Constructs comprising il-18 components and uses thereof
Patent Information
- Application Number
- PCT/CN2025/081002
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-03-06
- Filing Date
- 2025-03-06
- Publication Date
- 2025-10-02
AI Technical Summary
The clinical development of IL-18 has been curtailed by its limited efficacy due to high-affinity inhibitors like IL-18BP upregulation in tumors, and its dysregulation can cause autoimmune or inflammatory diseases, necessitating a need for regulated IL-18 activity to prevent aberrant immune responses.
Constructs comprising IL-18 components with modified polypeptides and masking moieties connected via cleavable linkers or peptidyl linkers of specific lengths, which reduce binding affinity to IL-18 receptors and are associated with antigen-binding moieties, such as antibodies, to enhance therapeutic window and minimize toxicity.
The constructs provide a wider therapeutic window with reduced toxicity, allowing effective targeting of IL-18 receptor-expressing cells and enhancing anti-tumor immunity while minimizing off-target effects.
Abstract
Description
CONSTRUCTS COMPRISING IL-18 COMPONENTS AND USES THEREOFCROSS-REFERENCE TO RELATED APPLICATION
[0001] This application claims priority to International Applications PCT / CN2024 / 080320, filed on March 6, 2024, the content of which is incorporated by reference in their entirety for all purposes. REFERENCE TO AN ELECTRONIC SEQUENCE LISTING
[0002] The contents of the electronic sequence listing (334302000541SEQLIST. xml; Size: 563, 001 bytes; and Date of Creation: February 28, 2025) is herein incorporated by reference in its entirety. FIELD OF THE APPLICATION
[0003] The present application relates to constructs comprising interleukin 18 (IL-18) components associated with a binding moiety that specifically binds to an antigen, that comprise IL-18 polypeptides that have decreased binding affinity relative to a wild-type IL-18 (e.g. a wild-type human IL-18) , methods of making such constructs, and methods of using such constructs in therapeutic applications. BACKGROUND OF THE APPLICATION
[0004] Interleukin 18 (IL-18, also known as interferon-gamma inducing factor) is a proinflammatory cytokine that has been found to stimulate innate lymphocytes, myeloid cells, antigen-experienced, T cells (see, e.g., Guo et al. (2012) Trends Immunol. 33, 598–606) , and natural killer (NK cells) . Therapeutically, recombinant IL-18 has been reported to synergize with immune checkpoint inhibitors (ICIs) (Ma et al. (2016) Clin Cancer Res 22: 2969–2980) and chimeric antigen receptor T (CAR-T) cells in pre-clinical models (Hu et al. (2017) Cell Rep 20, 3025–3033) . Proteins involved in the interleukin-18 (IL-18) pathway have been found to be upregulated on tumor infiltrating lymphocytes (TIL) (see, e.g., Zhou et al. (2020) Nature 583: 609–614) , suggesting that IL-18 therapy could enhance anti-tumor immunity. IL-18 has been administered to patients in clinical trials and found to be safe and well-tolerated (Robertson et al. (2006) Clin Cancer Res 12, 4265–4273) . However, clinical development of IL-18 has been curtailed by its limited efficacy. IL-18BP, a high-affinity inhibitor of IL-18 (KD < 1nM, see, e.g., Dinarello et al. (2013) Front Immunol 4: 289, doi: 10.3389 / fimmu. 2013.00289) , is frequently upregulated in diverse human and murine tumors and is believed to limit the anti-tumor activity of IL-18 in preclinical models (e.g., mice) and in clinical trials. IL-18BP-resistant IL-18 variant polypeptides, which maintain signaling potential, but are impervious to inhibition by IL-18BP, have been engineered (see, e.g., Zhou et al. (2020) Nature 583: 609–614) .
[0005] Further, as IL-18 can modulate both innate and adaptive immunity, its dysregulation can cause autoimmune or inflammatory diseases. For example, IL-18 plays a role in Th1-mediated immune responses by activating NK cells and Th1 cells, which are involved in host defense against intracellular pathogen infection through IFNγ production. IL-18 also induces the production of TNF and FasL, which are involved in growth, survival, and apoptosis. IL-18 is believed to play a role in inducing IL-4 and IL-13 production in T cells, NK cells, mast cells, and basophils, driving a Th2 response. Other mediators induced by IL-18 include inducible nitric oxide; cyclooxygenase (Cox-2) ; proinflammatory cytokines IL-1β, IL-6; chemokines IL-8, MCP-1, and MIP-1α; intracellular adhesion molecule ICAM-1; and growth factor GM-CSF. IL-18 also induces the production of cytokines such as IL-12, IL-2. Given the pleiotropic functions of IL-18, regulation of IL-18 activity is vital to prevent an aberrant immune response.
[0006] The disclosures of all publications, patents, patent applications and published patent applications referred to herein are hereby incorporated herein by reference in their entirety. SUMMARY OF THE PRESENT APPLICATION
[0007] The present application in one aspect provides a construct comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide, wherein: 1) the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide; 2) the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker; or 3) the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids. In some embodiments, the wildtype IL-18 polypeptide has an amino acid sequence of SEQ ID NO: 1. In some embodiments, the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide. In some embodiments, the binding affinity is assessed on a cell expressing an IL-18 receptor and not expressing the antigen. In some embodiments, the construct has a single IL-18 component.
[0008] In some embodiments according to any of the constructs described above, the binding moiety comprises a small molecule.
[0009] In some embodiments according to any of the constructs described above, the binding moiety does not have a Fc domain.
[0010] In some embodiments according to any of the constructs described above, the binding moiety comprises a Fc domain. In some embodiments, the Fc domain comprises an IgG Fc domain. In some embodiments, the IL-18 component is fused to C-terminus of the Fc domain. In some embodiments, the IL-18 component is a single IL-18 component in the construct that is fused to C-terminus of the Fc domain.
[0011] In some embodiments according to any of the constructs described above, the binding moiety comprises an antibody. In some embodiments, the antibody is a monovalent antibody. In some embodiments, the antibody is a multivalent antibody.
[0012] The present application in another aspect provides a construct comprising a single IL-18 component associated with a binding moiety comprising a multivalent antibody that specifically binds to an antigen, wherein the antibody comprises a Fc domain, wherein the single IL-18 component comprising a single IL-18 polypeptide comprising the wildtype IL-18 polypeptide set forth in amino acid sequence of SEQ ID NO: 1 or a variant thereof, and wherein the single IL-18 component is fused to the Fc domain. In some embodiments, the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide. In some embodiments, the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker. In some embodiments, the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids. In some embodiments, the wildtype IL-18 polypeptide has an amino acid sequence of SEQ ID NO: 1. In some embodiments, the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide. In some embodiments, the binding affinity is assessed on a cell expressing an IL-18 receptor and not expressing the antigen.
[0013] In some embodiments according to any of the constructs described above that involves an antibody, the antibody is a bivalent antibody.
[0014] In some embodiments according to any of the constructs described above that involves an antibody, the antibody is selected from the group consisting of a full-length antibody, a single-chain Fv (scFv) , a Fab, a Fab’, a F (ab’) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a nanobody (VHH) , a Fv-Fc fusion, an scFv-Fc fusion, an scFv-Fv fusion, a diabody, a tribody, and a tetrabody. In some embodiments, the antibody comprises a full-length antibody, a nanobody, a Fab, or a scFv. In some embodiments, the antibody is a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the IL-18 component is fused to one or two of the heavy chains. In some embodiments, the IL-18 component is fused to C-terminus of one or two of heavy chains and / or one or two of the light chains of the full-length antibody. In some embodiments, the two heavy chains comprise one or more modifications that promotes a knob-hole structure.
