variant capsid polypeptide disclosed herein, where the nucleic acid is integrated into the host cell genome. Such host cells include adenovirus rep and cap genes integrated into the genome. Transcription of the integratedrep and cap genes may be dependent upon introduction of certain helper virus sequences (e.g. , adenovirus E4, E2a and / or VA RNA) into the cell by transduction or other suitable means. Example plasmid free host cells are described in U S Patent Application Publication No. 2022 / 0025396 A1 , and U.S. Patent No. US 5,658,785, incorporated herein by reference.
[0171] In some embodiments, the host cells are trans-complementing packaging cell lines that provide functions deleted from a replication-defective helper virus, e.g., HEK293 cells or other Ea trans- complementing cells. In some embodiments, the packaging cell line 293-10-3 is used as described in U.S. Pat. No. 6,281 ,010, incorporated herein by reference.
[0172] In some embodiments, mammalian host cells (e g. 293T cells) can be in an adherent state (e.g., adhered / attached to a suitable surface of a cell culture flask, vial, tray, well, tube, etc.). In other embodiments, mammalian host cells can be in a suspended state (e.g., suspended in a medium).6.5.2. Viral Particle Production
[0173] In some embodiments, providing a cell comprising a nucleic acid described herein comprises introducing the nucleic acid to the cell, e.g., transfecting or transforming the cell with the nucleic acid. In embodiments, the nucleic acids of the disclosure are situated as a part of any genetic element (vector) which can be delivered to a host cell, e.g., naked DNA, a plasmid, phage, transposon, cosmid, episome, a protein in a non-viral delivery vehicle (e g , a lipid-based carrier), virus, etc which transfer the sequences carried thereon. Such a vector can be delivered by any suitable method, including transfection, liposome delivery, electroporation, membrane fusion techniques, viral infection, high velocity DNA- coated pellets, and protoplast fusion. A person of skill in the art possesses the knowledge and skill in nucleic acid manipulation to construct any embodiment of this invention and said skills include genetic engineering, recombinant engineering, and synthetic techniques. See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, NY.
[0174] In some embodiments, a vector of the disclosure comprises sequences encoding a dependoparvovirus variant capsid polypeptide as provided for herein or a fragment thereof. In some embodiments, a vector of the disclosure comprises sequences encoding a dependoparvovirus rep protein or a fragment thereof. Such a Rep coding region encodes at least for AAV Rep78, Rep68, Rep52, and Rep40, or functional homologs thereof. The Rep coding region is not required to include all wild-type genes but may be altered (e.g., by insertion, deletion, or mutation of one or more nucleotides) so long as the rep genes present provide for sufficient replication functions when expressed in the recombinant cell. The Rep coding region may be derived from any AAV serotype. In some embodiments, the Rep coding region is or comprises a rep gene encoding AAV2 Rep proteins, exemplary sequences of which are provided below.
[0175] AAV2 Rep78:MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRV SKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGA GGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNP NSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTA PDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTV PFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKK GGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQ NSNICFTHGQKDCLECFPVSESQPVSWKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ (SEQ ID NO:75)
[0176] AAV2 Rep68:MPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRV SKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGA GGGNKVVDECYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNP NSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTA PDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTV PFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTS NTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHWEVEHEFYVKK GGAKKRPAPSDADISEPKRVRESVAQPSTSDAEASINYADRLARGHSL (SEQ ID NO:76)
[0177] AAV2 Rep52:MELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDIS SNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFP FNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTT FEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADI SEPKRVRESVAQPSTSDAEASINYADRYQNKCSRHVGMNLMLFPCRQCERMNQNSNICFTHGQKDCLE CFPVSESQPVSVVKKAYQKLCYIHHIMGKVPDACTACDLVNVDLDDCIFEQ (SEQ ID NO:77)
[0178] AAV2 Rep40:MELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDIS SNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFP FNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTT FEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGGAKKRPAPSDADI SEPKRVRESVAQPSTSDAEASINYADRLARGHSL (SEQ ID NO:78)
[0179] In some embodiments the Rep coding region encodes for Rep sequences having at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% sequence identity to one or more AAV2 Rep proteins. In some embodiments, the Rep coding region comprises a nucleotide sequence encoding for a Rep78 protein having at least 80%, at least about 85%, at least about 90%, at least about 95%, at least 98%, at least 99%, or 100% sequence identity to AAV2 Rep78 In some embodiments, the Rep coding region comprises a nucleotide sequence encoding for a Rep68 protein having at least 80%, at least about 85%, at least about 90%, at least about 95%, at least 98%, at least 99%, or 100% sequence identity to AAV2 Rep68. In some embodiments, the Rep coding region comprises a nucleotide sequence encoding for a Rep52 protein having at least 80%, at least about 85%, at least about 90%, at least about 95%, at least 98%, at least 99%, or 100% sequence identity to AAV2 Rep52. In some embodiments, the Rep coding region comprises a nucleotide sequence encoding for a Rep40 protein having at least 80%, at least about 85%, at least about 90%, at least about 95%, at least 98%, at least 99%, or 100% sequence identity to AAV2 Rep40.
[0180] In some embodiments, the Rep coding sequence encodes for wild type Rep proteins. Alternatively, the Rep coding sequence may encode for one or more mutant Rep proteins having improved properties compared with wild type Rep proteins Examples of such mutant Rep proteins are described in U.S. Patent No. 11 ,060,070, incorporated herein by reference.
[0181] Additional exemplary Rep gene and protein sequences are disclosed as SEQ ID NOs: 7 to 15 and 20 to 22 of PCT Patent Application Publication No. WO / 2022 / 079429 A1, incorporated herein by reference.
[0182] In some embodiments, such vectors contain both dependoparvovirus cap and rep proteins. In vectors in which both AAV rep and cap are provided, in some embodiments, the dependoparvovirus rep and dependoparvovirus cap sequences are both of the same dependoparvovirus species or serotype origin, such as AAV9. Alternatively, the present embodiments also provides vectors in which the rep sequences are from a dependoparvovirus species or serotype which differs from that which is providing the cap sequences (e.g., AAV2 rep sequences and AAV9 cap sequences). In some embodiments, the rep and cap sequences are expressed from separate sources (e.g., separate vectors, or a host cell genome and a vector). In some embodiments, the rep sequences are fused in frame to cap sequences of a different dependoparvovirus species or serotype to form a chimeric dependoparvovirus vector.
[0183] In some embodiments, a vector of the disclosure comprises one or more helper sequences. Examples of helper sequences include E1a, E1b, E2a, E4, and VA Certain exemplary helper protein sequences are provided in Section 6 5 1 Additional AAV helper sequences are recognized in the art and include, for example, those described in U.S. Patent Application Publication Nos. 2004 / 0248288 A1 and 2022 / 0259572A1 , and in PCT Patent Application Publication Nos. WO / 1997 / 017458 A1 , WO / 2024 / 143429 A1 , and WO / 2020 / 208379 A1, each of which is incorporated herein by reference.
[0184] In some embodiments, the vectors of the disclosure further contain a payload, e.g , a minigene comprising a selected transgene, e g., flanked by dependoparvovirus 5' ITR and dependoparvovirus 3' ITR. In some embodiments, the ITR is from the same serotype as the variant capsid polypeptide In some embodiments, the ITR is of a different serotype than the variant capsid polypeptide. In some embodiments, the viral genome comprises two ITR sequence regions, wherein the ITRs are of the same serotype as one another. In some embodiments, the viral genome comprises two ITR sequence regions, wherein the ITRs are of different serotypes. Non-limiting examples include zero, one or both of the ITRs having the same serotype as the capsid. In one embodiment both ITRs of the viral genome of the AAV particle are AAV2 ITRs. Independently, each ITR may be about 100 to about 150 nucleotides in length. An ITR may be about 100-105 nucleotides in length, 106-110 nucleotides in length, 111-115 nucleotides in length, 116-120 nucleotides in length, 121-125 nucleotides in length, 126-130 nucleotides in length, 131-135 nucleotides in length, 136-140 nucleotides in length, 141-145 nucleotides in length or 146- 150 nucleotides in length. In one embodiment, the ITRs are 140-142 nucleotides in length. Nonlimiting examples of ITR lengths are 102, 105, 130, 140, 141 , 142, 145 nucleotides in length.
[0185] The vectors described herein, e.g., a plasmid, are useful for a variety of purposes, but are particularly well suited for use in production of recombinant dependoparvovirus particles comprising dependoparvovirus sequences or a fragment thereof, and in some embodiments, a payload.
[0186] In one aspect, the disclosure provides a method of making a dependoparvovirus particle (e.g. , a dependoparvovirus B particle, e.g., an AAV9 particle), or a portion thereof. In some embodiments, the method comprises culturing a host cell which contains a nucleic acid sequence encoding a dependoparvovirus variant capsid protein as provided for herein, or fragment thereof; a functional rep gene (e g., encoding Rep proteins as described herein); a payload, e g., a minigene comprising dependoparvovirus inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to promote packaging of the payload, e.g., minigene, into the dependoparvovirus capsid. In some embodiments, the components necessary to be cultured in the host cell to package a payload, e.g., minigene, in a dependoparvovirus capsid are provided to the host cell in trans. In some embodiments, any one or more of the required components (e.g., payload (e.g., minigene), rep sequences, cap sequences, and / or helper functions) are provided by a host cell which has been engineered to stably comprise one or more of the required components using methods known to those of skill in the art. In some embodiments, a host cell which has been engineered to stably comprise the required component(s) comprises it under the control of an inducible promoter. In some embodiments, the required component(s) are under the control of a constitutive promoter. Examples of suitable inducible and constitutive promoters are provided herein and further examples are known to those of skill in the art. In some embodiments, a selected host cell which has been engineered to stably comprise one or more components comprises a component under the control of a constitutive promoter and another component under the control of one or more inducible promoters. For example, a host cell which has been engineered to stably comprise the required components is generated from 293 cells (e.g., which comprise helper functions under the control of a constitutive promoter), which comprises the rep and / or cap proteins under the control of one or more inducible promoters.
[0187] In some embodiments, the payload (e.g., minigene), rep sequences, cap sequences, and helper functions required for producing a dependoparvovirus particle of the disclosure are delivered to the packaging host cell in the form of any genetic element which transfers the sequences carried thereon (e.g., in a vector or combination of vectors). The genetic element may be delivered by any suitable method, including those described herein. Methods used to construct genetic elements, vectors, and other nucleic acids of the disclosure are known to those with skill and include genetic engineering, recombinant engineering, and synthetic techniques. See, e.g., Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, NY. Similarly, methods of generating rAAV virions are well known and the selection of a suitable method is not a limitation on the present disclosure. See, e.g., K. Fisher et al, J. Virol, 70:520-532 (1993) and US Patent 5,478,745 Unless otherwise specified, the dependoparvovirus ITRs, and other selected dependoparvovirus components described herein, are readily selected from among any dependoparvovirus species and serotypes, e.g., AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh74, or AAV9 ITRs or other dependoparvovirus components may be readily isolated using techniques available to those of skill in the art from a dependoparvovirus species or serotype Dependoparvovirus species and serotypes may be isolated or obtained from academic, commercial, or public sources (e g , the American Type Culture Collection, Manassas, VA). In some embodiments, the dependoparvovirus sequences may be obtained through synthetic or other suitable means by reference to published sequences such as are available in the literature or in databases such as, e.g., GenBank or PubMed
[0188] Methods of expressing proteins (e.g. , recombinant or heterologous proteins, e.g., dependoparvovirus polypeptides) in insect cells are well documented, as are methods of introducing nucleic acids, such as vectors, e.g., insect-cell compatible vectors, into such cells and methods of maintaining such cells in culture. See, for example, METHODS IN MOLECULAR BIOLOGY, ed. Richard, Humana Press, N J (1995); O'Reilly et al., BACULOVIRUS EXPRESSION VECTORS, A LABORATORY MANUAL, Oxford Univ. Press (1994); Samulski et al., J. Vir. 63:3822-8 (1989); Kajigaya et al., Proc.Nat'l. Acad. Sci. USA 88:4646-50 (1991); Ruffing et al., J. Vir. 66:6922-30 (1992); Kirnbauer et al., Vir. 219:37-44 (1996); Zhao et al., Vir. 272:382-93 (2000); Samulski et al., and U.S. Pat. No. 6,204,059. In some embodiments, a nucleic acid construct encoding dependoparvovirus polypeptides (e.g., a dependoparvovirus genome) in insect cells is an insect cell-compatible vector. An “insect cellcompatible vector” as used herein refers to a nucleic acid molecule capable of productive transformation or transfection of an insect or insect cell. Exemplary biological vectors include plasmids, linear nucleic acid molecules, and recombinant viruses. Any vector can be employed as long as it is insect cellcompatible. The vector may integrate into the insect cell's genome or remain present extra- chromosomally. The vector may be present permanently or transiently, e.g., as an episomal vector. Vectors may be introduced by any means known in the art Such means include but are not limited to chemical treatment of the cells, electroporation, or infection. In some embodiments, the vector is a baculovirus, a viral vector, or a plasmid. Methods of dependoparvovirus capsid (e g., AAV) production in insect cells include, for example, those described in U.S. Patent Application Publication No.2024 / 0093231 A1, U.S. Patent No. 11,306,291 , Joshi et al , 2024, Methods Mol Biol, 2829:203-214, and Marwidi et al., 2024, Mol Ther Methods Clin Dev., 32(2)101228, incorporated herein by reference.
[0189] In some embodiments, a nucleic acid sequence encoding a dependoparvovirus polypeptide is operably linked to regulatory expression control sequences for expression in a specific cell type, such as Sf9 or HEK cells Techniques known to one skilled in the art for expressing foreign genes in insect host cells or mammalian host cells can be used with the compositions and methods of the disclosure. Methods for molecular engineering and expression of polypeptides in insect cells are described, for example, in Summers and Smith. A Manual of Methods for Baculovirus Vectors and Insect Culture Procedures, Texas Agricultural Experimental Station Bull. No. 7555, College Station, Tex. (1986); Luckow 1991 In Prokop et al., Cloning and Expression of Heterologous Genes in Insect Cells with Baculovirus Vectors' Recombinant DNA Technology and Applications, 97-152 (1986); King, L. A. and R. D Possee, The baculovirus expression system, Chapman and Hall, United Kingdom (1992); O'Reilly, D R., L. K. Miller, V. A. Luckow, Baculovirus Expression Vectors: A Laboratory Manual, New York (1992); W. H. Freeman and Richardson, C. D., Baculovirus Expression Protocols, Methods in Molecular Biology, volume 39 (1995); U.S. Pat. No. 4,745,051 ; US2003148506; and WO 03 / 074714. Promoters suitable for transcription of a nucleotide sequence encoding a dependoparvovirus polypeptide include the polyhedron, p10, p35 or IE-1 promoters and further promoters described in the above references are also contemplated.
[0190] In some embodiments, providing a cell comprising a nucleic acid described herein comprises acquiring a cell comprising the nucleic acid.
[0191] Methods of cultivating cells, cell-free systems, and other translation systems are known to those of skill in the art. In some embodiments, cultivating a cell comprises providing the cell with suitable media and incubating the cell and media for a time suitable to achieve viral particle production.
[0192] In some embodiments, a method of making a dependoparvovirus particle further comprises a purification step comprising isolating the dependoparvovirus particle from one or more other components (e.g., from a cell or media component).
[0193] In some embodiments, production of the dependoparvovirus particle comprises one or more (e.g., all) of: expression of dependoparvovirus polypeptides, assembly of a dependoparvovirus capsid, expression (e.g., duplication) of a dependoparvovirus genome, and packaging of the dependoparvovirus genome into the dependoparvovirus capsid to produce a dependoparvovirus particle. In some embodiments, production of the dependoparvovirus particle further comprises secretion of the dependoparvovirus particle into the media. The dependoparvovirus particle can be isolated from the collected media. In other embodiments, dependoparvovirus particles are isolated from host cells. For instance, adherent host cells can subsequently be collected by scraping and / or pelleting and suspended cells can be collected by pelleting and transferred into a receptacle. Collection steps can be repeated as necessary for full collection of produced cells. If necessary, host cell lysis can be achieved by consecutive freeze-thaw cycles (-80°C to 37°C), chemical lysis (such as adding detergent, e.g., triton), mechanical lysis, or by allowing the cell culture to degrade after reaching ~0% viability. Cellular debris can be removed by centrifugation and / or depth filtration.