[0015] In some embodiments according to any of the constructs described above, the IL-18 component is covalently conjugated to the binding moiety. In some embodiments, the IL-18 component and the binding moiety is covalently conjugated via a linker (e.g., a PEG linker) . In some embodiments, the linker is a non-peptidyl linker that has a length equivalent to a peptidyl linker of about 1-15 amino acids (e.g., about 1-5 amino acids, e.g., about 5-10 amino acids, e.g., about 10-15 amino acids, e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids) .
[0016] In some embodiments according to any of the constructs described above, the IL-18 component is fused to the binding moiety. In some embodiments, there is a linker between the IL-18 polypeptide and the binding moiety. In some embodiments, the linker is a peptidyl linker (e.g., a GS linker) . In some embodiments, the linker has no more than about 35 amino acids. In some embodiments, the linker has about 15-35 amino acids. In some embodiments, the linker has about 1-15 amino acids. In some embodiments, the linker has about 1-5 amino acids. In some embodiments, the linker has about 5-10 amino acids. In some embodiments, the linker has about 10-15 amino acids. In some embodiments, the linker has a length about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids.
[0017] In some embodiments according to any of the constructs described above, the antigen is a tumor specific antigen or tumor associated antigen. In some embodiments, the tumor is a solid tumor. In some embodiments, the antigen is a neoantigen.
[0018] In some embodiments according to any of the constructs described above, the antigen is an antigen expressed by immune cells. In some embodiments, the immune cells are tumor infiltrating lymphocytes.
[0019] In some embodiments according to any of the constructs described above, the antigen is an immune checkpoint target expressed on T cells or NK cells. In some embodiments, the antigen is PD-1. In some embodiments, the binding domain comprises a heavy chain variable region comprising VH-CDR1, VH-CDR2, VH-CDR3, and a light chain variable region comprising VL-CDR1, VL-CDR2, VL-CDR3. In some embodiments, the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 470, wherein the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 471, wherein the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 472, wherein the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 473, wherein the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 474, wherein the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 475. In some embodiments, VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 476, wherein the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 477, wherein the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 478, wherein the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 479, wherein the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 480, wherein the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 481.
[0020] In some embodiments, the IL-18 polypeptide is a wildtype IL-18 polypeptide comprising an amino acid sequence of SEQ ID NO: 1.
[0021] In some embodiments, the IL-18 polypeptide comprises one or more modifications as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 polypeptide has a reduced binding affinity to IL18Rβ as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the binding affinity is reduced at least by 50%, 60%, 70%, 80%, or 90%, or b) by 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%. In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to the wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is with an alanine. In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, and D98, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is with an alanine. In some embodiments, the IL-18 component has a reduced binding affinity to IL18Rα as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the binding affinity is reduced at least by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%. In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, K79, K84, D98, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is with an alanine.
[0022] In some embodiments according to any of the constructs described above, the IL-18 component comprises an IL-18 polypeptide that comprises two or more modifications. In some embodiments, the two or more modifications comprise a substitution of two or more amino acids selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, K84, K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is with an alanine.
[0023] In some embodiments according to any of the constructs described above, the IL-18 polypeptide comprises the amino acid sequence of any of SEQ ID Nos: 482-491.
[0024] In some embodiments according to any of the constructs described above, the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker. In some embodiments, the masking moiety comprises an IL-18 pro-peptide. In some embodiments, the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) . In some embodiments, the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333. In some embodiments, the masking moiety comprises a truncated pro-peptide of pro-IL-18. In some embodiments, the truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336. In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding. In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα or a fragment thereof. In some embodiments, the fragment of the extracellular domain of IL-18Ra comprises a) the first and the second domains of the extracellular domain, or b) the third domain of the extracellular domain. In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.
[0025] In some embodiments according to any of the constructs described above that involves a cleavable linker, the cleavable linker comprises one or more set of amino acid sequences that are recognized and cleaved by one or more proteases. In some embodiments, the one or more proteases are one or more tumor microenvironment (TME) proteases. In some embodiments, the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator, matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease, a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase. In some embodiments, the one or more TME proteases are matrix metalloproteases, and wherein the matrix metalloproteases are selected from the group consisting of: matrix metalloprotease 1, matrix metalloprotease 2, matrix metalloprotease 3, matrix metalloprotease 8, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 12, and matrix metalloprotease 14. In some embodiments, the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 2, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 14, urokinase-type Plasminogen Activator, matriptase and legumain. In some embodiments, the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by at least two, three, or four proteases. In some embodiments, the one or more amino acid sequences are recognized and cleaved by both legumain and one, two or three of MMP9, MMP2, MMP14. In some embodiments, the one or more amino acid sequences are recognized and cleaved by both uPA and one, two or three of MMP9, MMP2, MMP14. In some embodiments, the one or more amino acid sequences are recognized and cleaved by all of uPA, legumain, MMP2, MMP14 and MMP9. In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377. In some embodiments, the cleavable linker further comprises a spacer sequence. In some embodiments, the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases. In some embodiments, the cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases. In some embodiments, at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, and each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker. In some embodiments, the spacer sequence comprises a GS linker. In some embodiments, the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids. In some embodiments, the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids. In some embodiments, the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids. In some embodiments, the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα. In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399-407, and SEQ ID NO: 492-493, 495.
[0026] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0027] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0028] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, b) a cleavage linker, and c) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0029] In some embodiments according to any of the constructs described above, the IL-18 component comprises, a) an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, and 496-500, or b) an amino acid sequence functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 340-343, 345-352, and 496-500.
[0030] In some embodiments according to any of the constructs described above, the IL-18 polypeptide has a reduced binding against IL-18 binding protein (IL-18BP) as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced a) at least by any of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%or b) by about 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0031] In some embodiments according to any of the constructs described above, the IL-18 polypeptide comprises at least three, four, five, or six mutations at G3, E6, D54, Q56, P57, N91 and R104 of an IL-18 polypeptide, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1.
[0032] In some embodiments according to any of the constructs described above, the IL-18 polypeptide comprises a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1. In some embodiments, the IL-18 polypeptide does not comprise a cysteine at position 38, and / or the IL-18 polypeptide does not comprise a cysteine at position 68. In some embodiments, the IL-18 polypeptide comprises a) a cysteine at position 117, b) a cysteine at position 76, c) an isoleucine at position 38, and d) a serine at position 68, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1.
[0033] In some embodiments according to any of the constructs described above, the IL-18 component comprises an amino acid sequence of any one of SEQ ID NOs: 2-299 and 307-318, 465-469, 482-491, optionally wherein the IL-18 component comprises an amino acid sequence of any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, 150, 465-469, 482-491.
[0034] The present application in another aspect provides one or more nucleic acids encoding any of the constructs or a portion thereof described above.
[0035] The present application in another aspect provides one or more vectors comprising the one or more nucleic acids described above.
[0036] The present application in another aspect provides a host cell comprising the one or more nucleic acids or one or more vectors described above. In some embodiments, the host cell is a eukaryotic cell, optionally wherein the host cell is CHO cell. In some embodiments, the host cell is a pro-eukaryotic cell, optionally wherein the host cell is E. coli.
[0037] The present application in another aspect provides a method of producing any one of the constructs described above or a portion thereof, comprising: (a) culturing any of the host cell described above under conditions where the construct or the portion of the construct is expressed, and; (b) recovering the construct or the portion of the construct produced by the host cell.
[0038] The present application in another aspect provides a method of treating a disease or condition, comprising administering any one of the constructs described above into an individual in need thereof.
[0039] It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art. These and other embodiments of the invention are further described by the detailed description that follows.
[0040] The disclosures of all publications, patents, patent applications and published patent applications referred to herein are hereby incorporated herein by reference in their entirety.BRIEF DESCRIPTION OF THE DRAWINGS
[0041] FIG. 1A shows a schematic diagram of an exemplary construct comprising, with a binding moiety (e.g., a tissue specific antigen targeted moiety) (A) , an IL-18 component with attenuated binding to the IL-18 receptor that has an IL-18 polypeptide (C) , and an optional half-life extending element (B) optionally fused by linkers (L1, L2) .
[0042] FIG. 1B shows a schematic diagram of another exemplary construct, with a binding moiety, (e.g., a tissue specific antigen targeted moiety) (A) , an optional half-life extending element (B) , an IL-18 polypeptide (C) , a cleavable linker (L3) and a masking moiety (D) optionally fused by linkers (L1, L2) .
[0043] FIG. 2A are schematic diagrams of an immunocytokine in different formats. The immunocytokine comprises an IgG antibody and IL-18 components in different formats.
[0044] FIG. 2B illustrates activation of human IL-18 (hIL-18) receptor mediated signaling by anti-PD1 fused to the IL-18 polypeptide MM5 in various formats.
[0045] FIG. 2C shows a schematic diagram of an immunocytokine comprising anti-PD1 IgG antibody and an IL-18 component comprising an IL-18 polypeptide with attenuated binding to the IL-18 receptor.
[0046] FIG. 2D illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused IL-18 variant MM5 (i.e. PD1-MM5) , and anti-PD1 fused to the IL-18 component comprising the IL-18 polypeptide MM5 with attenuation mutations (A1 to A7) .
[0047] FIG. 3A shows a schematic diagram of a human PD1 overexpressing HEK293 cell line with an IL-18 reporter system (NFκB-luc / hIL-18RαRβ) .
[0048] FIG. 3B illustrates activation of PD1 positive and PD1 negative hIL-18 receptor mediated signaling by anti-PD1 fused to an IL-18 component comprising an IL-18 polypeptide comprising attenuation mutations (A1 to A3) .
[0049] FIG. 4A illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused to an IL-18 component comprising either an activable IL-18 polypeptide (M12 or MM5) (i.e. PD1-M12-R-L1, PD1-MM5-R-L1) , and their activated counterparts (e.g., with their masking moieties removed) (PD1-M12-R-L1 Cut, PD1-MM5-R-L1 Cut) .
[0050] FIG. 4B illustrates hIFNγ release from human PBMC induced by anti-PD1 fused to an IL-18 component comprising either an activable IL-18 polypeptide (M12 or MM5) (i.e. PD1-M12-R-L1, PD1-MM5-R-L1) , and their activated counterparts (e.g., with their masking moieties removed) (PD1-M12-R-L1 Cut, PD1-MM5-R-L1 Cut) .
[0051] FIG. 4C illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused to an IL-18 component comprising an activable IL-18 polypeptide M12 (PD1-M12-D12) , and its activated counterpart (e.g., with the masking moiety removed) (PD1-M12-D12 Cut) .
[0052] FIG. 4D illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused to an IL-18 component comprising an activable IL-18 polypeptide MM5 (PD1-MM5-D12) , and its activated counterpart (e.g., with the masking moiety removed) (PD1-MM5-D12 Cut) .
[0053] FIG. 5A illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused to an IL-18 component comprising either an activable IL-18 polypeptide M12 or an activatable IL-18 variant MM5.
[0054] FIG. 5B illustrates hIFNγ release from human PBMC induced by anti-PD1 fused to an IL-18 component comprising either an activable IL-18 polypeptide M12 or MM5.
[0055] FIG. 5C illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused to an IL-18 component comprising an activable IL-18 polypeptide MM5 (PD1-MM5-R) with different linkers between the IL-18 polypeptide and the masking moiety (L1 to L3) .
[0056] FIG. 5D illustrates activation of hIL-18 receptor mediated signaling by anti-PD1 fused to an activable IL-18 component comprising an activatable IL-18 polypeptide MM5 (PD1-MM5-R) with different linkers between IL-18 polypeptide and the masking moiety (L1, L4) .
[0057] FIG. 6 illustrates activation of hIL-18 receptor mediated signaling in PD1 positive and PD1 negative cells by anti-PD1 fused to IL-18 components comprising an IL-18 polypeptide MM5 (i.e. PD1-MM5) with variable length of linkers between the Fc domain and the IL-18 polypeptide.
[0058] FIG. 7 illustrates activation of hIL-18 receptor mediated signaling in PD1 positive and PD1 negative cells by anti-PD1 fused to monovalent (e.g., constructs having only one IL-18 component) . IL-18 components comprising an IL-18 polypeptide MM5 (i.e. PD1-MM5-K) .
[0059] FIG. 8A illustrates activation of hIL-18 receptor mediated signaling in PD1 positive and PD1 negative cells by anti-PD1 fused to activable IL-18 components comprising a MM5 IL-18 polypeptide that also comprises amino acid mutations that attenuate receptor binding (i.e. PD1-MM5-A1-R) .
[0060] FIG. 8B illustrates activation of hIL-18 receptor mediated signaling in PD1 positive and PD1 negative cells by anti-PD1 fused to activable IL-18 components comprising a MM5 IL-18 polypeptide with mutations that attenuate receptor binding (i.e. PD1-MM5-A2-R) .
[0061] FIG. 9A, 9B. and 9C are schematics of an IL-18 component fused to a full-length antibody, an antibody having a Fc domain and two scFv domains, or an antibody having a Fc domain and two VHH domains. The triangle represents a knob-into-hole structure. The IL-18 component can be fused to C-terminus of either chain of the Fc domain.
[0062] FIGs. 10A-G illustrate activation of hIL-18 receptor mediated signaling in PD1 positive and PD1 negative cells by anti-PD1 fused to monovalent activable MM5 IL-18 polypeptides. DETAILED DESCRIPTION OF THE APPLICATION
[0063] The present application in one aspect provides construct comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide, wherein the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide. In another aspect, the present application provides a construct comprising a single IL-18 component fused with a binding moiety comprising a multivalent antibody that specifically binds to an antigen, wherein the single IL-18 component comprising a single IL-18 polypeptide, wherein the antibody comprises a Fc domain. In some embodiments, the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide. In some embodiments, the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker. In some embodiments, the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids.
[0064] The present application is at least in part based upon inventors’ unique insights that by simultaneously lowering binding affinity of an IL-18 component to an IL-18 receptor and associating the IL-18 component with a binding moiety that targets an antigen (e.g., a tissue specific antigen) , the IL-18 component have a wider therapeutic window (i.e., dosing range between a minimum effective therapeutic concentration and the minimum toxic concentration) for specifically targeting cells (e.g., cells in a tissue) which a) either by themselves (i.e., cis-signaling) or b) together with adjacent cells (i.e., trans-signaling, e.g., TIL expressing IL-18 receptor and tumor cells expressing the antigen bound by the binding moiety) express both IL-18 receptor and the antigen. This wider therapeutic window allows effective treatment with reduced or minimized toxicity.