[0194] In some embodiments, and as described elsewhere herein, the nucleic acid molecule encoding the variant capsid polypeptide is disposed in a dependoparvovirus genome. In some embodiments, and as described elsewhere herein, the nucleic acid molecule encoding the variant capsid polypeptide is packaged into a dependoparvovirus particle along with the dependoparvovirus genome as part of a method of making a dependoparvovirus particle described herein. In other embodiments, the nucleic acid molecule encoding the variant capsid polypeptide is not packaged into a dependoparvovirus particle made by a method described herein
[0195] In some embodiments, a method of making a dependoparvovirus particle described herein produces a dependoparvovirus particle comprising a payload (e.g., a payload described herein) and the variant capsid polypeptide. In some embodiments, the payload comprises a second nucleic acid (e.g., in addition to the dependoparvovirus genome), and production of the dependoparvovirus particle comprises packaging the second nucleic acid into the dependoparvovirus particle. In some embodiments, a cell, cell-free system, or other translation system for use in a method of making a dependoparvovirus particle comprises the second nucleic acid. In some embodiments, the second nucleic acid comprises an exogenous sequence (e.g., exogenous to the dependoparvovirus, the cell, or to a target cell or subject who will be administered the dependoparvovirus particle). In some embodiments, the exogenous sequence encodes an exogenous polypeptide. In some embodiments, the exogenous sequence encodes a therapeutic product.
[0196] In some embodiments, virus particles of the disclosure have a similar production efficiency to viral particles with a reference capsid polypeptide, for example, with the wild-type capsid polypeptide (SEQ ID NO:1). In some embodiments, production efficiency of viral particles of the disclosure is (a) atleast 0.1-fold, at least 0.2-fold, at least 0.3-fold, at least 0.4-fold, at least 0.5-fold, at least 0.6-fold, at least 0.7-fold, at least 0.8-fold, or at least 0.9-fold and / or (b) up to 1-fold, e.g., as compared to a viral particle with a reference capsid polypeptide, for example, with the wild-type capsid polypeptide (SEQ ID NO:1 ), or the production efficiency is within any range bounded by a value in (a) and a value in (b). In some embodiments, production efficiency is at least 0.5-fold as compared to a viral particle with the wild-type capsid polypeptide (SEQ ID NO:1 ). Production efficiency can be evaluated by producing viral particles having a variant capsid with a genome encoding a unique barcode and a fluorescent reporter gene under the control of a ubiquitous (e.g., CBh) or neuronal cell-type specific promoter (e.g., human synapsin) via transient triple transfection of adherent HEK293T followed by iodixanol gradient purification.
[0197] In some embodiments, a nucleic acid or polypeptide described herein is produced by a method known to one of skill in the art. In embodiments, the nucleic acids, polypeptides, and fragments thereof of the disclosure are produced by any suitable means, including recombinant production, chemical synthesis, or other synthetic means. Such production methods are within the knowledge of those of skill in the art and are not a limitation of the present invention.
[0198] Various methods and systems for dependoparvovirus production in host cells are recognized in the art and are contemplated herein including, for example, those described in U.S. Patent Application Publication Nos. 20220064671 A1 , 20220259572 A1 , 20220025396 A1 and PCT Patent Application Publication Nos. WO / 1999 / 011764 A2, WO / 2023 / 178220 A1, WQ / 2020 / 208379 A1 , WO / 2023 / 143063 A1 , WO / 2023 / 239627 A2, WO / 2021 / 156609 A1 , and WO / 2021 / 113767 A1 , each of which is incorporated herein by reference in its entirety.6.6. Applications
[0199] The disclosure is directed, in part, to compositions comprising a nucleic acid, polypeptide, or particles described herein. The disclosure is further directed, in part, to methods utilizing a composition, nucleic acid, polypeptide, or particles described herein As will be apparent based on the disclosure, nucleic acids, polypeptides, particles, and methods disclosed herein have a variety of utilities.
[0200] The disclosure is directed, in part, to a vector comprising a nucleic acid described herein, e.g., a nucleic acid encoding a variant capsid polypeptide. Many types of vectors are known to those of skill in the art. In some embodiments, a vector comprises a plasmid. In some embodiments, the vector is an isolated vector, e.g., removed from a cell or other biological components.
[0201] The disclosure is directed, in part to a cell, cell-free system, or other translation system, comprising a nucleic acid or vector described herein, e.g., a nucleic acid or vector comprising a nucleic acid molecule encoding a variant capsid polypeptide. In some embodiments, the cell, cell-free system, or other translation system is capable of producing dependoparvovirus particles comprising the variant capsid polypeptides. In some embodiments, the cell, cell-free system, or other translation system comprises a nucleic acid comprising a dependoparvovirus genome or components of a dependoparvovirus genome sufficient to promote production of dependoparvovirus particles comprising the variant capsid polypeptides.
[0202] In some embodiments, the cell, cell-free system, or other translation system further comprises one or more non-dependoparvovirus nucleic acid sequences that promote dependoparvovirus particle production and / or secretion. Said sequences are referred to herein as helper sequences. In someembodiments, a helper sequence comprises one or more genes from another virus, e.g., an adenovirus or herpes virus. In some embodiments, the presence of a helper sequence is necessary for production and / or secretion of a dependoparvovirus particle. In some embodiments, a cell, cell-free system, or other translation system comprises a vector, e.g., plasmid, comprising one or more helper sequences.
[0203] In some embodiments, a cell, cell-free system, or other translation system comprises a first nucleic acid and a second nucleic acid, wherein the first nucleic acid comprises sequences encoding one or more dependoparvovirus genes (e g., a Cap gene, a Rep gene, or a complete dependoparvovirus genome) and a helper sequence, and wherein the second nucleic acid comprises a payload. In some embodiments, a cell, cell-free system, or other translation system comprises a first nucleic acid and a second nucleic acid, wherein the first nucleic acid comprises sequences encoding one or more dependoparvovirus genes (e g., a Cap gene, a Rep gene, or a complete dependoparvovirus genome) and a payload, and wherein the second nucleic acid comprises a helper sequence. In some embodiments, a cell, cell-free system, or other translation system comprises a first nucleic acid and a second nucleic acid, wherein the first nucleic acid comprises a helper sequence and a payload, and wherein the second nucleic acid comprises sequences encoding one or more dependoparvovirus genes (e.g., a Cap gene, a Rep gene, or a complete dependoparvovirus genome). In some embodiments, a cell, cell-free system, or other translation system comprises a first nucleic acid, a second nucleic acid, and a third nucleic acid, wherein the first nucleic acid comprises sequences encoding one or more dependoparvovirus genes (e g., a Cap gene, a Rep gene, or a complete dependoparvovirus genome), the second nucleic acid comprises a helper sequence, and the third nucleic acid comprises a payload.
[0204] In some embodiments, the first nucleic acid, second nucleic acid, and optionally third nucleic acid are situated in separate molecules, e.g., separate vectors or a vector and genomic DNA. In some embodiments, one, two, or all of the first nucleic acid, second nucleic acid, and optionally third nucleic acid are integrated (e.g., stably integrated) into the genome of a cell.
[0205] In embodiments, a cell of the disclosure is generated by transfecting a suitable cell with a nucleic acid described herein In some embodiments, a method of making a dependoparvovirus particle comprising a variant capsid polypeptide as provided for herein or improving a method of making a dependoparvovirus particle comprises providing a cell described herein. In some embodiments, providing a cell comprises transfecting a suitable cell with one or more nucleic acids described herein.
[0206] Many types and kinds of cells suitable for use with the nucleic acids and vectors described herein are known in the art. In some embodiments, the cell is a human cell. In some embodiments, the cell is an immortalized cell or a cell from a cell line known in the art. In some embodiments, the cell is an HEK293 cell. In some embodiments, the cell is an HEK293T cell.6.6.1 . Methods of delivering a payload
[0207] The disclosure is directed, in part, to a method of delivering a payload to a cell, e.g., a cell in a subject or in a sample. In some embodiments, a method of delivering a payload to a cell comprises contacting the cell with a dependoparvovirus particle comprising a variant capsid polypeptide (e.g., described herein) comprising the payload The disclosure also includes a dependoparvovirus particle comprising a variant capsid polypeptide (e.g., described herein) comprising a payload described herein for use in the methods of delivering a payload described herein In some embodiments, thedependoparvovirus particle is a dependoparvovirus particle described herein and comprises a payload described herein. In some embodiments, the cell is a CNS cell (e.g., a neuron (e.g., an excitatory neuron, interneurons, or medium spiny neuron), astrocyte, glial cell, oligodendrocyte). In some embodiments, the cell is a skeletal muscle cell. Non-limiting examples of skeletal muscles include the biceps, the triceps, the quadriceps, the tibialis interior, the gastrocnemius muscle, and diaphragm. In some embodiments, the cell is a cardiac muscle cell. In some embodiments, the method is conducted ex vivo. In some embodiments, the cell is a cell in an ex vivo sample that has been obtained from a subject.
[0208] In some embodiments, the payload comprises a transgene. In some embodiments, the transgene is a nucleic acid sequence heterologous to the vector sequences flanking the transgene which encodes a polypeptide, RNA (e g , a miRNA or siRNA) or other product of interest In embodiments, the nucleic acid of the transgene is operatively linked to a regulatory component in a manner sufficient to promote transgene transcription, translation, and / or expression in a host cell.
[0209] In aspects, a transgene is any polypeptide- or RNA-encoding sequence and the transgene selected will depend upon the use envisioned In some embodiments, a transgene comprises a reporter sequence, which upon expression produces a detectable signal. Such reporter sequences include, without limitation, DNA sequences encoding colorimetric reporters (e g., -lactamase, p-galactosidase (LacZ), alkaline phosphatase), cell division reporters (e.g., thymidine kinase), fluorescent or luminescence reporters (e.g., green fluorescent protein (GFP) or luciferase), resistance conveying sequences (e.g., chloramphenicol acetyltransferase (CAT)), or membrane bound proteins including to which high affinity antibodies directed thereto exist or can be produced by conventional means, e.g., comprising an antigen tag, e.g., hemagglutinin or Myc.
[0210] In some embodiments, a reporter sequence operably linked with regulatory elements which drive their expression, provide signals detectable by conventional means, including enzymatic, radiographic, colorimetric, fluorescence or other spectrographic assays, fluorescent activating cell sorting assays and immunological assays, including enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA) and immunohistochemistry In some embodiments, the transgene encodes a product which is useful in biology and medicine, such as RNA, proteins, peptides, enzymes, dominant negative mutants. In some embodiments, the RNA comprises a tRNA, ribosomal RNA, dsRNA, catalytic RNAs, small hairpin RNA, siRNA, trans-splicing RNA, and antisense RNAs. In some embodiments, the RNA inhibits or abolishes expression of a targeted nucleic acid sequence in a treated subject (e.g., a human or animal subject).
[0211] In some embodiments, the transgene is used to correct or ameliorate gene deficiencies. In some embodiments, gene deficiencies include deficiencies in which normal genes are expressed at less than normal levels or deficiencies in which the functional gene product is not expressed. In some embodiments, the transgene encodes a therapeutic protein or polypeptide which is expressed in a host cell. In some embodiments, a dependoparvovirus particle comprises or delivers multiple transgenes, e.g., to correct or ameliorate a gene defect caused by a multi-subunit protein. In some embodiments, a different transgene (e.g., each situated / delivered in a different dependoparvovirus particle, or in a single dependoparvovirus particle) is used to encode each subunit of a protein, or to encode different peptides or proteins, e.g., when the size of the DNA encoding the protein subunit is large, e.g., for immunoglobulin, platelet-derived growth factor, or dystrophin protein. In some embodiments, different subunits of a protein are encoded by the same transgene, e.g., a single transgene encoding each of thesubunits with the DNA for each subunit separated by an internal ribozyme entry site (IRES). In some embodiments, the DNA is separated by sequences encoding a 2A peptide, which self-cleaves in a post- translational event. See, e.g., Donnelly et al, J. Gen. Virol., 78(Pt 1 ): 13-21 (January 1997); Furler, et al, Gene Then, 8(11 ):864-873 (June 2001); Klump et al., Gene 7her 8(10):811-817 (May 2001) (incorporated herein by reference in its entirety).
[0212] In some embodiments, virus particles comprising a genome are provided, wherein the genome includes a nucleic acid expression construct. The nucleic acid expression construct can include a heterologous transgene and one or more regulatory elements.
[0213] In some embodiments, the regulatory elements include a promotor, e g., a promoter that is active in a target cell or tissue type of interest. In some embodiments, the promoter is a ubiquitous promoter. In other embodiments, the promoter is selective or specific to a target cell or tissue type (e.g , CNS and / or muscle (e.g. broad muscle expression or skeletal muscle or cardiac muscle)), and, optionally, is less (or not) active in a cell or tissue type where transgene expression is not desired (e.g., liver, spleen, PNS, or any combination of two or all of the foregoing). A promoter that is selective for a first cell or tissue type over a second cell or tissue type is active in the first cell or tissue type and less active or silent in the second cell or tissue type. In some embodiments, the promoter is a CNS-specific or ONS-selective promoter. In some embodiments, the promoter is a muscle-specific promoter-specific or muscle- selective promoter. In some embodiments, the promoter is active in both CNS and muscle tissue.
[0214] In some embodiments, the promoter is a ubiquitous or constitutive promoter active in a mammalian cell, for example a human cell, for example, in a human cell type of interest. In some embodiments, the cell type is a CNS cell such as, for example, a neuronal cell, a glial cell, an endothelia cell, and the like In some embodiments, the cell type is a skeletal muscle cell. In some embodiments, the cell type is a cardiac muscle cell. Examples of ubiquitous promoters include, but are not limited, to a CAG promoter (hybrid from a cytomegalovirus early enhancer element, a chicken-beta actin promoter, e.g., the first exon and the first intron of the chicken beta actin gene, and the splice acceptor of the rabbit beta globin gene), chicken-beta actin promoter, CBA promoter, CBh promoter, CB6 promoter, CMV promoter, human EF1-alpha promoter, PGK promoter, ubiquitin C (UBC) promoter and fragments thereof. In some embodiments, the promoter is a tissue-specific promoter, for example, a promoter specific in CNS tissue or cells of the CNS. Examples of CNS-specific promoters include but are not limited to a synapsin (SYN or SYN1) promoter, a neuron-specific enolase (NSE) promoter, a Ca27calmodulin-dependent kinase subunit a (CaMKII) promoter, a synapsin I with a minimal CMV sequence (Synl-minCMV) promoter, a glial fibrillary acidic protein (GFAP) promoter, a internexin neuronal intermediate filament protein alpha (INA) promoter, a nestin (NES) promoter, a neurofilament light chain (NfL) promoter, a neurofilament heavy chain (NfH) promoter, a myelin-associated oligodendrocyte basic protein (MOBP) promoter, a myelin basic protein (MBP) promoter, a tyrosine hydroxylase (TH) promoter, a forkhead box A2 (FOXA2) promoter, a aldehyde dehydrogenase 1 family member L1 (ALDH1L1 ) promoter, a glutamate decarboxylase 2 (GAD2) promoter, a riken gene A930098C07Rik (A93) promoter, a somatostatin (SST) promoter, a platelet derived growth factor receptor alpha (PDGFRA) promoter, a glutamate receptor metabotropic 1 (GRM1) promoter, a C-type natriuretic peptide precursor (NPPC) promoter, a adrenomedullin (ADM) promoter, a type 2 lactosamine alpha-2, 3-sialyltransferase (ST3GAL6) promoter, a ras responsive element binding protein 1 (RREB1) promoter, a deiodinase iodothyronine type II (DIO2)promoter, an excitatory amino acid transporter 2 (EAAT2) promoter, a nuclear receptor subfamily 2 group F member 2 (NR2F2) promoter, a platelet-derived growth factor (PDGF) promoter, a methyl-CpG binding protein 2 (MeCP2) promoter, and mouse, primate or human homologs of any of the forgoing, and fragments (e.g., active fragments) of any of the foregoing. In embodiments, the CNS-specific promoter is a neuron specific promoter. In embodiments, the CNS-specific promoter is an astrocyte-specific promoter. In some embodiments, the promoter is a promoter specific in muscle tissue or muscle cells, e.g., a desmin, MCK, TNNT2, or smooth muscle 22 (SM22) promoter. Further exemplary muscle specific promoters are described below.
[0215] In some embodiments, the promoter is a CBh promoter. An exemplary CBh promoter sequence is set forth as SEQ ID NO: 14 In some embodiments, the CBh promoter comprises a nucleotide sequence having at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 14
[0216] In other embodiments, the promoter is a synapsin promoter, for example a human synapsin promoter (hSYN). An exemplary hSYN promoter sequence is set forth as SEQ ID NO:15. In some embodiments, the hSYN promoter comprises a nucleotide sequence having at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO:15.
[0217] In some embodiments, the nucleic acid expression construct comprises an intron. In embodiments, the intron is disposed between the promoter and the heterologous transgene. In some aspects, the intron is disposed 5’ to the heterologous transgene on the expression construct, for example immediately 5’ to the heterologous transgene or 100 nucleotides or less 5’ to the heterologous transgene. In some aspects, the intron is a chimeric intron derived from human b-globin and Ig heavy chain (also known as b- globin splice donor / immunoglobulin heavy chain splice acceptor intron, or b-globin / IgG chimeric intron; Reed, R., et al. Genes and Development, 1989, incorporated herein by reference in its entirety). In other aspects, the intron is a VH4 intron or a SV40 intron
[0218] As provided herein, in some embodiments, virus particles comprising a payload, wherein the payload includes a nucleic acid that includes a heterologous transgene are provided. In some embodiments, the heterologous transgene encodes an RNA interference agent, for example a siRNA, shRNA or other interfering nucleic acid.