[0065] As illustrated in more details in the Examples, the inventors demonstrate three exemplary designs that each successfully achieves lower binding affinity of an IL-18 component against the IL-18 receptor. These three exemplary methods include a) introducing one or more modifications to one or more amino acids (e.g., residues responsible for binding to IL-18Ra or IL-18Rb) in the IL-18 polypeptide, b) connecting an IL-18 polypeptide with a masking moiety via a cleavable linker, and c) connecting the IL-18 polypeptide and the binding moiety with a linker (e.g., a peptidyl linker) and modulating the linker length between the binding moiety and the IL-18 polypeptide. By coupling such IL-18 component with an exemplary binding moiety (e.g., an anti-PD-1 antibody) , the therapeutic window can be increased by 100-fold to 10000-fold. See e.g., FIGs. 3B, 4A-4B, 5A-5D, 6 and 7.
[0066] The present application is also at least in part based upon inventors’ unique insights that a construct comprising a multivalent binding moiety (e.g., a bivalent antibody) and a single IL-18 component has advantageous effects such as wider therapeutic window, less toxicity and comparable efficacy as compared to a corresponding construct with two or more IL-18 component. See e.g., FIG. 7. Accordingly, the present application in another aspect provides constructs comprising a single IL-18 component associated with a multivalent binding moiety (e.g., a multivalent antibody comprising an Fc domain) that specifically binds to an antigen.
[0067] Nucleic acids encoding the constructs or a portion thereof, vectors, host cells that comprise the constructs or a portion thereof, methods of producing constructs or a portion thereof, or methods of using the constructs e.g., for treating a cancer are also provided. Definitions
[0068] The term “antibody” is used in its broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) , full-length antibodies and antigen-binding fragments thereof, so long as they exhibit the desired antigen-binding activity.
[0069] A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variable domains of the heavy chain and light chain may be referred to as “VH” and “VL” , respectively. The variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) .
[0070] The term “single-domain antibody” or “sdAb” refers to a single antigen-binding polypeptide having three complementary determining regions (CDRs) . The sdAb alone is capable of binding to the antigen without pairing with a corresponding CDR-containing polypeptide. In some cases, sdAbs are engineered from camelid HCAbs, and their heavy chain variable domains are referred herein as “VHHs” . Camelid sdAb is one of the smallest known antigen-binding antibody fragments (see, e.g., Hamers-Casterman et al., Nature 363: 446-8 (1993) ; Greenberg et al., Nature 374: 168-73 (1995) ; Hassanzadeh-Ghassabeh et al., Nanomedicine (Lond) , 8: 1013-26 (2013) ) .
[0071] “Fv” is the minimum antibody fragment, which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy-and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
[0072] “Single-chain Fv, ” also abbreviated as “sFv” or “scFv, ” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994) .
[0073] “Percent (%) amino acid sequence identity” or “homology” with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR) , or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, %amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R. C., Nucleic Acids Research 32 (5) : 1792-1797, 2004; Edgar, R. C., BMC Bioinformatics 5 (1) : 113, 2004) .
[0074] The term “Fc domain” , “Fc region” or “fragment crystallizable region” herein is used to define a C-terminal domain or region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof. The C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody. Accordingly, a composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue. Suitable native-sequence Fc regions for use in the antibodies described herein include human IgG1, IgG2 (IgG2A, IgG2B) , IgG3 and IgG4.
[0075] A “bispecific” or “multispecific” antibody can refer to an antibody that binds to two or more different antigens, or an antibody that binds to two or more different epitopes of a same antigen.
[0076] A “multivalent” antibody refers to an antibody that has two or more antigen-binding moieties (excluding the IL-18 component) that can bind to either a same antigen or different antigens. A “bivalent” antibody refers to an antibody that has two or more antigen-binding moieties (excluding the IL-18 component) . A monovalent antibody refers to an antibody that has a single antigen-binding moiety (excluding the IL-18 component) .
[0077] An “isolated” nucleic acid molecule encoding a polypeptide or a cytokine as described herein is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment. In some embodiments, the isolated nucleic acid molecule encoding the polypeptide or the cytokine described herein is in a form other than in the form or setting in which it is found in nature.
[0078] The term “vector, ” as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors. ”
[0079] The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
[0080] The terms “host cell, ” “host cell line, ” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells, ” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, and may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
[0081] As used herein, “treatment” or “treating” is an approach for obtaining beneficial or desired results, including clinical results. For purposes of this application, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease) , preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and / or prolonging survival. Also encompassed by “treatment” is a reduction of pathological consequence of cancer (such as, for example, tumor volume) . The methods of the application contemplate any one or more of these aspects of treatment.
[0082] In the context of cancer, the term “treating” includes any or all of: inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden and ameliorating one or more symptoms associated with the disease.
[0083] The terms “inhibition” or “inhibit” refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To “reduce” or “inhibit” is to decrease, reduce or arrest an activity, function, and / or amount as compared to that of a reference. In certain embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 20%or greater. In another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 50%or greater. In yet another embodiment, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater.
[0084] The terms “subject, ” “individual, ” and “patient” are used interchangeably herein to refer to a mammal, including, but not limited to, human, bovine, horse, feline, canine, rodent, or primate. In some embodiments, the individual is a human.
[0085] It is understood that embodiments of the application described herein include “consisting” and / or “consisting essentially of” embodiments.
[0086] Reference to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X” .
[0087] As used herein, reference to “not” a value or parameter generally means and describes “other than” a value or parameter. For example, the method is not used to treat cancer of type X means the method is used to treat cancer of types other than X.
[0088] The term “about X-Y” used herein has the same meaning as “about X to about Y. ”
[0089] As used herein and in the appended claims, the singular forms “a, ” “or, ” and “the” include plural referents unless the context clearly dictates otherwise. Constructs Comprising Interleukin 18 (IL-18) Components
[0090] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) .
[0091] In another aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises: 1) an IL-18 polypeptide comprising one or more modifications as compared to a wildtype IL-18 polypeptide, 2) an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, or 3) an IL-18 polypeptide and a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids, wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the wildtype IL-18 polypeptide is human IL-18. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1. YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPR GMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFES SSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED (SEQ ID NO: 1)
[0092] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide comprising one or more modifications as compared to a wildtype IL-18 polypeptide, wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the wildtype IL-18 polypeptide comprises an amino acid sequence of SEQ ID NO: 1.
[0093] In another aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide comprising one or more modifications as compared to a wildtype IL-18 polypeptide, wherein the wildtype IL-18 polypeptide comprises an amino acid sequence of SEQ ID NO: 1, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) .
[0094] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide. In some embodiments, the masking moiety comprises a truncated pro-peptide of pro-IL-18. In some embodiments, the truncated pro-peptide comprises SEQ ID NO: 336.
[0095] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprising an amino acid sequence of SEQ ID NO: 336, b) a cleavable linker, and c) an IL-18 polypeptide comprising any one of SEQ ID NOs: 1-299, 307-318, 465-469, and 482-491. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprising an amino acid sequence of SEQ ID NO: 336, b) a cleavable linker, and c) an IL-18 polypeptide comprising any one of SEQ ID NOs: 1-299, 307-318, 465-469, and 482-491, wherein the cleavable linker has a length of no more than about 50, about 40, about 30, about 25, about 20, about 15, about 12, or about 10 amino acids. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprising an amino acid sequence of SEQ ID NO: 336, b) a cleavable linker, and c) an IL-18 polypeptide comprising any one of SEQ ID NOs: 1-299, 307-318, 465-469, and 482-491, wherein the cleavable linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0096] In one aspect, provided here are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen (e.g., PD-1) , wherein the IL-18 component comprises an IL-18 polypeptide comprising a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, K84, K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substation is with an alanine. In some embodiments, the substitution of an amino acid is selected from the group consisting of G108, H109, K112, D110, R147, M150, and G145. In some embodiments, the IL-18 component further comprises a masking moiety is fused to the IL-18 polypeptide via a cleavable linker. In some embodiments, the masking moiety comprises an IL-18 pro-peptide (e.g., SEQ ID NO: 333 or 336) . In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding (e.g., an amino acid sequence of any one of SEQ ID NOs: 353-356 or a variant thereof having at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity) . In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377, SEQ ID NOs: 399-407, and SEQ ID NO: 492-493, 495. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, P57A, C38I, C68S, S117C, and N91T. In some embodiments, the IL-18 polypeptide comprises E6G, D54L, Q56T, P57E, N91G, C38I, C68S, S117C, and R104S. In some embodiments, the IL18 -polypeptide further comprises 76C and 127C. In some embodiments, the IL-18 polypeptide further comprises at least one of G108A, H109A, and K112A. In some embodiments, the IL-18 component is fused to the binding moiety via a peptidyl linker, wherein the peptidyl linker has a length of no more than 15 amino acids (e.g., no more than about 12, 10, 8, or 5 amino acids) . In some embodiments, the binding moiety comprises an antibody comprising a Fc domain, and wherein the peptidyl linker is fused to the C-terminus of the Fc domain. In some embodiments, the antibody comprises a full-length antibody, a scFv, or a VHH.
[0097] In one aspect, provided here are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen (e.g., PD-1) , wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, wherein the masking moiety comprises a) a truncated pro-peptide of pro-IL-18 (e.g., an amino acid sequence of SEQ ID NO: 336) or b) an extracellular domain of IL-18Rα or a fragment thereof (e.g., an amino acid sequence of any one of SEQ ID NOs: 353-356) . In some embodiments, cleavable linker comprises two or more set of amino acid sequences that are recognized and cleaved by a protease. In some embodiments, the cleavable linker comprises one or more set of amino acid sequences that are recognized and cleaved by two or more proteases. In some embodiments, the one or more proteases comprise one or more tumor microenvironment (TME) proteases, and wherein the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator, matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease, a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase. In some embodiments, the amino acid sequence recognized and cleaved by a) both legumain and one, two or three of MMP9, MMP2, and MMP14, b) both uPA and one, two or three of MMP9, MMP2, and MMP14, c) all of uPA, legumain, MMP2, MMP14 and MMP9. In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377, SEQ ID NOs: 399-407, and SEQ ID NO: 492-493, 495. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, P57A, C38I, C68S, S117C, and N91T. In some embodiments, the IL-18 polypeptide comprises E6G, D54L, Q56T, P57E, N91G, C38I, C68S, S117C, and R104S. In some embodiments, the IL-18 polypeptide further comprises 76C and 127C. In some embodiments, the IL-18 polypeptide further comprises at least one of G108A, H109A, and K112A. In some embodiments, the IL-18 component is fused to the binding moiety via the peptidyl linker, wherein the peptidyl linker has a length of no more than 15 amino acids (e.g., no more than about 12, 10, 8, or 5 amino acids) . In some embodiments, the binding moiety comprises an antibody comprising a Fc domain, and wherein the peptidyl linker is fused to the C-terminus of the Fc domain. In some embodiments, the antibody comprises a full-length antibody, a scFv, or a VHH. In some embodiments, the IL-18 component comprises from N-to C-terminus, a masking moiety, a cleavage linker and the IL-18 polypeptide. In some embodiments, the IL-18 component comprises from N-to C-terminus, the IL-18 polypeptide, a cleavage linker, and a masking moiety. In some embodiments, the antibody is a full-length antibody.
[0098] In one aspect, provided here are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen (e.g., PD-1) , wherein the IL-18 component comprises an IL-18 polypeptide and a peptidyl linker, wherein the peptidyl linker connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker is no more than about 15 amino acids (e.g., no more than about 12, 10, 8, or 5 amino acids) . In some embodiments, binding moiety has a Fc domain, and the IL-18 component is fused to the C-terminus of the Fc domain. In some embodiments, the binding moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the IL-18 component is fused to C-terminus of one or both of the heavy chains. In some embodiments, the IL-18 component is fused to C-terminus of one or both of the light chains. In some embodiments, the binding moiety comprises two polypeptides, wherein each polypeptide comprises a scFv domain and a Fc region, where two Fc regions form a Fc domain, wherein the IL-18 component is fused to C-terminus of one or both of the polypeptides. In some embodiments, the binding moiety comprises two polypeptides, wherein each polypeptide comprises a VHH domain and a Fc region, where two Fc regions form a Fc domain, wherein the IL-18 component is fused to C-terminus of one or both of the polypeptides. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, P57A, C38I, C68S, S117C, and N91T. In some embodiments, the IL-18 polypeptide comprises E6G, D54L, Q56T, P57E, N91G, C38I, C68S, S117C, and R104S. In some embodiments, the IL-18 polypeptide further comprises 76C and 127C. In some embodiments, the IL-18 polypeptide further comprises at least one of G108A, H109A, and K112A.
[0099] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . Exemplary constructs are listed below. Exemplary constructs comprising IL-18 components. *Alternative heavy chain that can be used with the light chain.
[0100] In some embodiments, provided herein are constructs comprising an IL-18 component associated with a binding moiety, wherein the binding moiety comprises a full-length antibody.
[0101] In some embodiments, the construct comprises an IL-18 component associated with a binding domain comprising a full-length antibody that binds to an antigen, wherein the full-length antibody comprises two heavy chains and two light chains, and wherein the IL-18 component is fused to C-terminus of the only one of the heavy chain.
[0102] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 419, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 419, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0103] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 421, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 421, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0104] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 422, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 422, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 423, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 423.
[0105] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 424, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 424, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0106] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 425, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 425, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0107] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 426, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 426, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0108] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 427, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 427, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0109] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 428, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 428, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0110] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 429, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 429, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0111] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 430, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 430, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0112] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 431, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 431, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0113] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 432, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 432, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0114] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 433, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 433, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0115] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 434, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 434, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0116] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 435, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 435, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0117] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 436, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 436, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 437, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 437.
[0118] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 439, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 439, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 437, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 437.
[0119] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 438, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 438, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 437, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 437.
[0120] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 440, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 440, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 437, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 437.
[0121] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 441, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 441, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0122] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 442, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 442, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0123] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 443, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 443, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0124] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 444, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 444, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0125] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 445, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 445, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0126] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 448, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 448, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0127] In some embodiments, the construct comprises a) a first and a second polypeptides each comprising the amino acid sequence of SEQ ID NO: 449, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 449, and b) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0128] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 446, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 446, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 447, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 447, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0129] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 450, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 450, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0130] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 452, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 452, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0131] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 453, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 453, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0132] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 454, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 454, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0133] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 455, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 455, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0134] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 456, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 456, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0135] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 457, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 457, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0136] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 458, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 458, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0137] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 459, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 459, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0138] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 460, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 460, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0139] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 461, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 461, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0140] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 462, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 462, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0141] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 463, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 463, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 451, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0142] In some embodiments, the construct comprises a) a first polypeptide comprising the amino acid sequence of SEQ ID NO: 464, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 450, b) a second polypeptide comprising the amino acid sequence of SEQ ID NO: 464, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 451, and c) a third and a fourth polypeptides each comprising the amino acid sequence of SEQ ID NO: 420, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of SEQ ID NO: 420.