[0219] In some embodiments, the payload includes a heterologous transgene that encodes a therapeutic polypeptide. In some aspects, the heterologous transgene is a human gene or fragment thereof. In some aspects, the therapeutic polypeptide is a human protein. In some embodiments, the heterologous transgene of the virus particle encodes a molecule useful in treating a disease, and the virus particle is administered to a patient in need thereof to treat said disease. In some aspects the payload comprises a molecule that is effective in treating chronic CNS disease, such as, for example, an RNA interference nucleotide (e g , shRNA, siRNA or miRNA that inhibits APOL-1 ) Examples of diseases (and heterologous transgenes or molecules encoded by said heterologous transgenes) according to the present disclosure include: MPSI (alpha-L-iduronidase ( IDUA)); MPS II - Hunter syndrome (iduronate-2- sulfatase (IDS)); Ceroid lipofuscinosis-Batten disease (CLN1, CLN2, CLN10, CLN13, CLN5, CLN11 , CLN4, CNL14, CLN3, CLN6, CLN7, CLN8, CLN12); MPS Illa - Sanfilippo Type A syndrome (heparin sulfate sulfatase (also called N-sulfoglucosamine sulfohydrolase (SGSH)); MPS 111 B - Sanfilippo Type bsyndrome (N-acetyl-alpha-D-glucosaminidase (NAGLU)); MPS VI - Maroteaux-Lamy syndrome (arylsulfatase B); MPS IV A - Morquio syndrome type A (GALNS); MPS IV B - Morquio syndrome type B (GLB1); chronic or neuropathic pain; Osteogenesis Imperfecgta Type I, II, III or IV (COL1AI and / or COL1A2); hereditary angioedema (SERPING1 , C1 NH); Osteogenesis Imperfecta Type V (IFITM5); Osteogenesis Imperfecta Type VI (SERPINF1); Osteogenesis Imperfecta Type VII (CRTAP); Osteogenesis Imperfecta Type VIII (LEPRE1 and / or P3H1 ); Osteogenesis Imperfecta Type IX (PPIB); Gaucher disease type I, II and III (Glucocerebrosidase; GBAI); Parkinson's Disease (Glucocerebrosidase; GBAI and / or dopamine decarboxylase); Pompe (acid maltase; GAA; hGAA); Metachromatic leukodystrophy (Aryl sulfatase A); MPS VII - Sly syndrome (beta-glucuronidase); MPS VIII (glucosamine- 6-sulfate sulfatase); MPS IX (Hyaluronidase); maple syrup urine disease (BCKDHA, BCKDHB, and / or DBT); Niemann-Pick disease (Sphingomyelinase); Parkinson’s disease (anti-alpha synuclein RNAi); Alzheimer’s disease (anti-mutant APP RNAi); Niemann-Pick disease without sphingomyelinase deficiency (NPC1 or NPC gene encoding a cholesterol metabolizing enzyme); Tay-Sachs disease (alpha subunit of beta-hexosaminidase); Sandhoff disease (both alpha and beta subunit of betahexosaminidase); Fabry Disease (alpha-galactosidase); Fucosidosis (fucosidase (FUCAI)); Alpha- mannosidosis (alpha-mannosidase); Beta-mannosidosis (beta-mannosidase); Wolman disease (cholesterol ester hydrolase); Dravet syndrome (SCN1A, SCN1 B, SCN2A, GABRG2); Parkinson's disease (Neurturin); Parkinson's disease (glial derived growth factor (GDGF)); Parkinson's disease (tyrosine hydroxylase); frontotemporal dementia (progranulin); Angleman syndrome (ubiquitin protein ligase 3A (UBE3A), gene editing systems targeting a UBE3A inhibitory RNA (UBE3A-anitsense transcript)); Parkinson's disease (glutamic acid decarboxylase; FGF-2; BDGF); Spinal Muscular Atrophy (SMN, including SMN1 or SMN2); Friedreich's ataxia (Frataxin); Amyotrophic lateral sclerosis (ALS) (S0D1 inhibitor, e.g., anti-S0D1 RNAi); Glycogen Storage Disease la (Glucose-6-phosphatase); XLMTM (MTMI); Crigler Najjar (UGTIAI); CPVT (CASQ2); spinocerebellar ataxia (ATXN2; ATXN3 or other ATXN gene; anti-mutant Machado-Joseph disease / SCA3 allele RNAi); Rett syndrome (MECP2 or fragment thereof); Achromatopsia (CNGB3, CNGA3, GNAT2, PDE6C); Choroidermia (CDM); Danon Disease (LAMP2); Cystic Fibrosis (CFTR or fragment thereof); Duchenne Muscular Dystrophy (Mini- / MicroDystrophin Gene); SARS-Cov-2 infection (anti-SARS-Cov-2 RNAi, SARS-Cov-2 genome fragments or S protein (including variants)); Limb Girdle Muscular Dystrophy Type 2C - Gamma-sarcoglycanopathy (human-alpha-sarcoglycan); Advanced Heart Failure (SERCA2a); Rheumatoid Arthritis (TNFR:Fc Fusion; anti-TNF antibody or fragment thereof); Leber Congenital Amaurosis (GAA); X-linked adrenoleukodystrophy (ABCD1); Limb Girdle Muscular Dystrophy Type 2C - Gamma-sarcoglycanopathy (gamma-sarcoglycan); Angelman syndrome (UBE3A); Retinitis Pigmentosa (hMERTK); Age-Related Macular Degeneration (sFLTCH ); Phelan-McDermid syndrome (SHANK3; 22q13.3 replacement); Becker Muscular Dystrophy and Sporadic Inclusion Body Myositis (huFollistatin344); Parkinson's Disease (GDNF); Metachromatic Leukodystrophy - MLD (cuARSA); Hepatitis C (anti-HCV RNAi); Limb Girdle Muscular Dystrophy Type 2D (hSGCA); Human Immunodeficiency Virus Infections; (PG9DP); Acute Intermittant Porphyria (PBGD); Leber's Hereditary Optical Neuropathy (PIND4v2); Alpha-1 Antitrypsin Deficiency (alphalAT); X-linked Retinoschisis (RS1 ); Choroideremia (hCHM); Giant Axonal Neuropathy (GAN); Hemophilia B (Factor IX); Homozygous FH (hLDLR); Dysferlinopathies (DYSF); Achromatopsia (CNGA3 or CNGB3); Progressive supranuclear palsy (MAPT; anti-Tau; anti-MAPT RNAi); Ornithine Transcarbamylase deficiency (OTC); Hemophilia A (Factor VIII); Age-related macular degeneration(AMD), including wetAMD (anti-VEGF antibody or RNAi); X-Linked Retinitis Pigmentosa (RPGR); Myotonic dystrophy Type 1 (DMPK; anti-DMPK RNAi, including anti-CTG trinucleotide repeat RNAi); Myotonic dystrophy Type 2 (CNBP); Facioscapulohumeral muscular dystrophy (D4Z4 DNA); oculopharynggeal muscular dystrophy (PABPN1; mutated PABPN1 inhibitor (e.g., RNAi)); Mucopolysaccharidosis Type VI (hARSB); Leber Hereditary Optic Neuropathy (ND4); X-Linked myotubular Myopathy (MTMI); Crigler-Najjar Syndrome (UGTIAI); Retinitis Pigmentosa (hPDE6B); Mucopolysaccharidosis Type 3B (hNAGLU); Duchenne Muscular Dystrophy (GALGT2); Alzheimer's Disease (NGF; ApoE4; ApoE2; ApoE3; Anti-ApoE RNAi, MAPT, anti-Tau antibody, anti-amyloid beta antibody (e.g., aducanumab)); multiple system atrophy; Familial Lipoprotein Lipase Deficiency (LPL); Alpha-1 Antitrypsin Deficiency (hAAT); Leber Congenital Amaurosis 2 (hRPE65v2); Batten Disease; Late Infantile Neuronal Lipofuscinosis (CLN2); Huntington’s disease (HTT; anti-HTT RNAi); Fragile X syndrome (FMR1 ); Fragile X-associated tremor / ataxia syndrome (FMR1 ), Premature ovarian aging (FMR1 ), Polycystic ovarian syndrome (FMR1), Leber's Hereditary Optical Neuropathy (PIND4v2); Aromatic Amino Acid Decarboxylase Deficiency (hAADC); Retinitis Pigmentosa (hMERKTK); and Retinitis Pigmentosa (RLBPI). In some embodiments, the CNS disease is a tauopathy (e.g., Alzheimers’ disease, progressive supranuclear palsy, frontotemporal dementia (Pick disease), corticobasal degeneration, argyrophilic grain disease, globular glial tauopathies, neurofibrillary tangle dementia, chronic traumatic encephalopathy (CTE), or aging-related tau astrogliopathy) and the payload is an anti- Tau antibody or antisense oligonucleotide targeting MAPT. In some aspects, the payload comprises a molecule that is effective in treating muscle-related disease. Exemplary, non-limiting muscle-related diseases are described below.
[0220] In some embodiments, the heterologous transgene encodes a therapeutic polypeptide. In some aspects, the heterologous transgene is a human gene or fragment thereof. In some aspects, the therapeutic polypeptide is a human protein In some aspects, the heterologous transgene encodes an antibody or fragment thereof (for example an antibody light chain, an antibody heavy chain, a Fab or an scFv) Examples of antibodies or fragments thereof that are encoded by the heterologous transgene include but are not limited to: and an anti-Ab antibody (e g., solanezumab, GSK933776, and lecanemab), anti-sortilin ( e.g , AL-001 ), anti-Tau (e.g., ABBV-8E12, UCB-0107, and Nl- 105), anti-SEMA4D (e.g., VX15 / 2503), anti-alpha synuclein (e.g., prasinezumab, NI-202, and MED-1341 ), anti- SOD1 (e.g , Nl- 204), anti-CGRP receptor (e.g., eptinezumab, fremanezumab, or galcanezumab), anti-VEGF (e.g., sevacizumab, ranibizumab, bevacizumab, and brolucizumab), anti-EpoR (e g , LKA-651, ), anti-ALKI (e.g., ascrinvacumab), anti-C5 (e g., tesidolumab, ravulizumab, and eculizumab), anti-CD105 (e.g., carotuximab), anti-CCIQ (e.g , ANX-007), anti-TNFa (e.g., adalimumab, infliximab, and golimumab), anti- RGMa (e.g., elezanumab), anti-TTR (e.g., NI-301 and PRX-004), anti-CTGF (e.g., pamrevlumab), anti- IL6R (e.g., satralizumab, tocilizumab, and sarilumab), anti-l L6 (e.g., siltuximab, clazakizumab, sirukumab, olokizumab, and gerilimzumab), anti-IL4R (e.g., dupilumab), anti-IL17A (e.g., ixekizumab and secukinumab), anti-IL5R (e.g., reslizumab), anti-IL-5 (e.g., benralizumab and mepolizumab), anti-IL13 (e g , tralokinumab), anti-IL12 / IL23 (e g , ustekinumab), anti-CD 19 (e g , inebilizumab), anti-IL31RA (e g , nemolizumab), anti-ITGF7 mAb (e.g., etrolizumab), anti-SOST mAb (e.g., romosozumab), anti-lgE (e.g., omalizumab), anti-TSLP (e.g , nemolizumab), anti-pKal mAb (e.g., lanadelumab), anti-ITGA4 (e.g., natalizumab), anti- ITGA4B7 (e.g., vedolizumab), anti-BLyS (e.g., belimumab), anti-PD-1 (e.g., nivolumab and pembrolizumab), anti-RANKL (e.g., denosumab), anti-PCSK9 (e.g., alirocumab and evolocumab),anti-ANGPTL3 (e.g., evinacumab*), anti-OxPL (e.g., E06), anti-fD (e.g., lampalizumab), or anti-MMP9 (e.g., andecaliximab), optionally wherein the heavy chain (Fab and Fc region) and the light chain are separated by a self-cleaving furin (F) / F2A or furin (F) / T2A, IRES site, or flexible linker, for example, ensuring expression of equal amounts of the heavy and the light chain polypeptides
[0221] In some embodiments, the virus particle comprises a heterologous transgene encoding a genome editing system. Examples include a CRISPR genome editing system (e.g., one or more components of a CRISPR genome editing system such as, for example, a guide RNA molecule and / or a RNA-guided nuclease such as a Cas enzyme such as Cas9, Cpf1 and the like), a zinc finger nuclease genome editing system, a TALEN genome editing system or a meganuclease genome editing system. In embodiments, the genome editing system targets a mammalian, e g , human, genomic target sequence In embodiments, the virus particle includes a heterologous transgene encoding a targetable transcription regulator. Examples include a CRISPR-based transcription regulator (for example, one or more components of a CRISPR-based transcription regulator, for example, a guide RNA molecule and / or a enzymatically-inactive RNA-guided nuclease / transcription factor (“TF”) fusion protein such as a dCas9- TF fusion, dCpf1-TF fusion and the like), a zinc finger transcription factor fusion protein, a TALEN transcription regulator or a meganuclease transcription regulator.
[0222] In some embodiments, components of a therapeutic molecule or system are delivered by more than one unique virus particle (e.g., a population that includes more than one unique virus particles). In other embodiments, the therapeutic molecule or components of a therapeutic molecule or system are delivered by a single unique virus particle (e.g., a population that includes a single unique virus particle).
[0223] In embodiments, the transgene encodes any biologically active product or other product, e.g , a product desirable for study Suitable transgenes may be readily selected by persons of skill in the art, such as those, but not limited to, those described herein.
[0224] Other examples of proteins encoded for by the transgene include, but are not limited to, colony stimulating factors (CSF); blood factors, such as p-globin, hemoglobin, tissue plasminogen activator or an analog thereof such as reteplase, lanoteplase or tenecteplase, and coagulation factors; interleukins; soluble receptors, such as soluble TNF-a. receptors, soluble VEGF receptors, soluble interleukin receptors (e.g , soluble IL-1 receptors and soluble type II IL-1 receptors), or ligand-binding fragments of a soluble receptor; growth factors, such as keratinocyte growth factor (KGF), stem cell factor (SCF), or fibroblast growth factor (FGF, such as basic FGF and acidic FGF); enzymes; chemokines,; enzyme activators, such as tissue plasminogen activator; angiogenic agents, such as vascular endothelial growth factors, glioma-derived growth factor, angiogenin, or angiogenin-2; anti-angiogenic agents, such as a soluble VEGF receptor; a protein vaccine; neuroactive peptides, such as nerve growth factor (NGF) or oxytocin; thrombolytic agents; tissue factors; macrophage activating factors; tissue inhibitors of metalloproteinases; or IL-1 receptor antagonists.
[0225] In embodiments, the disclosure provides a nucleotide sequence which encodes a molecule for the treatment of Alzheimer’s disease. In embodiments, the molecule for the treatment of Alzheimer’s disease comprises an inhibitory nucleic acid molecule (e.g , an antisense oligonucleotide or inhibitory RNA (e.g., siRNA, miRNA or shRNA molecule). In embodiments, the molecule for the treatment of Alzheimer’s disease comprises an inhibitory nucleic acid molecule (e g., an antisense oligonucleotide orinhibitory RNA (e.g., siRNA, miRNA or shRNA molecule) targeting beta-amyloid, alpha-synuclein, Tau, TREM, e.g., TREM2, or an apolipoprotein (APO) E protein, e.g. APOE1, APOE2, APOE3 or APOE4.
[0226] In embodiments, the molecule for the treatment of Alzheimer’s disease comprises a genome editing system (for example a zinc finger nuclease, a meganuclease, a TALEN, or an RNA-guided genome editing system (e.g. a Gas polypeptide and a guide RNA molecule). In embodiments the genome editing system targets a genetic region encoding a beta-amyloid protein or a Tau protein. In embodiments, the genome editing system targets MSA4
[0227] In embodiments, the molecule for the treatment of Alzheimer’s disease is an antibody or antigenbinding fragment thereof (e.g., as scFV). In embodiments, the molecule for the treatment of Alzheimer’s disease is a human protein or fragment or variant thereof. In embodiments, the molecule for the treatment of Alzheimer’s disease is an inhibitor of beta-amyloid aggregation. In embodiments, the molecule for the treatment of Alzheimer’s disease is an inhibitor of alpha-synuclein. In embodiments, the molecule for the treatment of Alzheimer’s disease is an anti-beta amyloid antibody, e.g., gantenerumab, crenezumab, aducanumab, lecanemab, bapineuzumab, solanezumab, donanemab or trontinemab (which is an anti-beta amyloid / anti-transferrin receptor bispecific antibody) In embodiments, the molecule for the treatment of Alzheimer’s disease is a Tau inhibitor, e.g., an anti-tau antibody (e.g., semorinemab). In embodiments, the molecule for the treatment of Alzheimer’s disease is an anti-TREM antibody or antigen-binding fragment thereof. In embodiments, the molecule for the treatment of Alzheimer’s disease is human nerve growth factor or a fragment or variant thereof. In embodiments, the molecule for the treatment of Alzheimer’s disease is human brain-derived neurotrophic factor or a fragment or variant thereof In embodiments, the molecule for the treatment of Alzheimer’s disease is human synapsin-caveolin-1 (SynCavl ) or a fragment or variant thereof.