[0143] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 133. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 133, wherein the cleavable linker has a length of no more than about 50, about 40, about 30, about 25, about 20, about 15, about 12, or about 10 amino acids. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 133, wherein the cleavable linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0144] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising one or more modifications, wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising one or more modifications, wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, wherein the cleavable linker has a length of no more than about 50, about 40, about 30, about 25, about 20, about 15, about 12, or about 10 amino acids. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising one or more modifications, wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, , wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, wherein the cleavable linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids. In some embodiments, the substitution is with an alanine.
[0145] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at G108, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is G108A. In some embodiments, the IL-18 peptide is referred to as “MM5 A1. ”
[0146] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at H109, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is H109A. In some embodiments, the IL-18 peptide is referred to as “MM5 A2. ”
[0147] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at K112, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is K112A. In some embodiments, the IL-18 peptide is referred to as “MM5 A3. ”
[0148] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at D110, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is D110A. In some embodiments, the IL-18 peptide is referred to as “MM5 A4. ”
[0149] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at R147, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is R147A. In some embodiments, the IL-18 peptide is referred to as “MM5 A5. ”
[0150] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at M150, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is M150A. In some embodiments, the IL-18 peptide is referred to as “MM5 A6. ”
[0151] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising a substitution of an amino acid at G145, wherein amino acid position is relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substitution is G145A. In some embodiments, the IL-18 peptide is referred to as “MM5 A7. ”
[0152] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 39. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 39, wherein the cleavable linker has a length of no more than about 50, about 40, about 30, about 25, about 20, about 15, about 12, or about 10 amino acids. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 39, wherein the cleavable linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0153] In some embodiments, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) .
[0154] In some embodiments, the IL-18 component comprises a peptidyl linker that prevents (such as inhibits) the IL-18 polypeptide from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, the IL-18 component has a peptidyl linker to prevent (such as inhibit) the IL-18 polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, the IL-18 component has a peptidyl linker to prevent (such as inhibit) the IL-18 polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) .
[0155] In some embodiments, the IL-18 polypeptide is fused to a peptidyl linker that prevents (such as inhibits) the IL-18 polypeptide from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, the IL-18 polypeptide is fused to a peptidyl linker to prevent (such as inhibit) the IL-18 polypeptide from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, the IL-18 polypeptide is fused to a peptidyl linker to prevent (such as inhibit) the IL-18 polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) .
[0156] In some embodiments, the peptidyl linker comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the peptidyl linker comprises an amino acid sequence of any one of SEQ ID NOs: 333, 336 and 353-356. In some embodiments, the peptidyl linker comprises two or more set of amino acid sequences set forth in SEQ ID NOs: 333, 336 and 353-356. In some embodiments, the peptidyl linker has a length of no more than about 35 amino acids. In some embodiments, the peptidyl linker has a length of about 15 to 35 amino acids. In some embodiments, the peptidyl linker reduces binding of the IL-18 polypeptide to IL-18 binding protein (IL-18BP) as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, binding affinity is reduced a) at least by any of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%or b) by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0157] In one aspect, provided herein are constructs comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide and a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, and wherein the IL-18 component has a decreased binding affinity to an IL-18 receptor as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 39. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 39, wherein the cleavable linker has a length of no more than about 50, about 40, about 30, about 25, about 20, about 15, about 12, or about 10 amino acids. In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising SEQ ID NO: 336, b) a cleavable linker of SEQ ID NO. 337, and c) an IL-18 polypeptide comprising SEQ ID NO: 39, wherein the cleavable linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0158] In some embodiments, the IL-18 polypeptide is a wildtype IL-18 polypeptide and is fused to a masking moiety. In some embodiments, the IL-18 polypeptide is a wildtype IL-18 polypeptide and is fused to a peptidyl linker. In some embodiments, the IL-18 polypeptide is a wildtype IL-18 polypeptide, and is fused to a masking moiety and a peptidyl linker.
[0159] In some embodiments, the IL-18 polypeptide comprises at least one point mutation and is fused to a masking moiety. In some embodiments, the IL-18 polypeptide comprises at least one point mutation and a peptidyl linker. In some embodiments, the IL-18 polypeptide comprises at least one point mutation, and is fused to a masking moiety and a peptidyl linker.
[0160] In some embodiments, the IL-18 polypeptide comprises at least two point mutations and is fused to a masking moiety. In some embodiments, the IL-18 polypeptide comprises at least two point mutations and a peptidyl linker. In some embodiments, the IL-18 polypeptide comprises at least two point mutations, and is fused to a masking moiety and a peptidyl linker.
[0161] In some embodiments, the IL-18 polypeptide comprises at least three point mutations and is fused to a masking moiety. In some embodiments, the IL-18 polypeptide comprises at least three point mutations and a peptidyl linker. In some embodiments, the IL-18 polypeptide comprises at least three point mutations, and is fused to a masking moiety and a peptidyl linker.
[0162] In some embodiments, the IL-18 polypeptide comprises at least three point mutations and is fused to a masking moiety. In some embodiments, the IL-18 polypeptide comprises at least three point mutations and a peptidyl linker. In some embodiments, the IL-18 polypeptide comprises at least three point mutations, and is fused to a masking moiety and a peptidyl linker.
[0163] In some embodiments, the IL-18 polypeptide comprises at least four point mutations and is fused to a masking moiety. In some embodiments, the IL-18 polypeptide comprises at least four point mutations and a peptidyl linker. In some embodiments, the IL-18 polypeptide comprises at least four point mutations, and is fused to a masking moiety and a peptidyl linker.
[0164] In some embodiments, the construct, the IL-18 component, or the IL-18 polypeptide described herein has a reduced binding affinity to an IL-18 receptor (e.g., human wildtype IL-18 receptor) relative to the wildtype human IL-18 polypeptide, when the IL-18 receptor is expressed on a cell (e.g., NFκB-luc / hIL-18RαRβ HEK293 cells as described in Examples) that expresses IL-18 receptor but does not express the antigen bound by the binding affinity. In some embodiments, the binding affinity to an IL-18 receptor as assessed via EC50 (e.g., as described in Examples) or KD is reduced at least by about any of 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, or 95% (e.g., by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%) as compared to the binding affinity of a wildtype IL-18 polypeptide. In some embodiments, the binding affinity as assessed via EC50 is no more than one-hundredth, five-thousands, two-thousands, or one-thousands of the binding affinity of the IL-18 wildtype polypeptide set forth in SEQ ID NO: 1.
[0165] In some embodiments, the construct, the IL-18 component, or the IL-18 polypeptide described herein has a binding affinity to an IL-18 receptor as assessed via EC50 of at least 0.5, 1, 5, 10, 25, 50, 75, 100, 200, 500, 1000 nM on a cell (e.g., NFκB-luc / hIL-18RαRβ HEK293 cells as described in Examples) expresses IL-18 receptor but does not express the antigen bound by the binding affinity.
[0166] In some embodiments, the construct described herein has a binding affinity to an IL-18 receptor as assessed via EC50 of no more than about 10 nM, 5 nM, 1 nM, 0.5 nM, or 0.1 nM, when the IL-18 receptor is expressed on a cell that expresses both the IL-18 receptor and the antigen bound by the binding affinity (e.g., NFκB-luc / hIL-18RαRβ HEK293 cells expressing the exemplary antigen such as PD-1 as described in Examples) .
[0167] In some embodiments, the ratio of the EC50 between the EC50 with cells expressing IL-18 receptor but not the antigen bound by the binding moiety and the EC50 with cells expressing both IL-18 receptor and the antigen bound by the binding moiety is a) at least about 10, 50, 100, 200, 250, 500, 750, 1000, 2000, 2500, 5000, 7500, 10000, 15000, 20000, 25000, 30000, or 35000, or b) about any of 10-50, 50-100, 100-200, 200-250, 250-500, 500-750, 750-1000, 1000-2000, 2000-2500, 2500-5000, 5000-7500, 7500-10000, 10000-15000, 15000-20000, 20000-25000, 25000-30000, and / or 30000-35000. In some embodiments, the construct specifically binds to IL-18 receptor α ( “IL-18Rα” ) , e.g., human IL-18Rα or “hIL-18α, ” and exhibits substantially reduced binding to IL-18 binding protein ( “IL-18BP” ) , e.g., human IL-18 or “hIL-18BP. ” In some embodiments, the construct exhibits substantially reduced binding to IL-18BP, relative to the WT human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the affinity of the construct for IL-18Rα (e.g., hIL-18Rα) is comparable to the affinity of WT human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) . In some embodiments, the affinity of the construct for IL-18Rα (e.g., hIL-18Rα) is increased as compared to the affinity of WT human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) .
[0168] In some embodiments, the construct binds to IL-18Rα with a KD of less than about 5 x 10-5 M, less than about 5 x 10-6 M, less than about 5 x 10-7 M, less than about 5 x 10-8 M, less than about 5 x 10-9 M, less than about 5 x 10-10 M, or less than about 5 x 10-11 M, including any range in between these values. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-5 and about 5 x 10-11 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-11 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-10 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-9 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-8 and about 5 x 10-11 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-9 and about 5 x 10-11 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-8 and about 5 x 10-10 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-7 and about 5 x 10-10 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-9 and about 5 x 10-10 M. In some embodiments, the construct binds to IL-18Rαwith a KD of between about 5 x 10-7 and about 5 x 10-9 M. In some embodiments, the construct binds to IL-18Rα with a KD of between about 5 x 10-8 and about 5 x 10-9 M. In some embodiments, the construct binds IL-18Rα (e.g., hIL-18Rα) with a KD between about 5 x 10-5 and 5 x 10-11 M, e.g., about any one of 5 x 10-5, 6 x 10-5, 7 x 10-5, 8 x 10-5, 9 x 10-5, 1 x 10-6, 2 x 10-6, 3 x 10-6, 4 x 10-6, 5 x 10-6, 6 x 10-6, 7 x 10-6, 8 x 10-6, 9 x 10-6, 1 x 10-7, 2 x 10-7, 3 x 10-7, 4 x 10-7, 5 x 10-7, 6 x 10-7, 7 x 10-7, 8 x 10-7, 9 x 10-7, 1 x 10-8, 2 x 10-8, 3 x 10-8, 4 x 10-8, 5 x 10-8, 6 x 10-8, 7 x 10-8, 8 x 10-8, 9 x 10-8, 1 x 10-9, 2 x 10-9, 3 x 10-9, 4 x 10-9, 5 x 10-9, 6 x 10-9, 7 x 10-9, 8 x 10-9, 9 x 10-9, 1 x 10-10, 2 x 10-10, 3 x 10-10, 4 x 10-10, 5 x 10-10, 6 x 10-10, 7 x 10-10, 8 x 10-10, 9 x 10-10, 1 x 10-11, 2 x 10-11, 3 x 10-11, 4 x 10-11, or 5 x 10-11 M, including any range in between these values. In some embodiments, the affinity of the construct for IL-18Rα (e.g., hIL-18Rα) is higher than the affinity of the wild-type human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) . In some embodiments, the affinity of the construct for IL-18Rα (e.g., hIL-18Rα) is comparable to (e.g., about the same as) the affinity of the wild-type human IL-18 set forth in SEQ ID NO: 1 for IL-18Rα (e.g., hIL-18Rα) .
[0169] In some embodiments, the construct exhibits substantially reduced binding to IL-18 binding protein (IL-18BP) relative to the wild-type IL-18. In some embodiments, the construct binds to IL-18BP with a KD of more than 5 x 10-9 M. In some embodiments, the construct binds to IL-18BP with a KD of more than 5 x 10-8 M. In some embodiments, the construct binds to IL-18BP with a KD of more than 5 x 10-7 M. In some embodiments, the construct binds to IL-18BP with a KD of more than 5 x 10-6 M. In some embodiments, the construct binds to IL-18BP with a KD of more than 5 x 10-5 M. In some embodiments, the construct exhibits no binding (such as no detectable binding) to IL-18BP (e.g., hIL-18BP) . In some embodiments, an construct that exhibits no binding (e.g., no detectable binding) to IL-18BP (e.g., hIL-18BP) binds to IL-18BP (e.g., hIL-18BP) with a KD greater than 10-3 M.
[0170] The affinities of the IL-18 polypeptides, IL-18 components, or constructs described herein for IL-18 receptor, IL-18Rα and / or IL-18BP can be determined experimentally by methods known in the art. Such methods include, but are not limited to, e.g., Western blots, enzyme-linked immunosorbent assay (ELISA) , radioimmunoassay (RIA) , electrochemiluminescence (ECL) assay, immunoradiometric (IRMA) assay, enzyme immunoassay (EIA) , surface plasmon resonance (SPR) , peptide scans, and fluorescence activated cell sorting (FACS) -based kinetic competition screening. Binding Moieties
[0171] The binding moieties described herein can be any agent that specifically binds to an antigen.
[0172] In some embodiments, the binding moiety comprises a small molecule.
[0173] In some embodiments, the binding moiety does not have a Fc domain.
[0174] In some embodiments, the binding moiety comprises a Fc domain. In some embodiments, the Fc domain is a human Fc domain or a variant thereof comprising one or more amino acid substitutions. In some embodiments, the Fc domain is a human IgG Fc domain or variant thereof, e.g., a human IgG1, IgG2, or IgG4 Fc domain or a variant of any of the preceding. In some embodiments, the construct comprises, N-terminus-to-C-terminus, an IL-18 polypeptide described herein and a human IgG1 Fc variant that comprises one or more modifications that promotes a knob-hole structure. In some embodiments, the Fc domain is directly fused to the IL-18 component.
[0175] In some embodiments, the binding moiety comprises an antibody. In some embodiments, the antibody is a monovalent antibody comprising one antigen-binding moiety that specifically binds to the antigen. In some embodiments, two IL-18 components are fused to the monovalent antibody. In some embodiments, only one IL-18 component is fused to the monovalent antibody. In some embodiments, the antibody is a bivalent antibody comprising two antigen-binding moieties that specifically bind to the antigen. In some embodiments, the bivalent antibody is fused to two IL-18 components. In some embodiments, the bivalent antibody is fused to only one IL-18 component.
[0176] In some embodiments, the antibody is selected from the group consisting of a full-length antibody, a single-chain Fv (scFv) , a Fab, a Fab’, a F (ab’) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a nanobody (VHH) , a Fv-Fc fusion, an scFv-Fc fusion, an scFv-Fv fusion, a diabody, a tribody, and a tetrabody.