[0228] Accordingly, in certain aspects, is the disclosure provides a virus particle comprising (a) a variant capsid polypeptide described herein, e.g., a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Alzheimer’s disease, for example as described herein, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0229] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described in Section 6.2; (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Alzheimer’s disease, for example as described herein, and (ii) a promoter operably linked to said nucleotide sequence.
[0230] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Alzheimer’s disease, for example gantenerumab or an antigen binding fragment thereof, and (ii) a promoter operablylinked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0231] In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Alzheimer’s disease, for example crenezumab or an antigen binding fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g , two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0232] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of myasthenia Gravis disease, for example an anti-IL-6 antibody (e g., satralizumab) or antigen-binding fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary
[0233] In embodiments, the disclosure provides a nucleotide sequence which encodes a molecule for the treatment of Parkinson’s disease. In embodiments, the molecule for the treatment of Parkinson’s disease comprises an inhibitory nucleic acid molecule (e.g , an antisense oligonucleotide or inhibitory RNA (e.g., siRNA, miRNA or shRNA molecule). In embodiments, the molecule for the treatment of Parkinson’s disease comprises an inhibitory nucleic acid molecule (e g., an antisense oligonucleotide or inhibitory RNA (e g , siRNA, miRNA or shRNA molecule) targeting SNCA An exemplary accession number for human SNCA is set forth in T able 3, together with example antisense oligonucleotide targeting SNCA.
[0234] In embodiments, the molecule for the treatment of Parkinson’s disease comprises a genome editing system (for example a zinc finger nuclease, a meganuclease, a TALEN, or an RNA-guided genome editing system (e.g. a Cas polypeptide and a guide RNA molecule). In embodiments the genome editing system targets a genetic region encoding an alpha-synuclein protein (e.g., SNCA gene).
[0235] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Parkinson’s disease, for example an anti-alpha synuclein antibody (e.g., prasinezumab or BIIB054) or antigen-binding fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence (e.g., a human GBA1 gene or fragment or variant thereof, e.g., a variant thereof having at least 90% or at least 95% sequence identity to human GBA1) encoding a molecule for the treatment of Parkinson’s disease, for example human beta-glucocerebrosidase or a fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human GBA1 is set forth in Table 2. Example human GBA1 variants (e.g., single nucleotide polymorphism containing variants) are disclosed in PCT Patent Application Publication No.WO / 2023 / 004370 / A1 , incorporated herein by reference in its entirety. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Parkinson’s disease, for example an inhibitor of LRRK2, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Parkinson’s disease, for example a trophic factor (e.g., glial cell line-derived neurotrophic factor (GDNF) or cerebral dopamine neurotrophic factor (CDNF)) or a fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Parkinson’s disease, for example an antisense RNA (e.g., antisense RNA targeting alpha-synuclein, or SNCA, gene) or a fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0236] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence (e.g., a human GBA gene, e.g., a human GBA1 gene) encoding a molecule for the treatment of Gaucher’s disease, for example a human glucocerebrosidase (GCase, e g beta-glucosylceramidase-1) or fragment or variant thereof, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g , two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotidesequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0237] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of multiple sclerosis, for example an anti-CD20 antibody (e.g., ocrelizumab, rituximab, ofatumumab, or RG60351 RO7121932 (an anti-CD20, anti-transferrin receptor bispecific antibody sometimes known as Brainshuttle (BS) CD20- Multiple Sclerosis) or antigen-binding fragment thereof, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments the multiple sclerosis is relapsing remitting multiple sclerosis. In embodiments the multiple sclerosis is primary progressing multiple sclerosis In embodiments the multiple sclerosis is secondary progressive multiple sclerosis. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self- complementary
[0238] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Huntington’s disease, for example an inhibitory nucleic acid directed to mutated huntingtin protein (HTT) (e.g., tominersen, WVE-120101 or WVE-120102), and (ii) a promoter operably linked to said nucleotide sequence The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0239] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Phelan McDermid syndrome, for example human SHANK3 or fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human SHANK3), and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Phelan McDermid syndrome, for example a human growth hormone, e.g., human insulin like growth factor 1 (IGF-1 ), or fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human IGF-1 ), and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e g , two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence,and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0240] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of frontotemporal dementia, for example human progranulin or granulin, or fragment or variant thereof, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of frontotemporal dementia, for example an anti-tau antibody (e.g., semorinemab), or fragment or variant thereof, and (ii) a promoter operably linked to said nucleotide sequence In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of frontotemporal dementia, for example an inhibitory nucleic acid which targets SOD-1 (e g , tofersen), and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0241] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of amyotrophic lateral sclerosis (ALS), for example an inhibitory nucleic acid which targets SOD-1 (e.g., tofersen), and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of ALS, for example an inhibitory nucleic acid which targets O9orf72 (e.g., BIIB078), and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of ALS, for example an inhibitory nucleic acid which targets ATXN2 (e.g., BIIB105), and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of ALS, for example an inhibitory nucleic acid which targets FUS, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or allfive) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a staffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0242] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of multiple system atrophy, for example an anti-alpha synuclein antibody (e.g., prasinezumab), and (ii) a promoter operably linked to said nucleotide sequence In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 62 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of multiple system atrophy, for example an antisense oligonucleotide targeting human SNCA, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of multiple system atrophy, for example human glial cell-derived neurotrophic factor (GDNF) or fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human GDNF), and (ii) a promoter operably linked to said nucleotide sequence The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0243] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of progressive supranuclear palsy (PSP), for example an anti-Tau antibody (e.g , semorinemab), and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of progressive supranuclear palsy (PSP), for example an anti-alpha-synuclein antibody (e.g., prasinezumab), and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0244] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Freidrich's ataxia, for example human frataxin (FRXN) or fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human FRXN), and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0245] In certain aspects, the disclosure provides a nucleotide sequence which encodes a molecule for the treatment of Angelman syndrome In embodiments, the molecule for the treatment of Angelman syndrome comprises an inhibitory nucleic acid molecule (e.g , an antisense oligonucleotide or inhibitory RNA (e.g., siRNA, miRNA or shRNA molecule). In embodiments, the molecule for the treatment of Angelman syndrome comprises an inhibitory nucleic acid molecule (e.g., an antisense oligonucleotide or inhibitory RNA (e g , siRNA, miRNA or shRNA molecule) targeting UBE3A
[0246] In embodiments, the molecule for the treatment of Angelman syndrome comprises a genome editing system (for example a zinc finger nuclease, a meganuclease, a TALEN, or an RNA-guided genome editing system (e.g. a Cas polypeptide and a guide RNA molecule). In embodiments the genome editing system targets UBE3A.
[0247] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Angelman syndrome, for example an inhibitor of a UBE3A antisense nucleic acid (e.g., rugonersen) or a human UBE3A or fragment or variant thereof (e g , a variant thereof having at least 90% or at least 95% sequence identity to human UBE3A), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human UBE3A is set forth in Table 2. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced In some embodiments, the viral genome is self-complementary
[0248] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Fragile X syndrome, for example human fragile X mental retardation protein (FMRP) or fragment or variant thereof (e.g., a nucleotide sequence comprising an FMR1 gene or fragment or variant thereof), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human FMRP is set forth in Table 2. In embodiments, described herein is a virus particle comprising (a) a capsidpolypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Fragile X syndrome, for example an inhibitor of transcriptional silencing of FMRP, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Fragile X syndrome, for example human diacylglycerol kinase (DGKk) or fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human DGKk), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human DGKk is set forth in T able 2. The viral genome can further comprise one or more (e g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, ( b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self- complementary.
[0249] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Rett syndrome, for example a human MECP2 or fragment or variant thereof, e.g., a variant thereof having at least 90% or at least 95% sequence identity to human MECP2 , and (ii) a promoter operably linked to said nucleotide sequence An exemplary accession number for human MECP2 is set forth in Table 2. The viral genome can further comprise one or more (e.g., two, three, four or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0250] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Dravet syndrome, for example human sodium channel, voltage gated, type 1-alpha (SCN1A or Nav1.1 ) or fragment or variant thereof, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Dravet syndrome, for example an inhibitory nucleic acid targeting a mutant SCN1 A transcript, and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Dravet syndrome, for example an anti-tau antibody (e.g., semorinemab), or fragment or variant thereof,and (ii) a promoter operably linked to said nucleotide sequence. In embodiments, described herein is a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Dravet syndrome, for example human Syntaxin-binding protein 1 (STXBP1 ) or fragment or variant thereof, and (ii) a promoter operably linked to said nucleotide sequence The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0251] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Friedreich's ataxia, for example a human FXN gene or fragment or variant thereof, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0252] The disclosure is further directed, in part, to a method of delivering a payload to a subject, e.g., an animal or human subject. In some embodiments, a method of delivering a payload to a subject comprises administering to the subject a dependoparvovirus particle comprising a variant polypeptide (e.g., described herein) comprising the payload, e.g., in a quantity and for a time sufficient to deliver the payload. In some embodiments, the dependoparvovirus particle is a dependoparvovirus particle described herein and comprises a payload described herein. In some embodiments, the particle delivers the payload to the CNS. In some embodiments, the delivery to the CNS is increased as compared to a particle without the variant capsid polypeptide or as compared to a wild-type capsid polypeptide, e.g., a particle with capsid polypeptides of SEQ ID NO:1. In some embodiments, the particle delivers the payload to muscle (e.g., skeletal and / or cardiac) tissue. In some embodiments, the delivery to the muscle tissue is increased as compared to a particle without the variant capsid polypeptide or as compared to a wild-type capsid polypeptide, e.g., a particle with capsid polypeptides of SEQ ID NO:1. In some embodiments, the particle delivers the payload to skeletal muscle tissue. In some embodiments, the delivery to the skeletal muscle tissue is increased as compared to a particle without the variant capsid polypeptide or as compared to a wild-type capsid polypeptide, e.g., a particle with capsid polypeptides of SEQ ID NO:1 . In some embodiments, the particle delivers the payload to cardiac muscle tissue. In some embodiments, the delivery to the cardiac muscle tissue is increased as compared to a particle without the variant capsid polypeptide or as compared to a wild-type capsid polypeptide, e.g., a particle with capsid polypeptides of SEQ ID NO:1.
[0253] In some embodiments, virus particles comprising a genome are provided, wherein the genome includes a nucleic acid expression construct including a heterologous transgene and one or more regulatory elements, where the one or more regulatory elements include a muscle (e.g., skeletal muscle and / or cardiac muscle) specific promoter. Examples of muscle specific promoters that can be used to drive expression of a transgene in skeletal muscle include but are not limited to Desmin (DES), CAMK, Mb, myosin (e.g , myo-3), dystrophin, muscle creatine kinase (MCK), MHCK7, CK6, CK7, CK8, CK8e, dMCK, tMCK, MH, SPc-5-12 (also known as C5-12), alpha skeletal actin (ASKA), SP-301, E-syn, myosin light chain (MLC), myosin heavy chain (MHC), four and a half LIM domains protein 1 (FHL1), alpha 2 actinin (ACTN2), filamin-C (FLNC), sarcoplasmic / endoplasmic reticulum calcium ATPase 1 (ATP2A1 ), troponin I type 1 (TNNI1 ), myosin-1 (MYH1 ), phosphorylatable, fast skeletal muscle myosin light chain (MYLPF), alpha-3 chain tropomyosin (TPM3), Pitx3, and ankyrin repeat domain-containing protein 2 (ANKRD2) promoters. Promoters capable of driving expression in skeletal muscle are further described in Skopenkova et al., 2021 , Acta Naturae 13(1):47-58, Piekarowicz ef al., 2019, Mol Ther Methods Clin Dev. 15:157-169, Wang, 2008 Gene Ther. 15:1489-1499, Coulon et al., 2007, JBC 282(45):33192- 33200, WO 2021 / 127655, and WO 2023 / 006890, the contents of each of which are incorporated herein by reference in their entireties. Examples of muscle specific promoters that can be used to drive expression of a transgene in cardiac muscle include but are not limited to cardiac troponin T (TNNT2), cardiac troponin C (TNNC1 or cTnC), Desmin (DES), alpha-myosin heavy chain (a-MHC), and myosin light chain 2 (MLC-2). Promoters capable of driving expression in heart muscle are further described in WO 2021 / 163357 and WO 2023 / 122804, the contents of each of which are incorporated herein by reference in their entireties.
[0254] In some aspects, the payload comprises a molecule that is effective in treating a muscle disease, such as, for example, a protein or an RNA interference nucleotide (e.g., shRNA, siRNA or miRNA).
[0255] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Duchenne muscular dystrophy (DMD), for example human Dystrophin (DMD) or a fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human DMD), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human DMD is set forth in Table 4. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0256] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of X-linked myotubular myopathy, for example human myotubularin (MTM1 ) or a fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human MTM1 ), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for humanMTM1 is set forth in Table 4. The viral genome can further comprise one or more (e g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0257] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Myotonic Dystrophy Type 1 (DM1 ), for example human myotonin-protein kinase (DMPK) or a fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human DMPK, and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human DMPK is set forth in Table 4. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0258] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Limb-girdle muscular dystrophy (LGMD), for example human Gamma-sarcoglycan, Alpha-sarcoglycan, Beta- sarcoglycan, or Delta-sarcoglycan or a fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human Gamma-sarcoglycan, Alpha-sarcoglycan, Beta- sarcoglycan, or Delta-sarcoglycan), and (ii) a promoter operably linked to said nucleotide sequence. Exemplary accession numbers for human Gamma-sarcoglycan, Alpha-sarcoglycan, Beta-sarcoglycan, and Delta-sarcoglycan are set forth in Table 4. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0259] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Pompe disease, for example human acid alpha-glucosidase (GAA) or a fragment (e g., exon 2) or variant thereof (e.g , a variant thereof having at least 90% or at least 95% sequence identity to human GAA or a portion thereof), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human GAA is set forth in Table 4. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprisesITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary.
[0260] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Facioscapulohumeral muscular dystrophy (FSHD), for example an antisense oligonucleotide targeting human DUX4, and (ii) a promoter operably linked to said nucleotide sequence. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self-complementary
[0261] In certain aspects, the disclosure provides a virus particle comprising (a) a capsid polypeptide described herein, for example, a capsid polypeptide described in Section 6.2 and (b) an engineered viral genome comprising (i) a nucleotide sequence encoding a molecule for the treatment of Facioscapulohumeral muscular dystrophy (FSHD), for example human SMCHD1 or a fragment or variant thereof (e.g., a variant thereof having at least 90% or at least 95% sequence identity to human SMCHD1 or a portion thereof), and (ii) a promoter operably linked to said nucleotide sequence. An exemplary accession number for human SMCHD1 is set forth in Table 4. The viral genome can further comprise one or more (e.g., two, three, four, or all five) of (a) a pair of dependoparvovirus ITRs, (b) an intron, (c) an enhancer or repressor sequence, (d) a stuffer sequence, and (e) a polyA sequence. Preferably, the viral genome comprises ITRs flanking the nucleotide sequence and a polyA sequence operably linked to the nucleotide sequence. Typically, the viral genome lacks rep and cap sequences, which are in trans by the host cell in which the virus particle is produced. In some embodiments, the viral genome is self- complementary.
[0262] Exemplary muscle tissue related diseases that can be treated include but are not limited to Acid Maltase Deficiency (AMD), Amyotrophic Lateral Sclerosis (ALS), Andersen-Tawil Syndrome, Barth syndrome (TAZ), Becker Muscular Dystrophy (BMD), Becker Myotonia Congenita, Bethlem Myopathy, Bulbospinal Muscular Atrophy (Spinal- Bulbar Muscular Atrophy), Carnitine Deficiency, Carnitine Palmityl Transferase Deficiency (CPT Deficiency), Central Core Disease (CCD), Centronuclear Myopathy, Charcot-Marie-Tooth Disease (CMT), Congenital Muscular Dystrophy (CMD), Congenital Myasthenic Syndromes (CMS), Congenital Myotonic Dystrophy, Cori Disease (Debrancher Enzyme Deficiency), Danon disease, Debrancher Enzyme Deficiency, Dejerine-Sottas Disease (DSD), Dermatomyositis (DM), Distal Muscular Dystrophy (DD), Distal myopathy with anterior tibial onset, Duchenne Muscular Dystrophy (DMD), Dystrophia Myotonica (Myotonic Muscular Dystrophy), Emery-Dreifuss Muscular Dystrophy (EDMD), Endocrine Myopathies, Eulenberg Disease (Paramyotonia Congenita), Facioscapulohumeral Muscular Dystrophy (FSH or FSHD), Finnish (Tibial) Distal Myopathy, Forbes Disease (Debrancher Enzyme Deficiency), Friedreich's Ataxia (FA), Fukuyama Congenital Muscular Dystrophy, Glycogenosis Type 10, Glycogenosis Type 11 , Glycogenosis Type 2, Glycogenosis Type 3,Glycogenosis Type 5, Glycogenosis Type 7 , Glycogenosis Type 9, Gowers-Laing Distal Myopathy, Hauptmann-Thanheuser MD (Emery- Dreifuss Muscular Dystrophy), Hereditary Inclusion-Body Myositis, Hereditary Motor and Sensory Neuropathy (Charcot-Marie-Tooth Disease), Hyperthyroid Myopathy, Hypothyroid Myopathy, Inclusion-Body Myositis (IBM), Inherited Myopathies, Integrin-Deficient Congenital Muscular Dystrophy, Kennedy Disease (Spinal-Bulbar Muscular Atrophy), Kugelberg- Welander Disease (Spinal Muscular Atrophy), Lactate Dehydrogenase Deficiency, Lambert-Eaton Myasthenic Syndrome (LEMS), Limb-Girdle Muscular Dystrophy (LGMD), Lou Gehrig's Disease (Amyotrophic Lateral Sclerosis), McArdle Disease (Phosphorylase Deficiency), Merosin-Deficient Congenital Muscular Dystrophy, Metabolic Diseases of Muscle, Mitochondrial Myopathy, Miyoshi myopathy, Miyoshi Distal Myopathy, Motor Neurone Disease, Muscle-Eye-Brain Disease, Myasthenia Gravis (MG), Myoadenylate Deaminase Deficiency, Myofibrillar Myopathy, Myophosphorylase Deficiency, Myotonia Congenita (MC), Myotonic Muscular Dystrophy (MMD), Myotubular Myopathy (MTM or MM), Nemaline Myopathy, Nonaka Distal Myopathy, Oculopharyngeal Muscular Dystrophy (OPMD), Paramyotonia Congenita, Pearson Syndrome, Periodic Paralysis, Peroneal Muscular Atrophy (Charcot- Marie-Tooth Disease), Phosphofructokinase Deficiency, Phosphogly cerate Kinase Deficiency, Phosphogly cerate Mutase Deficiency, Phosphorylase Deficiency, Phosphorylase Deficiency, Polymyositis (PM), Pompe Disease (Acid Maltase Deficiency), Primary merosin deficiency (LAMA2), Progressive External Ophthalmoplegia (PEO), Rod Body Disease (Nemaline Myopathy), Spinal Muscular Atrophy (SMA), Spinal-Bulbar Muscular Atrophy (SBMA), Steinert Disease (Myotonic Muscular Dystrophy), Tarui Disease (Phosphofructokinase Deficiency), Thomsen Disease (Myotonia Congenita), Ullrich Congenital Muscular Dystrophy, Walker-Warburg Syndrome (Congenital Muscular Dystrophy), Welander Distal Myopathy, Werdnig-Hoffmann Disease (Spinal Muscular Atrophy), and ZASP-Related Myopathy
[0263] Payloads suitable for treating muscle-related disease are known in the art and include the following disease (suitable payload) combinations: Barth syndrome (TAZ), Primary merosin deficiency (LAMA2), Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), Danon disease (LAMP2), Limb girdle muscular dystrophy (Subtypes and affected genes: LGMD1A (TTID), LGMD1 B (LMNA), LGMD1C (CAV3), LGMD1D (DNAJB6), LGMD1E (DES), LGMD1 F (TNP03), LGMD1G (HNRPDL), LGMD1H, LGMD2A (CAPN3), LGMD2B (DYSF), LGMD2C (SGCG), LGMD2D (SGCA), LGMD2E (SGCB), LGMD2F (SGCD), LGMD2G (TCAP), LGMD2H (TRIM32), LGMD2I (FKRP), LGMD2J (TTN), LGMD2K (POMT1), LGMD2L (AN05), LGMD2M (FKTN), LGMD2N (POMT2), LGMD20 (POMGNT 1 ), LGMD2Q (PLEC1 )), Miyoshi myopathy (DYSF), Distal myopathy with anterior tibial onset (DYSF), Welander distal myopathy (TIA1 ), Gowers-Laing distal myopathy (MYH7), Facioscapulohumeral muscular dystrophy (Subtypes and affected genes: Type 1 (DUX4), Type 2 (SMCHD1 )), Oculopharyngeal muscular dystrophy (PABPN1 ), myotonic dystrophy (Subtypes and affected genes: DM1 (DMPK) and DM2 (ZNF9)), congenital myotonia (CLCN1 ), paramyotonia congenital (SCN4A), myotubular myopathy (MTM1 ), glycogen storage disease type II (Pompe disease) (GAA).
[0264] In some embodiments, the payload is selected from: TAZ, LAMA2, DMD, LAMP2, CAPN3, DYSF, SGCA, SGCB, FKRP, PABPN1 , MTM1 , and GAA.
[0265] In some embodiments, the payload is human dystrophin
[0266] Further exemplary diseases that can be treated and further exemplary heterologous transgenes that can be delivered via the viral particles of the disclosure are provided in Table 2, Table 2-1, Table 3, Table 4, Table 4-1, and Table 5.
[0267] In some embodiments, the payload is an antisense oligonucleotide effective in treating a CNS disease, for example by modulating expression of a target gene. Exemplary CNS diseases which may be treated using an antisense oligonucleotide include amyotrophic lateral sclerosis, Huntington’s disease, and Alzheimer’s disease Exemplary target genes of such antisense oligonucleotides for treatment of CNS disease include SOD1 , C9orf72, Ataxin 2, huntingtin (HTT), Sortilin-related receptor, Microtubule- Associated Protein Tau (MAPT), and neutral sphingomyelinase (N-SMase). Various antisense oligonucleotides effective in treatment of CNS diseases are described in the art and include, for example, those described in Bennett et al., 2019 Annu Rev Neurosci. 42:385-406, Rinaldi et al., 2018, Nature Reviews Neurology, 14:9-21, and Rook et al., 2022, BioDrugs 36(2):105-119, each incorporated herein by reference.
[0268] Non-limiting, example antisense oligonucleotides that can be delivered via the viral particles of the disclosure (along with associated target genes and CNS tissue related diseases that can be treated) are provided in Table 2-1. Where such antisense oligonucleotides are indicated by reference to a patent or patent application publication, such patent and patent applications are incorporated herein by reference in their entirety for their disclosed antisense oligonucleotide structures and sequences.
[0269] In some embodiments, the payload is an antisense oligonucleotide effective in treating a muscle disease, for example by modulating expression of a target gene. Exemplary target genes of such antisense oligonucleotides for treatment of muscle disease include, for example, MSTN, INHBA, ACVR1 B, MLCK1 , ACVR1 , FBXO32, TRIM63, MEF2D, KLF15, MED1 , MED13, DUX4, LMNA, SMN, GAA, GYS2, DMD, DMPK, MSTN, and PPP1 R3A
[0270] Non-limiting, example antisense oligonucleotides that can be delivered via the viral particles of the disclosure (along with associated target genes and muscle tissue related diseases that can be treated) are provided in Table 4-1. Where such antisense oligonucleotides are indicated by reference to a patent or patent application publication, such patent and patent applications are incorporated herein by reference in their entirety for their disclosed antisense oligonucleotide structures and sequences.6.6.2. Methods of treatment
[0271] The disclosure is directed, in part, to a method of treating a disease or condition in a subject, e.g., an animal or human subject. In some embodiments, a method of treating a disease or condition in a subject comprises administering to the subject a dependoparvovirus particle comprising a variant polypeptide described herein, e.g., comprising a payload described herein. In some embodiments, the dependoparvovirus particle, which comprises a variant polypeptide, comprising a payload described herein is administered in an amount and / or time effective to treat the disease or condition. In some embodiments, the payload is a therapeutic product. In some embodiments, the payload is a nucleic acid, e.g., encoding an exogenous polypeptide.
[0272] The dependoparvovirus particles comprising a variant polypeptide described herein or produced by the methods described herein can be used to express one or more therapeutic proteins to treat various diseases or disorders. In some embodiments, the disease or disorder is a cancer, e.g., a cancer such as carcinoma, sarcoma, leukemia, lymphoma; or an autoimmune disease, e g., multiple sclerosis. Non-limiting examples of carcinomas include esophageal carcinoma; bronchogenic carcinoma; colon carcinoma; colorectal carcinoma; gastric carcinoma; hepatocellular carcinoma; basal cell carcinoma, squamous cell carcinoma (various tissues); bladder carcinoma, including transitional cell carcinoma; lung carcinoma, including small cell carcinoma and non-small cell carcinoma of the lung; adrenocortical carcinoma; sweat gland carcinoma; sebaceous gland carcinoma; thyroid carcinoma; pancreatic carcinoma; breast carcinoma; ovarian carcinoma; prostate carcinoma; adenocarcinoma; papillarycarcinoma; papillary adenocarcinoma; cystadenocarcinoma; medullary carcinoma; renal cell carcinoma; uterine carcinoma; testicular carcinoma; osteogenic carcinoma; ductal carcinoma in situ or bile duct carcinoma; choriocarcinoma; seminoma; embryonal carcinoma; Wilm's tumor; cervical carcinoma; epithelial carcinoma; and nasopharyngeal carcinoma. Non-limiting examples of sarcomas include fibrosarcoma, myxosarcoma, liposarcoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, chondrosarcoma, chordoma, osteogenic sarcoma, osteosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's sarcoma, leiomyosarcoma, rhabdomyosarcoma, and other soft tissue sarcomas Non-limiting examples of solid tumors include ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, menangioma, melanoma, neuroblastoma, and retinoblastoma. Non-limiting examples of leukemias include chronic myeloproliferative syndromes; T-cell CLL prolymphocytic leukemia, acute myelogenous leukemias; chronic lymphocytic leukemias, including B-cell CLL, hairy cell leukemia; and acute lymphoblastic leukemias Examples of lymphomas include, but are not limited to, B-cell lymphomas, such as Burkitt's lymphoma; and Hodgkin's lymphoma. In some embodiments, the disease or disorder is a genetic disorder In some embodiments, the genetic disorder is sickle cell anemia, Glycogen storage diseases (GSD, e.g., GSD types I, II, III, IV, V, VI, VII, VIII, IX, X, XI, XII, XIII, and XIV), cystic fibrosis, lysosomal acid lipase (LAL) deficiency 1, Tay-Sachs disease, Phenylketonuria, Mucopolysaccharidoses, Galactosemia, muscular dystrophy (e.g , Duchenne muscular dystrophy), hemophilia such as hemophilia A (classic hemophilia) or hemophilia B (Christmas Disease), Wilson's disease, Fabry Disease, Gaucher Disease hereditary angioedema (HAE), and alpha 1 antitrypsin deficiency. Examples of other diseases or disorders are provided above in Section 6.6.1
[0273] In some aspects, the disease or condition is a disease of the CNS. Exemplary diseases of the CNS include, Absence of the Septum Pellucidum, Acid Lipase Disease, Acid Maltase Deficiency, Acquired Epileptiform Aphasia, Acute Disseminated Encephalomyelitis, Attention Deficit-Hyperactivity Disorder (ADHD), Adie's Pupil, Adie's Syndrome, Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Agnosia, Aicardi Syndrome, Aicardi-Goutieres Syndrome Disorder, AIDS - Neurological Complications, Alexander Disease, Alpers' Disease, Alternating Hemiplegia, Alzheimer's Disease, Amyotrophic Lateral Sclerosis (ALS), Anencephaly, Aneurysm, Angelman Syndrome, Angiomatosis, Angleman syndrome, Anoxia, Antiphospholipid Syndrome, Aphasia, Apraxia, Arachnoid Cysts, Arachnoiditis, Arnold-Chiari Malformation, Arteriovenous Malformation, Asperger Syndrome, Ataxia, Ataxia Telangiectasia, Ataxias and Cerebellar or Spinocerebellar Degeneration, Atrial Fibrillation and Stroke, Attention Deficit-Hyperactivity Disorder, Autism Spectrum Disorder, Autonomic Dysfunction, Back Pain, Barth Syndrome, Batten Disease, Becker's Myotonia, Bechet's Disease, Bell's Palsy, Benign Essential Blepharospasm, Benign Focal Amyotrophy, Benign Intracranial Hypertension, Bernhardt-Roth Syndrome, Binswanger's Disease, Blepharospasm, Bloch-Sulzberger Syndrome, Brachial Plexus Birth Injuries, Brachial Plexus Injuries, Bradbury-Eggleston Syndrome, Brain and Spinal Tumors, Brain Aneurysm, Brain Injury, Brown-Sequard Syndrome, Bulbar palsy, Bulbospinal Muscular Atrophy, Cerebral Autosomal Dominant Arteriopathy with Sub-cortical Infarcts and Leukoencephalopathy (CADASIL), Canavan Disease, Carpal Tunnel Syndrome, Causalgia, Cavernomas, Cavernous Angioma, Cavernous Malformation, Central Cervical Cord Syndrome, Central Cord Syndrome, Central Pain Syndrome, Central Pontine Myelinolysis, Cephalic Disorders, Ceramidase Deficiency, Cerebellar Degeneration, Cerebellar Hypoplasia, Cerebral Aneurysms, Cerebral Arteriosclerosis, Cerebral Atrophy,Cerebral Beriberi, Cerebral Cavernous Malformation, Cerebral Gigantism, Cerebral Hypoxia, Cerebral Palsy, Cerebro-Oculo-Facio-Skeletal Syndrome (COFS), Charcot-Marie-Tooth Disease, Chiari Malformation, Cholesterol Ester Storage Disease, Chorea, Choreoacanthocytosis, Chronic Inflammatory Demyelinating Polyneuropathy (CIDP), Chronic Orthostatic Intolerance, Chronic Pain, Cockayne Syndrome Type II, Coffin Lowry Syndrome, Colpocephaly, Coma, Complex Regional Pain Syndrome, Concentric sclerosis (Balo's sclerosis), Congenital Facial Diplegia, Congenital Myasthenia, Congenital Myopathy, Congenital Vascular Cavernous Malformations, Corticobasal Degeneration, Cranial Arteritis, Craniosynostosis, Cree encephalitis, Creutzfeldt-Jakob Disease, Chronic progressive external ophtalmoplegia, Cumulative Trauma Disorders, Cushing's Syndrome, Cytomegalic Inclusion Body Disease, Cytomegalovirus Infection, Dancing Eyes-Dancing Feet Syndrome, Dandy-Walker Syndrome, Dawson Disease, De Morsier's Syndrome, Dejerine-Klumpke Palsy, Dementia, Dementia -Multi-Infarct, Dementia - Semantic, Dementia -Subcortical, Dementia With Lewy Bodies, Demyelination diseases, Dentate Cerebellar Ataxia, Dentatorubral Atrophy, Dermatomyositis, Developmental Dyspraxia, Devic's Syndrome, Diabetic Neuropathy, Diffuse Sclerosis, Distal hereditary motor neuronopathies, Dravet Syndrome, Dysautonomia, Dysgraphia, Dyslexia, Dysphagia, Dyspraxia, Dyssynergia Cerebellaris Myoclonica, Dyssynergia Cerebellaris Progressiva, Dystonias, Early Infantile Epileptic Encephalopathy, Empty Sella Syndrome, Encephalitis, Encephalitis Lethargica, Encephaloceles, Encephalomyelitis, Encephalopathy, Encephalopathy (familial infantile), Encephalotrigeminal Angiomatosis, Epilepsy, Epileptic Hemiplegia, Episodic ataxia, Erb's Palsy, Erb-Duchenne and Dejerine-Klumpke Palsies, Essential Tremor, Extrapontine Myelinolysis, Faber's disease, Fabry Disease, Fahr's Syndrome, Fainting, Familial Dysautonomia, Familial Hemangioma, Familial Idiopathic Basal Ganglia Calcification, Familial Periodic Paralyses, Familial Spastic Paralysis, Farber's Disease, Febrile Seizures, Fibromuscular Dysplasia, Fisher Syndrome, Floppy Infant Syndrome, Foot Drop, Fragile X syndrome, Friedreich's Ataxia, Frontotemporal Dementia, Gaucher Disease, Generalized Gangliosidoses (GM1, GM2), Gerstmann's Syndrome, Gerstmann-Straussler-Scheinker Disease, Giant Axonal Neuropathy, Giant Cell Arteritis, Giant Cell Inclusion Disease, Globoid Cell Leukodystrophy, Glossopharyngeal Neuralgia, Glycogen Storage Disease, Guillain-Barre Syndrome, Hallervorden-Spatz Disease, Head Injury, Headache, Hemicrania Continua, Hemifacial Spasm, Hemiplegia Alterans, Hereditary Neuropathies, Hereditary Spastic Paraplegia, Heredopathia Atactica Polyneuritiformis, Herpes Zoster, Herpes Zoster Oticus, Hirayama Syndrome, Holmes-Adie syndrome, Holoprosencephaly, HTLV-1 Associated Myelopathy, Hughes Syndrome, Huntington's Disease, Hurler syndrome, Hydranencephaly, Hydrocephalus, Hydrocephalus - Normal Pressure, Hydromyelia, Hypercortisolism, Hypersomnia, Hypertonia, Hypotonia, Hypoxia, Immune-Mediated Encephalomyelitis, Inclusion Body Myositis, Incontinentia Pigmenti, Infantile Hypotonia, Infantile Neuroaxonal Dystrophy, Infantile Phytanic Acid Storage Disease, Infantile Refsum Disease, Infantile Spasms, Inflammatory Myopathies, Iniencephaly, Intestinal Lipodystrophy, Intracranial Cysts, Intracranial Hypertension, Isaacs' Syndrome, Joubert Syndrome, Kearns-Sayre Syndrome, Kennedy's Disease, Kinsbourne syndrome, Kleine-Levin Syndrome, Klippel-Feil Syndrome, Klippel-Trenaunay Syndrome (KTS), Kluver-Bucy Syndrome, Korsakoff's Amnesic Syndrome, Krabbe Disease, Kugelberg-Welander Disease, Kuru, Lambert-Eaton Myasthenic Syndrome, Landau-Kleffner Syndrome, Lateral Femoral Cutaneous Nerve Entrapment, Lateral Medullary Syndrome, Learning Disabilities, Leigh's Disease, Lennox-Gastaut Syndrome, Lesch- Nyhan Syndrome, Leukodystrophy, Levine-Critchley Syndrome, Lewy Body Dementia, Lichtheim'sdisease, Lipid Storage Diseases, Lipoid Proteinosis, Lissencephaly, Locked-ln Syndrome, Lou Gehrig's Disease, Lupus - Neurological Sequelae, Lyme Disease - Neurological Complications, Lysosomal storage disorders, Machado-Joseph Disease, Macrencephaly, Megalencephaly, Melkersson-Rosenthal Syndrome, Meningitis, Meningitis and Encephalitis, Menkes Disease, Meralgia Paresthetica, Metachromatic Leukodystrophy, Microcephaly, Migraine, Miller Fisher Syndrome, Mini Stroke, Mitochondrial Myopathy, Mitochondrial DNA depletion syndromes, Moebius Syndrome, Monomelic Amyotrophy, Morvan Syndrome, Motor Neuron Diseases, Moyamoya Disease, Mucolipidoses, Mucopolysaccharidoses, Multi-Infarct Dementia, Multifocal Motor Neuropathy, Multiple Sclerosis, Multiple System Atrophy, Multiple System Atrophy with Orthostatic Hypotension, Muscular Dystrophy, Myasthenia - Congenital, Myasthenia Gravis, Myelinoclastic Diffuse Sclerosis, Myelitis, Myoclonic Encephalopathy of Infants, Myoclonus, Myoclonus epilepsy, Myopathy, Myopathy- Congenital, Myopathy -Thyrotoxic, Myotonia, Myotonia Congenita, Narcolepsy, NARP (neuropathy, ataxia and retinitis pigmentosa), Neuroacanthocytosis, Neurodegeneration with Brain Iron Accumulation, Neurodegenerative disease, Neurofibromatosis, Neuroleptic Malignant Syndrome, Neurological Complications of AIDS, Neurological Complications of Lyme Disease, Neurological Consequences of Cytomegalovirus Infection, Neurological Manifestations of Pompe Disease, Neurological Sequelae Of Lupus, Neuromyelitis Optica, Neuromyotonia, Neuronal Ceroid Lipofuscinosis, Neuronal Migration Disorders, Neuropathic pain, Neuropathy- Hereditary, Neuropathy, Neurosarcoidosis, Neurosyphilis, Neurotoxicity, Nevus Cavernosus, Niemann-Pick Disease, O'Sullivan-McLeod Syndrome, Occipital Neuralgia, Ohtahara Syndrome, Olivopontocerebellar Atrophy, Opsoclonus Myoclonus, Orthostatic Hypotension, Overuse Syndrome, Pain -Chronic, Pantothenate Kinase-Associated Neurodegeneration, Paraneoplastic Syndromes, Paresthesia, Parkinson's Disease, Paroxysmal Choreoathetosis, Paroxysmal Hemicrania, Parry- Romberg, Pelizaeus-Merzbacher Disease, Pena Shokeir II Syndrome, Perineural Cysts, Peroneal muscular atrophy, Periodic Paralyses, Peripheral Neuropathy, Periventricular Leukomalacia, Persistent Vegetative State, Pervasive Developmental Disorders, Phytanic Acid Storage Disease, Pick's Disease, Pinched Nerve, Piriformis Syndrome, Pituitary Tumors, Polymyositis, Pompe Disease, Porencephaly, Post-Polio Syndrome, Postherpetic Neuralgia, Postinfectious Encephalomyelitis, Postural Hypotension, Postural Orthostatic Tachycardia Syndrome, Postural Tachycardia Syndrome, Primary Dentatum Atrophy, Primary Lateral Sclerosis, Primary Progressive Aphasia, Prion Diseases, Progressive bulbar palsy, Progressive Hemifacial Atrophy, Progressive Locomotor Ataxia, Progressive Multifocal Leukoencephalopathy, Progressive Muscular Atrophy, Progressive Sclerosing Poliodystrophy, Progressive Supranuclear Palsy, Prosopagnosia, Pseudobulbar palsy, Pseudo-Torch syndrome, Pseudotoxoplasmosis syndrome, Pseudotumor Cerebri, Psychogenic Movement, Ramsay Hunt Syndrome I, Ramsay Hunt Syndrome II, Rasmussen's Encephalitis, Reflex Sympathetic Dystrophy Syndrome, Refsum Disease, Refsum Disease - Infantile, Repetitive Motion Disorders, Repetitive Stress Injuries, Restless Legs Syndrome, Retrovirus-Associated Myelopathy, Rett Syndrome, Reye's Syndrome, Rheumatic Encephalitis, Riley-Day Syndrome, Sacral Nerve Root Cysts, Saint Vitus Dance, Salivary Gland Disease, Sandhoff Disease, Schilder's Disease, Schizencephaly, Seitelberger Disease, Seizure Disorder, Semantic Dementia, Septo-Optic Dysplasia, Severe Myoclonic Epilepsy of Infancy (SMEI), Shaken Baby Syndrome, Shingles, Shy-Drager Syndrome, Sjogren's Syndrome, Sleep Apnea, Sleeping Sickness, Sotos Syndrome, Spasticity, Spina Bifida, Spinal Cord Infarction, Spinal Cord Injury, Spinal Cord Tumors, Spinal Muscular Atrophy, Spinocerebellar Ataxia, Spinocerebellar Atrophy, SpinocerebellarDegeneration, Sporadic ataxia, Steele-Richardson-Olszewski Syndrome, Stiff-Person Syndrome, Striatonigral Degeneration, Stroke, Sturge-Weber Syndrome, Subacute Sclerosing Panencephalitis, Subcortical Arteriosclerotic Encephalopathy, Short-lasting, Unilateral, Neuralgiform (SUNCT) Headache, Swallowing Disorders, Sydenham Chorea, Syncope, Syphilitic Spinal Sclerosis, Syringohydromyelia, Syringomyelia, Systemic Lupus Erythematosus, Tabes Dorsalis, Tardive Dyskinesia, Tarlov Cysts, Tay- Sachs Disease, Temporal Arteritis, Tethered Spinal Cord Syndrome, Thomsen's Myotonia, Thoracic Outlet Syndrome, Thyrotoxic Myopathy, Tic Douloureux, Todd's Paralysis, Tourette Syndrome, Transient Ischemic Attack, Transmissible Spongiform Encephalopathies, Transverse Myelitis, Traumatic Brain Injury, Tremor, Trigeminal Neuralgia, Tropical Spastic Paraparesis, Troyer Syndrome, Tuberous Sclerosis, Vascular Erectile Tumor, Vasculitis Syndromes of the Central and Peripheral Nervous Systems, Vitamin B12 deficiency, Von Economo's Disease, Von Hippel-Lindau Disease (VHL), Von Recklinghausen's Disease, Wallenberg's Syndrome, Werdnig-Hoffman Disease, Wernicke-Korsakoff Syndrome, West Syndrome, Whiplash, Whipple's Disease, Williams Syndrome, Wilson Disease, Wolman's Disease, X-Linked Spinal and Bulbar Muscular Atrophy. Examples of other diseases or disorders are provided above in Section 6.6.1
[0274] In some aspects, the disease or condition is a disease of muscle (e.g , skeletal muscle). Exemplary diseases of the muscle include Acid Maltase Deficiency (AMD), Amyotrophic Lateral Sclerosis (ALS), Andersen-Tawil Syndrome, Becker Muscular Dystrophy (BMD), Becker Myotonia Congenita, Bethlem Myopathy, Bulbospinal Muscular Atrophy (Spinal- Bulbar Muscular Atrophy), Carnitine Deficiency, Carnitine Palmityl Transferase Deficiency (CPT Deficiency), Central Core Disease (CCD), Centronuclear Myopathy, Charcot-Marie- Tooth Disease (CMT), Congenital Muscular Dystrophy (CMD), Congenital Myasthenic Syndromes (CMS), Congenital Myotonic Dystrophy, Cori Disease (Debrancher Enzyme Deficiency), Debrancher Enzyme Deficiency, Dejerine-Sottas Disease (DSD), Dermatomyositis (DM), Distal Muscular Dystrophy (DD), Duchenne Muscular Dystrophy (DMD), Dystrophia Myotonica (Myotonic Muscular Dystrophy), Emery-Dreifuss Muscular Dystrophy (EDMD), Endocrine Myopathies, Eulenberg Disease (Paramyotonia Congenita), Facioscapulohumeral Muscular Dystrophy (FSH or FSHD), Finnish (Tibial) Distal Myopathy, Forbes Disease (Debrancher Enzyme Deficiency), Friedreich's Ataxia (FA), Fukuyama Congenital Muscular Dystrophy, Glycogenosis Type 10, Glycogenosis Type 11, Glycogenosis Type 2, Glycogenosis Type 3, Glycogenosis Type 5, Glycogenosis Type 7, Glycogenosis Type 9, Gowers-Laing Distal Myopathy, Hauptmann-Thanheuser MD (Emery- Dreifuss Muscular Dystrophy), Hereditary Inclusion-Body Myositis, Hereditary Motor and Sensory Neuropathy (Charcot- Marie-Tooth Disease), Hyperthyroid Myopathy, Hypothyroid Myopathy, Inclusion-Body Myositis (IBM), Inherited Myopathies, Integrin-Deficient Congenital Muscular Dystrophy, Kennedy Disease (Spinal-Bulbar Muscular Atrophy), Kugelberg-Welander Disease (Spinal Muscular Atrophy), Lactate Dehydrogenase Deficiency, Lambert-Eaton Myasthenic Syndrome (LEMS), Limb-Girdle Muscular Dystrophy (LGMD), Lou Gehrig's Disease (Amyotrophic Lateral Sclerosis), McArdle Disease (Phosphorylase Deficiency), Merosin-Deficient Congenital Muscular Dystrophy, Metabolic Diseases of Muscle, Mitochondrial Myopathy, Miyoshi Distal Myopathy, Motor Neurone Disease, Muscle-Eye-Brain Disease, Myasthenia Gravis (MG), Myoadenylate Deaminase Deficiency, Myofibrillar Myopathy, Myophosphorylase Deficiency, Myotonia Congenita (MC), Myotonic Muscular Dystrophy (MMD), Myotubular Myopathy (MTM or MM), Nemaline Myopathy, Nonaka Distal Myopathy, Oculopharyngeal Muscular Dystrophy (OPMD), Paramyotonia Congenita, Pearson Syndrome, Periodic Paralysis, Peroneal Muscular Atrophy (Charcot-Marie-Tooth Disease), Phosphofructokinase Deficiency, Phosphogly cerate Kinase Deficiency, Phosphogly cerate Mutase Deficiency, Phosphorylase Deficiency, Phosphorylase Deficiency, Polymyositis (PM), Pompe Disease (Acid Maltase Deficiency), Progressive External Ophthalmoplegia (PEO), Rod Body Disease (Nemaline Myopathy), Spinal Muscular Atrophy (SMA), Spinal-Bulbar Muscular Atrophy (SBMA), Steinert Disease (Myotonic Muscular Dystrophy), Tarui Disease (Phosphofructokinase Deficiency), Thomsen Disease (Myotonia Congenita), Ullrich Congenital Muscular Dystrophy, Walker-Warburg Syndrome (Congenital Muscular Dystrophy), Welander Distal Myopathy, Werdnig-Hoffmann Disease (Spinal Muscular Atrophy), and ZASP-Related Myopathy.
[0275] In some aspects, the disease or condition is a disease of cardiac muscle. Exemplary diseases of cardiac muscle include Acid maltase deficiency (Glycogen storage disease II), Advanced heart failure, Andersen-Tawil Syndrome, Arrhythmogenic right ventricular cardiomyopathy 1 (ARVD1 ), Arrhythmogenic right ventricular cardiomyopathy 5 (ARVD5), Arrhythmogenic right ventricular cardiomyopathy 8 (ARVD8), Arrhythmogenic right ventricular cardiomyopathy 9 (ARVD9), Arrhythmogenic right ventricular cardiomyopathy 10 (ARVD10), Arrhythmogenic right ventricular cardiomyopathy 11 (ARVD11 ), Arrhythmogenic right ventricular cardiomyopathy 12 (ARVD12), Arrhythmogenic right ventricular cardiomyopathy 13 (ARVD13), Arrhythmogenic right ventricular cardiomyopathy 14 (ARVD14), Arrhythmogenic right ventricular cardiomyopathy 15 (ARVD15), Atrial fibrillation 3 (ATFB3), Atrial fibrillation 4 (ATFB4), Atrial fibrillation 6 (ATFB6), Atrial fibrillation 7 (ATFB7), Atrial fibrillation 9 (ATFB9), Atrial fibrillation 10 (ATFB10), Atrial fibrillation 11 (ATFB11 ), Atrial fibrillation 12 (ATFB612), Atrial fibrillation 13 (ATFB6), Atrial fibrillation 14 (ATFB14), Atrial fibrillation 15 (ATFB15), Atrial fibrillation 16 (ATFB16), Atrial fibrillation 17 (ATFB17), Atrial fibrillation 18 (ATFB18), Atrial septal defect 2 (ASD2), Atrial septal defect 3 (ASD3), Atrial septal defect 4 (ASD4), Atrial septal defect 5 (ASD5), Atrial septal defect 6 (ASD6), Atrial septal defect 7 (ASD7), Atrial septal defect 8 (ASD8), Atrial septal defect 9 (ASD9), Atrial standstill 1, Atrial standstill 2, Barth syndrome , Becker Muscular Dystrophy (BMD), Brugada syndrome 1, Brugada syndrome 2, Brugada syndrome 3, Brugada syndrome 4, Brugada syndrome 5, Brugada syndrome 6, Brugada syndrome 7, Brugada syndrome 8, Brugada syndrome 9, Cardiac arrhythmia syndrome, Cardiac conduct defect, Cardiac conduction disease, Cardiac, facial, and digital anomalies with developmental delay (CAFDADD), Cardiofaciocutaneous syndrome 1 , Cardiofaciocutaneous syndrome 2, Cardiofaciocutaneous syndrome 3, Cardiofaciocutaneous syndrome 4, Cardiac-urogenital syndrome, Cardiac valvular dysplasia, X-linked, Cardiac valvular dysplasia 2, Cardiomyopathy, dilated, 1A, Cardiomyopathy, dilated, 1AA, Cardiomyopathy, dilated, 1C, Cardiomyopathy, dilated, 1D, Cardiomyopathy, dilated, 1E, Cardiomyopathy, dilated, 1 FF, Cardiomyopathy, dilated, 1 MM, Cardiomyopathy, dilated, 1P, Cardiomyopathy, dilated, 1 , Cardiomyopathy, dilated, 1S, Cardiomyopathy, dilated, 1Y, Cardiomyopathy, dilated, 2A, Cardiomyopathy, dilated, 2E, Cardiomyopathy, familial restrictive, 1 , Cardiomyopathy, familial restrictive, 3, Cardiomyopathy, hypertrophic, 1 (CMH1 ), Cardiomyopathy, hypertrophic, 2 (CMH2), Cardiomyopathy, hypertrophic, 3 (CMH3), Cardiomyopathy, hypertrophic 4 (CMH4), Cardiomyopathy, hypertrophic 6 (CMH6), Cardiomyopathy, hypertrophic, 7 (CMH7), Cardiomyopathy, hypertrophic, 8 (CMH8), Cardiomyopathy, hypertrophic, 9 (CMH9), Cardiomyopathy, hypertrophic, 10 (CMH10), Cardiomyopathy, hypertrophic, 11 (CMH11 ), Cardiomyopathy, hypertrophic, 12 (CMH12), Cardiomyopathy, hypertrophic, 13 (CMH13), Cardiomyopathy, hypertrophic, 14 (CMH14), Cardiomyopathy, hypertrophic, 15 (CMH15), Cardiomyopathy, hypertrophic, 16 (CMH16), Cardiomyopathy, hypertrophic, 17 (CMH17),Cardiomyopathy, hypertrophic, 18 (CMH18), Cardiomyopathy, hypertrophic, 20 (CMH20), Cardiomyopathy, hypertrophic, 23 (CMH23), Cardiomyopathy, hypertrophic, 25 (CMH25), Cardiomyopathy, hypertrophic, 26 (CMH26), Cardiomyopathy, hypertrophic, 27 (CMH27), Cardiomyopathy, hypertrophic, 28 (CMH28), Cardiomyopathy, hypertrophic, 29 (CMH29), Cardiomyopathy, restrictive 1 (RCM1), Cardiomyopathy, restrictive 3 (RCM3), Cardiomyopathy, restrictive 4 (RCM4), Cardiomyopathy, restrictive 5 (RCM5), Cardiomyopathy, restrictive 6 (RCM6), Carnitine Deficiency, systemic primary, Catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), Combined oxidative phosphorylation deficiency 8, Combined oxidative phosphorylation deficiency 10, Congenital Myopathy, Congenital Myotonic Dystrophy, Conotruncal heart malformations, Coronary artery disease 1 , Coronary artery disease 2, Cori Disease - Debrancher Enzyme Deficiency - Forbes Disease, Costello syndrome, Danon disease, Dextrocardia with other cardiac malformations, x- linked (visceral heterotaxy (HTX1)), Dilated Cardiomyopathy, Duchenne Muscular Dystrophy, Ehlers- Danlos syndrome, cardiac valvular type, Emery-Dreifuss Muscular Dystrophy, Fabry disease, cardiac variant, Frank-ter Haar syndrome, Friedreich's ataxia, Fukuyama Congenital Muscular Dystrophy, Glycogen storage disease III, GM1-gangliosidosis, type I with cardiac involvement, Heart failure, Hirschsprung disease (HCAD), Infantile hypertrophic cardiomyopathy, Ischemia-reperfusion injury, Jervell and Lange-Nielsen syndrome (JLNS1), Jervell and Lange-Nielsen syndrome 2 (JLNS2), Laing Distal Myopathy, Left ventricular noncompaction 1 (LVNC1), Left ventricular noncompaction 3 (LVNC3), Left ventricular noncompaction 4 (LVNC4), Left ventricular noncompaction 5 (LVNC5), Left ventricular noncompaction 6 (LVNC6), Left ventricular noncompaction 7 (LVNC7), Left ventricular noncompaction 8 (LVNC8), Left ventricular noncompaction 9 (LVNC9), Left ventricular noncompaction 10 (LVNC10), LEOPARD syndrome 1 , LEOPARD syndrome 2, LEOPARD syndrome 3, Limb-girdle muscular dystrophy, type 25 (LGMDR25), Lodder-Merla syndrome, type 1 , Long QT syndrome 1 , Long QT syndrome 2, Long QT syndrome 3, Long QT syndrome 4, Long QT syndrome 5, Long QT syndrome 6, Long QT syndrome 7 (Andersen syndrome), Long QT syndrome 8, Long QT syndrome 9, Long QT syndrome 10, Long QT syndrome 11, Long QT syndrome 12, Long QT syndrome 13, Long QT syndrome 14, Long QT syndrome 15, Long QT syndrome 16, Metabolic encephalomyopathic crises (MECRON), Microphthalmia, syndromic, type 9, Mitochondrial phosphate carrier deficiency (MPCD), Mitral valve prolapse 3 (MVP3), Mungan syndrome (MGS), Myocardial infarction, Myofibrillar Myopathy 1 , Myofibrillar Myopathy 2, Myofibrillar Myopathy 6, Myofibrillar Myopathy 10, Myofibrillar Myopathy 11, Myofibrillar Myopathy 12, Myotonic dystrophy Type 1 - Steinert Disease, Myotonic dystrophy Type 2, Naxos disease (NXD), Nemaline Myopathy 1 , Nemaline Myopathy 3, Nonprogressive hear block, Orthostatic intolerance (soldiers heart), Progeria syndrome, Progressive familial heart block type IA, Progressive familial heart block type IB, RYR2 calcium release deficiency syndrome, Sengers syndrome, Sick sinus syndrome 1 (SSS1 ), Sick sinus syndrome 2 (SSS2), Sick sinus syndrome 3 (SSS3), Sick sinus syndrome 4 (SSS4), Sudden cardiac failure, infantile (SCFI), TARP syndrome, Timothy syndrome, Valvular heart disease, congenital, Ventricular fibrillation 1 (VF1 ), Ventricular tachycardia, Vertebral, cardiac, renal, and limb defects syndrome 1 (VCRL1), and Vertebral, cardiac, renal, and limb defects syndrome 2 (VCRL2), Vertebral, cardiac, renal, and limb defects syndrome 3 (VCRL3).
[0276] In some aspects, the disease or condition is a disease affecting the CNS and muscle, for example SMA, multiple sclerosis, Amyotrophic lateral sclerosis (ALS), Ataxia, Becker muscular dystrophy, Charcot-Marie-Tooth disease, Dystonias, Friedreich's ataxia, Glycogen storage disease II,Kennedy Disease, Lambert-Eaton Myasthenic Syndrome, Mitochondrial DNA depletion syndromes, Muscle-Eye-Brain Disease, Neuromyotonia, Periodic Paralyses, juvenile Primary Lateral Sclerosis, Progressive external ophtalmoplegia, Spastic Paraplegias, congenital Stiff-Person Syndrome, Tardive Dyskinesia, Werdnig-Hoffman Disease, or X-Linked Spinal and Bulbar Muscular Atrophy.
[0277] In some embodiments, administration of a dependoparvovirus particle comprising a variant polypeptide and comprising a payload (e.g. , a transgene as described in Section 6.6.1 or its subparts) to a subject induces expression of the payload (e.g., transgene) in a subject. In some embodiments, the expression is induced in the CNS. In some embodiments, the production is similar in the CNS as compared to a similar particle with the wild-type capsid protein. In some embodiments, the production is increased in the CNS as compared to a similar particle with the wild-type capsid protein, for example, a particle with capsid proteins of SEQ ID NO:1. In some embodiments, the expression is induced in muscle. In some embodiments, the production is similar in muscle as compared to a similar particle with the wild-type capsid protein, for example, a particle with capsid proteins of SEQ ID NO:1. In some embodiments, the production is increased in muscle as compared to a similar particle with the wild-type capsid protein (for example, a particle with capsid proteins of SEQ ID NO:1 ). In some embodiments, the expression is induced in skeletal muscle. In some embodiments, the production is similar in skeletal muscle as compared to a similar particle with the wild-type capsid protein, for example, a particle with capsid proteins of SEQ ID NO:1. In some embodiments, the production is increased in skeletal muscle as compared to a similar particle with the wild-type capsid protein (for example, a particle with capsid proteins of SEQ ID NO:1 ). In some embodiments, the expression is induced in cardiac muscle In some embodiments, the production is similar in cardiac muscle as compared to a similar particle with the wildtype capsid protein, for example, a particle with capsid proteins of SEQ ID NO:1. In some embodiments, the production is increased in cardiac muscle as compared to a similar particle with the wild-type capsid protein (for example, a particle with capsid proteins of SEQ ID NO:1) The amount of a payload, e g , transgene, e.g., heterologous protein, e.g , therapeutic polypeptide, expressed in a subject (e.g., the serum of the subject) can vary. For example, in some embodiments the payload, e.g., protein or RNA product of a transgene, can be expressed in the serum of the subject in the amount of at least about 9 pg / ml, at least about 10 g / ml, at least about 50 pg / ml, at least about 100 pg / ml, at least about 200 pg / ml, at least about 300 pg / ml, at least about 400 pg / ml, at least about 500 pg / ml, at least about 600 pg / ml, at least about 700 pg / ml, at least about 800 pg / ml, at least about 900 pg / ml, or at least about 1000 pg / ml In some embodiments, the payload, e g , protein or RNA product of a transgene, is expressed in the serum of the subject in the amount of about 9 pg / ml, about 10 pg / ml, about 50 pg / ml, about 100 pg / ml, about 200 pg / ml, about 300 pig / ml, about 400 pg / ml, about 500 pg / ml, about 600 g / ml, about 700 pg / ml, about 800 g / ml, about 900 g / ml, about 1000 g / ml, about 1500 pig / ml, about 2000 g / ml, about 2500 pg / ml, or a range between any two of these values.
[0278] In some embodiments, for therapeutic applications, a viral particle comprising a capsid polypeptide as described herein is prepared as a pharmaceutical composition. As used herein the term “pharmaceutical composition” refers to a composition comprising at least one active ingredient (e.g., the viral particle) and optionally, one or more pharmaceutically acceptable carriers or excipients.
[0279] Relative amounts of the active ingredient, pharmaceutically acceptable carrier or excipient, and / or any additional ingredients in a pharmaceutical composition in accordance with the presentdisclosure may vary. Differences in the constitution of a pharmaceutical composition may depend upon the identity, size, and / or condition of the subject being treated, the route by which the composition is to be administered, and / or any other factor. The composition may comprise between 0.0001% and 99% (w / w) of the active ingredient By way of example, the composition may comprise between 0 0001% and 100%, e.g., between 0 5 and 50%, between 1-30%, between 5-80%, or at least 80% (w / w) active ingredient. Non limiting examples of carriers and / or excipients include solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, or combination thereof.7. NUMBERED EMBODIMENTS
[0280] While various specific embodiments have been illustrated and described, it will be appreciated that various changes can be made without departing from the spirit and scope of the disclosure(s). The present disclosure is exemplified by the numbered embodiments set forth below. Unless otherwise specified, features of any of the concepts, aspects and / or embodiments described in the detailed description above are applicable mutatis mutandis to any of the following numbered embodiments.
[0281] Various numbered embodiments below refer to virus particles, and it will be understood that such viral particles are engineered particles comprising a capsid polypeptide and a nucleic acid that do not naturally occur together in nature Further, the nucleic acid can include components that do not naturally occur together in nature. For example, a nucleic acid can comprise a payload (e.g., a nucleotide sequence of a transgene, which may encode a non-naturally occurring, e g., variant, polypeptide), one or more regulatory elements (which may comprise a non-naturally occurring, e.g., variant, regulatory sequence such as a promoter), and AAV ITRs, where two or more of such components do not naturally occur together in nature. In some embodiments, (a) a viral particle comprises a variant capsid polypeptide of a first serotype (e.g., a variant AAV9 capsid polypeptide) and ITRs from the genome of an AAV of a different serotype (e g , AAV2 ITRs) and / or (b) the payload is a transgene encoding a human polypeptide or a variant thereof.1 . A capsid polypeptide comprising:(a) a threonine at a position corresponding to Q579 of the VP1 capsid polypeptide of SEQ ID NOU;(b) a valine at a position corresponding to Q592 of the VP1 capsid polypeptide of SEQ ID NOU;(c) an alanine at a position corresponding to T593 of the VP1 capsid polypeptide of SEQ ID NOU ;(d) an alanine at a position corresponding to W595 of the VP1 capsid polypeptide of SEQ ID NOU ;(e) a leucine at a position corresponding to V596 of the VP1 capsid polypeptide of SEQ ID NOU ;(f) a serine at a position corresponding to N598 of the VP1 capsid polypeptide of SEQ ID NOU ; and(g) an alanine at a position corresponding to 1601 of the VP1 capsid polypeptide of SEQ ID NOU .2. In a capsid polypeptide, the improvement comprising:(a) a threonine at a position corresponding to Q579 of the VP1 capsid polypeptide of SEQ ID NO:1;(b) a valine at a position corresponding to Q592 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(c) an alanine at a position corresponding to T593 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(d) an alanine at a position corresponding to W595 of the VP1 capsid polypeptide of SEQ ID NO:1;(e) a leucine at a position corresponding to V596 of the VP1 capsid polypeptide of SEQ ID NO:1;(f) a serine at a position corresponding to N598 of the VP1 capsid polypeptide of SEQ ID NO:1; and(g) an alanine at a position corresponding to 1601 of the VP1 capsid polypeptide of SEQ ID NO:1.3. A capsid polypeptide comprising the peptide TVATNHQSAQAQAVAGALQSQGA (SEQ ID NO:37) or a peptide whose amino acid sequence has one to five amino acid substitutions as compared to the amino acid sequence of SEQ ID NO:37, provided that the amino acids at positions 1, 14, 15, 17, 18, 20, and 23 of the peptide are threonine, valine, alanine, alanine, leucine, serine, and alanine, respectively4. In a capsid polypeptide, the improvement comprising including within the capsid polypeptide the peptide TVATNHQSAQAQAVAGALQSQGA (SEQ ID NO:37) or a peptide whose amino acid sequence has one to five amino acid substitutions as compared to the amino acid sequence of SEQ ID NO:37, provided that the amino acids at positions 1 , 14, 15, 17, 18, 20, and 23 of the peptide are threonine, valine, alanine, alanine, leucine, serine, and alanine, respectively.5. The capsid polypeptide of embodiment 3 or embodiment 4, wherein the peptide has up to four amino acid substitutions as compared to the amino acid sequence of SEQ ID NO:37.6. The capsid polypeptide of embodiment 3 or embodiment 4, wherein the peptide has up to three amino acid substitutions as compared to the amino acid sequence of SEQ ID NO:37.7. The capsid polypeptide of embodiment 3 or embodiment 4, wherein the peptide has up to two amino acid substitutions as compared to the amino acid sequence of SEQ ID NO:37.8. The capsid polypeptide of embodiment 3 or embodiment 4, wherein the peptide has up to one amino acid substitution as compared to the amino acid sequence of SEQ ID NO:37.9. The capsid polypeptide of embodiment 3 or embodiment 4, wherein the peptide has the amino acid sequence of SEQ ID NO:37.10. The capsid polypeptide of any one of embodiments 3 to 9, wherein the peptide is in a surface loop of the capsid polypeptide.11. The capsid polypeptide of embodiment 10, wherein the surface loop comprises a VR-VIII variable region.12. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof13. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof14. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof15. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof16. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof17. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof18. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof19. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof20. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof21. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof22. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof23. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof24. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof25. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof26. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof27. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof28. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof29. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof30. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof31. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof32. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof33. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof34. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof35. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof36. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof37. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof38. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof39. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:3 or the VP2 or VP3 portion thereof40. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof41. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof42. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof43. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof44. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof45. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof46. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof47. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof48. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof49. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof50. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof51. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof52. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof53. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:5 or the VP2 or VP3 portion thereof54. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof55. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof56. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof57. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof58. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof59. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof60. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof61. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof62. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof63. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof64. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof65. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof66. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof67. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:7 or the VP2 or VP3 portion thereof68. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof69. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof70. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof71. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof72. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof73. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof74. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof75. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof76. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof77. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof78. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof79. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof80. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof81. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:9 or the VP2 or VP3 portion thereof82. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.83. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof84. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.85. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.86. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.87. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof88. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.89. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.90. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.91. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof92. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.93. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof94. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.95. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:11 or the VP2 or VP3 portion thereof.96. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 70% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.97. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 75% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof98. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 80% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO: 12 or the VP2 or VP3 portion thereof.99. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 85% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.100. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 90% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.101. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 91% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof102. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 92% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.103. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 93% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof104. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 94% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.105. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.106. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 96% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.107. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 97% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO: 12 or the VP2 or VP3 portion thereof108. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 98% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.109. The capsid polypeptide of any one of embodiments 1 to 11, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.110. A capsid polypeptide, which is optionally a capsid polypeptide according to any one of embodiments 1 to 109, which comprises the amino acid sequence of a VP1 capsid polypeptide of SEQ ID NO: 12 or the VP2 or VP3 portion thereof111. A capsid polypeptide which:(a) comprises the mutations in the mutation set present in the amino acid sequence of SEQ ID NO:12 as compared to the amino acid sequence of SEQ ID NO:1 ; and(b) comprises an amino acid sequence with an edit distance of 15 or less to the amino acid sequence of SEQ ID NO:12 (or to the VP2 or VP3 portion thereof).112. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 14 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)113. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 13 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)114. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 12 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)115. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 11 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)116. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 10 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)117. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 9 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)118. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 8 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)119. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 7 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)120. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 6 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)121. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 5 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)122. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 4 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)123. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 3 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)124. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 2 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)125. The capsid polypeptide of embodiment 111 , comprising an amino acid sequence with an edit distance of 1 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof)126. The capsid polypeptide of any one of embodiments 1 to 125, whose sequence has an edit distance of (a) 12 or lower, (b) 11 or lower, or (c) 10 or lower to a VP1 capsid polypeptide of SEQ ID NO: 1 or the VP2 or VP3 portion thereof127. The capsid polypeptide of any one of embodiments 1 to 126, whose sequence has an edit distance of (a) 12 or lower, (b) 11 or lower, or (c) 10 or lower to:(a) a VP1 capsid polypeptide of SEQ ID NO:12;(b) a VP2 capsid polypeptide corresponding to the VP2 portion of SEQ ID NO: 12; or(c) a VP3 capsid polypeptide corresponding to the VP3 portion of SEQ ID NO: 12.128 The capsid polypeptide of any one of embodiments 1 to 127, which is a VP1 capsid polypeptide129. The capsid polypeptide of any one of embodiments 1 to 127, which is a VP2 capsid polypeptide.130. The capsid polypeptide of any one of embodiments 1 to 127, which is a VP3 capsid polypeptide.131. A nucleic acid molecule encoding a capsid polypeptide of any one of embodiments 1 to 130.132. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 70% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).133. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 80% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).134. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 80% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).135. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 85% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).136. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e g , a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof)137. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 91% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).138. The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 92% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).139 The nucleic acid molecule of embodiment 131 , wherein the nucleic acid molecule comprises a nucleotide sequence having at least 93% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).140. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 94% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).141. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 95% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).142. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 96% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).143. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 97% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).144. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 98% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).145. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 99% sequence identity to the nucleotide sequence of SEQ ID NO: 13 or a fragment thereof (e.g., a VP1 -encoding, a VP2-encoding or a VP3-encoding fragment thereof).146. The nucleic acid molecule of embodiment 131, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:13 or a fragment thereof (e.g., a VP1-encoding, a VP2-encoding or a VP3-encoding fragment thereof).147. The nucleic acid molecule of any one of embodiments 131 to 146, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:13.148. The nucleic acid molecule of any one of embodiments 131 to 146, wherein the nucleic acid molecule comprises a fragment of the nucleotide sequence of SEQ ID NO: 13 that encodes a VP2 capsid polypeptide149. The nucleic acid molecule of any one of embodiments 131 to 146, wherein the nucleic acid molecule comprises a fragment of the nucleotide sequence of SEQ ID NO: 13 that encodes a VP3 capsid polypeptide.150. The nucleic acid molecule of any one of embodiments 131 to 149, wherein the nucleic acid molecule is double-stranded or single-stranded, and wherein the nucleic acid molecule is linear or circular, e.g., wherein the nucleic acid molecule is a plasmid.151. A virus particle (e.g., adeno-associated virus (“AAV”) particle) comprising a capsid polypeptide of any one of embodiments 1 to 130 or comprising a capsid polypeptide encoded by the nucleic acid molecule of any one of embodiments 131 to 150.152. In a virus particle (e.g., adeno-associated virus (“AAV”) particle) comprising a capsid polypeptide, the improvement comprising including in the capsid polypeptide:(a) a threonine at a position corresponding to Q579 of the VP1 capsid polypeptide of SEQ ID NO:1;(b) a valine at a position corresponding to Q592 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(c) an alanine at a position corresponding to T593 of the VP1 capsid polypeptide of SEQ ID NO:1;(d) an alanine at a position corresponding to W595 of the VP1 capsid polypeptide of SEQ ID NO:1;(e) a leucine at a position corresponding to V596 of the VP1 capsid polypeptide of SEQ ID NO:1;(f) a serine at a position corresponding to N598 of the VP1 capsid polypeptide of SEQ ID NO:1; and(g) an alanine at a position corresponding to 1601 of the VP1 capsid polypeptide of SEQ ID NO:1.153. In a virus particle (e.g., adeno-associated virus (“AAV”) particle) comprising a capsid polypeptide and an encapsulated nucleic acid, the improvement comprising including in the capsid polypeptide:(a) a threonine at a position corresponding to Q579 of the VP1 capsid polypeptide of SEQ ID NO:1;(b) a valine at a position corresponding to Q592 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(c) an alanine at a position corresponding to T593 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(d) an alanine at a position corresponding to W595 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(e) a leucine at a position corresponding to V596 of the VP1 capsid polypeptide of SEQ ID NO:1;(f) a serine at a position corresponding to N598 of the VP1 capsid polypeptide of SEQ ID NO:1; and(g) an alanine at a position corresponding to 1601 of the VP1 capsid polypeptide of SEQ ID NO:1.154 The virus particle of embodiment 153, wherein the encapsulated nucleic acid comprises a payload (e.g., a heterologous transgene) and one or more regulatory elements.155 The virus particle of any one of embodiments 151 or embodiment 152, comprising a nucleic acid comprising a payload (e.g., a heterologous transgene) and one or more regulatory elements156. The virus particle of embodiment 154 or embodiment 155, wherein the payload comprises a heterologous nucleic acid sequence as defined in any one of embodiments 194 to 512, 860 to 997, 1044 to 1069, and 1072 to 1289.157 The virus particle of any one of embodiments 154 to 156, wherein the one or more regulatory elements comprise a promoter.158 The virus particle of embodiment 157, wherein the promoter is a constitutive promoter159. The virus particle of embodiment 157 or embodiment 158, wherein the promoter is a CBh promoter.160. The virus particle of embodiment 159, wherein the CBh promoter comprises a nucleotide sequence having at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 14.161. The virus particle of embodiment 157, wherein the promoter is a CNS-specific promoter.162. The virus particle of embodiment 157 or embodiment 161 , wherein the promoter is a hSYN promoter.163. The virus particle of embodiment 162, wherein the hSYN promoter comprises a nucleotide sequence having at least 90%, at least 95%, at least 96%, at least 97%, or at least 98%, at least 99%, or 100% sequence identity to SEQ ID NO: 15.164. The virus particle of embodiment 157, wherein the promoter is a muscle-specific promoter.165. The virus particle of embodiment 164, wherein the muscle-specific promoter is a skeletal musclespecific promoter.166. The virus particle of embodiment 164, wherein the muscle-specific promoter is a cardiac musclespecific promoter.167. The virus particle of any one of embodiments 151 to 166, wherein said virus particle exhibits increased CNS biodistribution, e.g., as measured in a mammal, e.g., in NHP, e.g., as described herein, relative to wild-type AAV9 (e.g., a virus particle comprising capsid polypeptides of SEQ ID NO:1 or encoded by SEQ ID NO:2), optionally wherein the increased CNS biodistribution is measured using a method described in Section 8.1.168. The virus particle of any one of embodiments 151 to 167, wherein said virus particle exhibits increased brain biodistribution, e.g., as measured in a mammal, e.g., in NHP, e.g., as described herein, relative to wild-type AAV9 (e.g., a virus particle comprising capsid polypeptides of SEQ ID NO:1 or encoded by SEQ ID NO:2), optionally wherein the increased brain biodistribution is measured using a method described in Section 8.1.169 The virus particle of any one of embodiments 151 to 168, wherein said virus particle exhibits increased muscle biodistribution, e.g., as measured in a mammal, e.g., in NHP, e.g., as described herein, relative to wild-type AAV9 (e.g., a virus particle comprising capsid polypeptides of SEQ ID NO:1 or encoded by SEQ ID NO:2), optionally wherein the increased muscle biodistribution is measured using a method described in Section 8.1.170. The virus particle of any one of embodiments 151 to 169, wherein said virus particle exhibits increased skeletal muscle biodistribution, e.g., as measured in a mammal, e.g., in NHP, e.g., as described herein, relative to wild-type AAV9 (e.g., a virus particle comprising capsid polypeptides of SEQ ID NO:1 or encoded by SEQ ID NO:2), optionally wherein the increased skeletal muscle biodistribution is measured using a method described in Section 8.1.171. The virus particle of any one of embodiments 151 to 170, wherein said virus particle exhibits increased cardiac muscle biodistribution, e.g., as measured in a mammal, e.g., in NHP, e.g., as described herein, relative to wild-type AAV9 (e.g., a virus particle comprising capsid polypeptides of...
Claims
WHAT IS CLAIMED IS:1 . A capsid polypeptide comprising:(a) a threonine at a position corresponding to Q579 of the VP1 capsid polypeptide of SEQ ID NO:1;(b) a valine at a position corresponding to Q592 of the VP1 capsid polypeptide of SEQ ID NO:1;(c) an alanine at a position corresponding to T593 of the VP1 capsid polypeptide of SEQ ID NO:1;(d) an alanine at a position corresponding to W595 of the VP1 capsid polypeptide of SEQ ID NO:1;(e) a leucine at a position corresponding to V596 of the VP1 capsid polypeptide of SEQ ID NO:1 ;(f) a serine at a position corresponding to N598 of the VP1 capsid polypeptide of SEQ ID NO:1; and(g) an alanine at a position corresponding to 1601 of the VP1 capsid polypeptide of SEQ ID NO:1.
2. A capsid polypeptide comprising the peptide TVATNHQSAQAQAVAGALQSQGA (SEQ ID NO:37) or a peptide whose amino acid sequence has one to five amino acid substitutions as compared to the amino acid sequence of SEQ ID NO:37, provided that the amino acids at positions 1, 14, 15, 17, 18, 20, and 23 of the peptide are threonine, valine, alanine, alanine, leucine, serine, and alanine, respectively3 The capsid polypeptide of claim 2, wherein the peptide has the amino acid sequence of SEQ ID NO:37.
4. The capsid polypeptide of any claim 2 or 3, wherein the peptide is in a surface loop of the capsid polypeptide.
5. The capsid polypeptide of claim 4, wherein the surface loop comprises a VR-VIII variable region.
6. The capsid polypeptide of any one of claims 1 to 5, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof7. The capsid polypeptide of any one of claims 1 to 5, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:1 or the VP2 or VP3 portion thereof8. The capsid polypeptide of any one of claims 1 to 5, which comprises an amino acid sequence having at least 95% sequence identity ((a) calculated taking targeting peptide insertions into account or(b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.9 The capsid polypeptide of any one of claims 1 to 5, which comprises an amino acid sequence having at least 99% sequence identity ((a) calculated taking targeting peptide insertions into account or (b) calculated without taking targeting peptide insertions into account) to a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.
10. A capsid polypeptide which comprises the amino acid sequence of a VP1 capsid polypeptide of SEQ ID NO:12 or the VP2 or VP3 portion thereof.
11. A capsid polypeptide which:(a) comprises the mutations in the mutation set present in the amino acid sequence of SEQ ID NO:12 as compared to the amino acid sequence of SEQ ID NO:1 ; and(b) comprises an amino acid sequence with an edit distance of 15 or less to the amino acid sequence of SEQ ID NO:12 (or to the VP2 or VP3 portion thereof).
12. The capsid polypeptide of claim 11 , comprising an amino acid sequence with an edit distance of 5 or less to the amino acid sequence of SEQ ID NO: 12 (or to the VP2 or VP3 portion thereof).
13. The capsid polypeptide of any one of claims 1 to 12, whose sequence has an edit distance of (a) 12 or lower, (b) 11 or lower, or (c) 10 or lower to:(a) a VP1 capsid polypeptide of SEQ ID NO:12;(b) a VP2 capsid polypeptide corresponding to the VP2 portion of SEQ ID NO: 12; or(c) a VP3 capsid polypeptide corresponding to the VP3 portion of SEQ ID NO: 12.
14. The capsid polypeptide of any one of claims 1 to 13, which is a VP1 capsid polypeptide.
15. The capsid polypeptide of any one of claims 1 to 13, which is a VP2 capsid polypeptide.
16. The capsid polypeptide of any one of claims 1 to 13, which is a VP3 capsid polypeptide.
17. A nucleic acid molecule encoding a capsid polypeptide of any one of claims 1 to 16.
18. The nucleic acid molecule of claim 17, wherein the nucleic acid molecule comprises a nucleotide sequence having at least 95% sequence identity to the nucleotide sequence of SEQ ID NO:13 or a fragment thereof (e.g., a VP1-encoding, a VP2-encoding or a VP3-encoding fragment thereof).
19. The nucleic acid molecule of claim 17, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO:13 or a fragment thereof (e.g., a VP1-encoding, a VP2-encoding or a VP3-encoding fragment thereof).
20. A virus particle (e.g., adeno-associated virus (“AAV”) particle) comprising a capsid polypeptide of any one of claims 1 to 16 or comprising a capsid polypeptide encoded by the nucleic acid molecule of any one of claims 17 to 19.21 . The virus particle of claim 20, comprising a nucleic acid comprising a payload (e.g., a heterologous transgene) and one or more regulatory elements.
22. The virus particle of claim 21 , wherein the one or more regulatory elements comprise a promoter.
23. The virus particle of claim 22, wherein the promoter is a CNS-specific promoter.
24. The virus particle of claim 22, wherein the promoter is a muscle-specific promoter.
25. The virus particle of claim 24, wherein the muscle-specific promoter is a skeletal muscle-specific promoter.26 The virus particle of claim 24, wherein the muscle-specific promoter is a cardiac muscle-specific promoter.
27. An adeno-associated virus particle comprising (a) a capsid polypeptide of any one of claims 1 to 16 or comprising a capsid polypeptide encoded by the nucleic acid molecule of any one of claims 17 to 19 and (b) a nucleic acid comprising a payload (e.g., a heterologous transgene) and one or more regulatory elements.
28. The adeno-associated virus particle of claim 27, wherein the virus particle comprises a capsid polypeptide comprising the amino acid sequence of SEQ ID NO:12 or the VP2 or VP3 portion thereof.
29. The adeno-associated virus particle of claim 27 or 28, wherein the nucleic acid comprises AAV inverted terminal repeat sequences, optionally wherein the AAV inverted repeat sequences are AAV2 inverted terminal repeat sequences.30 A method of treating a disease or condition in a subject, comprising administering to the subject in an amount effective to treat the disease or condition:(a) a virus particle:(i) comprising the capsid polypeptide of any one of claims 1 to 16 and a heterologous nucleic acid sequence encoding a therapeutic product suitable for treating the disease or condition;(ii) comprising a capsid polypeptide encoded by the nucleic acid molecule of any one of claims 17 to 19 and a heterologous nucleic acid sequence encoding a therapeutic product suitable for treating the disease or condition, or(iii) of any one of claims 20 to 29 comprising a heterologous nucleic acid sequence encoding a therapeutic product suitable for treating the disease or condition; or(b) a composition, e.g., a pharmaceutical composition, comprising the virus particle of (a) and, optionally, a pharmaceutically acceptable carrier.31 . The method of claim 30, wherein the disease or condition is a disease or condition of the CNS.
32. The method of claim 30, wherein the disease or condition is a muscle disease or condition33. The method of claim 30, wherein the disease or condition is a disease or condition of skeletal muscle.
34. The method of claim 30, wherein the disease or condition is a disease or condition of cardiac muscle35. A method of making a virus (e.g., a dependoparvovirus particle such as an adeno-associated virus (AAV) particle), comprising:(a) providing a cell, cell-free system, or other translation system, comprising the nucleic acid molecule of any one of claims 17 to 19; and(b) cultivating the cell, cell-free system, or other translation system, under conditions suitable for the production of the virus particle, thereby making the virus particle.
36. The method of claim 35, wherein the cell, cell-free system, or other translation system comprises a second nucleic acid molecule and at least a portion of said second nucleic acid molecule is packaged in the dependoparvovirus particle.
37. The method of claim 36, wherein the second nucleic acid molecule comprises a payload, e.g., a heterologous nucleic acid sequence encoding a therapeutic product.
38. A composition, e.g., a pharmaceutical composition, comprising a virus particle of any one of claims 20 to 29, or a virus particle produced by the method of any one of claims 35 to 37, and a pharmaceutically acceptable carrier or excipient.
39. The capsid polypeptide of any one of claims 1 to 16, the nucleic acid molecule of any one of claims 17 to 19, the virus particle of any one of claims 20 to 29, or the composition of claim 38, for use in treating a disease or condition in a subject.
40. The capsid polypeptide of any one of claims 1 to 16, the nucleic acid molecule of any one of claims 17 to 19, or the virus particle of any one of claims 20 to 29, or the composition of claim 38, for use in the manufacture of a medicament for use in treating a disease or condition in a subject.
41. A host cell comprising the nucleic acid molecule of any one of claims 17 to 19.
42. The host cell of claim 41 , wherein the host cell comprises a nucleic acid encoding a rep protein.
43. The host cell of claim 41 or 42, wherein the host cell comprises a nucleic acid encoding a cap protein.
44. The host cell of any one of claims 41 to 43, wherein the host cell comprises a nucleic acid comprising one or more helper sequences45. The host cell of any one of claims 41 to 44, wherein the host cell comprises a nucleic acid comprising a payload, e.g., a heterologous nucleic acid sequence encoding a therapeutic product, e.g., as described herein.
46. A method of delivering a payload (e.g , a transgene) to a cell, comprising contacting the cell with the virus particle of any one of claims 20 to 29.
47. A method of delivering a payload (e.g , a transgene) to the CNS of a subject, comprising administering to the subject the virus particle of any one of claims 20 to 29.
48. A method of delivering a payload (e.g , a transgene) to the muscle of a subject, comprising administering to the subject the virus particle of any one of claims 20 to 29.
49. The method of claim 47 or 48, wherein the virus particle is administered systemically.
Citation Information
Patent Citations
Mutated rep encoding sequences for use in AAV production
US11060070B2
AAV vectors produced by insect cells comprising REP52 and REP78 coding sequences with differential codon biases
US11306291B2
Production of adeno-associated virus in insect cells
US20030148506A1
Compositions and methods for efficient aav vector production
US20040248288A1
Plasmid free AAV vector producing cell lines
US20220025396A1