[0177] In some embodiments, the binding moiety specifically binds to a PD-1. In some embodiments, the binding moiety comprises a heavy chain variable region comprising a VH-CDR1, a VH-CDR2, a VH-CDR3, and a light chain variable region comprising a VL-CDR1, a VL-CDR2, a VL-CDR3, wherein the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 470, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 471, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 472, and wherein the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 473, the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 474, the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 475.
[0178] In some embodiments, the binding moiety comprises a heavy chain variable region comprising a VH-CDR1, a VH-CDR2, a VH-CDR3, and a light chain variable region comprising a VL-CDR1, a VL-CDR2, a VL-CDR3, wherein the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 476, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 477, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 478, and the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 479, the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 480, the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 481.
[0179] In some embodiments, the binding moiety comprises a single chain variable fragment (scFv) , comprising two heavy chain variable regions and two light chain variable regions. In some embodiments, the scFv is monospecific. In some embodiments, the scFv is bispecific.
[0180] In some embodiments, the binding moiety comprises a single domain antibody (nanobody; VHH) , comprising two heavy chain variable regions. In some embodiments, the binding moiety specifically binds to a PD-1. In some embodiments, the binding moiety comprises a heavy chain variable region comprising a VH-CDR1, a VH-CDR2, a VH-CDR3, wherein the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 470, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 471, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 472. In some embodiments, the binding moiety comprises a heavy chain variable region comprising a VH-CDR1, a VH-CDR2, a VH-CDR3, wherein the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 476, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 477, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 478.
[0181] In some embodiments, the binding moiety does not comprise a Fc domain.
[0182] In some embodiments, the binding moiety comprises a small molecule. Antigen
[0183] In some embodiments, the antigen is a tumor specific antigen or a tumor associated antigen. Tumor specific antigens or a tumor associated antigens may include normal proteins that are well sequestered from the immune system, proteins that are normally produced in extremely small quantities, proteins that are normally produced only in certain stages of development, or proteins whose structure is modified due to mutation.
[0184] An abundance of tumor antigens is known in the art and new tumor antigens can be readily identified by screening. Non-limiting examples of tumor antigens include EGFR, Her2, EpCAM, CD20, CD30, CD33, CD47, CD52, CD133, CD73, CEA, gpA33, Mucins, TAG-72, CIX, PSMA, folate-binding protein, GD2, GD3, GM2, VEGF, VEGFR, Integrin, αVβ3, α5β1, ERBB2, ERBB3, MET, IGF1R, EPHA3, TRAILR1, TRAILR2, RANKL, FAP and Tenascin.
[0185] In some embodiments, the antigen is a tumor associated antigen (e.g., a protein that is overexpressed on a tumor cell as compared to a corresponding non-tumor cell) . A “corresponding non-tumor cell” as used here, refers to a non-tumor cell that is of the same cell type as the origin of the tumor cell. It is noted that such proteins are not necessarily different from tumor antigens. Non-limiting examples include carcinoembryonic antigen (CEA) , which is overexpressed in most colon, rectum, breast, lung, pancreas and gastrointestinal tract carcinomas; heregulin receptors (HER-2, neu or c-erbB-2) , which is frequently overexpressed in breast, ovarian, colon, lung, prostate and cervical cancers; epidermal growth factor receptor (EGFR) , which is highly expressed in a range of solid tumors including those of the breast, head and neck, non-small cell lung and prostate; asialoglycoprotein receptor; transferrin receptor; serpin enzyme complex receptor, which is expressed on hepatocytes; fibroblast growth factor receptor (FGFR) , which is overexpressed on pancreatic ductal adenocarcinoma cells; vascular endothelial growth factor receptor (VEGFR) , for anti-angiogenesis gene therapy; folate receptor, which is selectively overexpressed in 90%of nonmucinous ovarian carcinomas; cell surface glycocalyx; carbohydrate receptors; and polymeric immunoglobulin receptor, which is useful for gene delivery to respiratory epithelial cells and attractive for treatment of lung diseases such as Cystic Fibrosis.
[0186] In some embodiments, the tumor is a solid tumor.
[0187] In some embodiments, the antigen is a neoantigen.
[0188] In some embodiments, the antigen is an antigen expressed by immune cells. In some embodiments, the immune cells are tumor infiltrating lymphocytes. In some embodiments, the antigen is an antigen expressed by immune cells. In some embodiments, the immune cells are tumor infiltrating lymphocytes.
[0189] In some embodiments, the antigen is an immune checkpoint target expressed on T cells or NK cells. In some embodiments, the antigen is PD-1. In some embodiments, the antigen is CTLA-4. Association between the binding moiety and the IL-18 component
[0190] The binding moieties and IL-18 components or IL-18 polypeptides described herein can be associated in various manners as far as the association does not prevent the IL-18 component or the binding moiety bind to their target as described in this application.
[0191] In some embodiments, the IL-18 component is covalently conjugated to the binding moiety. In some embodiments, there is a linker (e.g., a PEG linker) between the IL-18 component or the IL-18 polypeptide and the binding moiety.
[0192] In some embodiments, the IL-18 component is fused to the binding moiety. In some embodiments, there is a linker between the IL-18 polypeptide and the binding moiety, optionally wherein the linker is a peptidyl linker comprising no more than 35 amino acids.
[0193] In some embodiments, the binding moiety comprises an Fc domain comprising two polypeptides, and the IL-18 component is fused to the Fc domain. In some embodiments, the IL-18 component is fused to the C-terminus of the Fc domain. In some embodiments, a single IL-18 component is fused to the C-terminus of one of the two polypeptides in the Fc domain.
[0194] In some embodiments, the binding moiety comprises an antibody, and the antibody is a full-length antibody comprising two heavy chains and two light chains. In some embodiments, the IL-18 component is fused to one or two of the heavy chains. In some embodiments, the IL-18 component is fused to C-terminus of one or two of heavy chains and / or one or two of the light chains of the full-length antibody.
[0195] In some embodiments, the binding moiety comprises a full-length antibody comprising two heavy chains and two light chains. In some embodiments, two or more than two IL-18 polypeptides or IL-18 components are fused to the antibody. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to C-terminus of the two heavy chains. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to C-terminus of the two of the light chains. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to N-terminus of the two of the heavy chains. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to C-terminus of the two of the light chains.
[0196] In some embodiments, the binding moiety comprises a full-length antibody comprising two heavy chains and two light chains, and a single IL-18 polypeptide or a single IL-18 component is fused to the antibody. In some embodiments, the single IL-18 polypeptide or the single IL-18 component is fused to C-terminus of one of the heavy chains. In some embodiments, the single IL-18 polypeptide or the single IL-18 component is fused to C-terminus of one of the light chains. In some embodiments, the single IL-18 polypeptide or the single IL-18 component is fused to N-terminus of one of the heavy chains. In some embodiments, the single IL-18 polypeptide or the single IL-18 component is fused to N-terminus of one of the light chains.
[0197] In some embodiments, the binding moiety comprises an antibody comprising two polypeptides, wherein each of the two polypeptides comprises a scFv domain and a Fc region, wherein the two Fc regions form a Fc domain. In some embodiments, two or more than two IL-18 polypeptides or IL-18 components are fused to the antibody. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to C-terminus of the two polypeptides. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to N-terminus of the two polypeptides.
[0198] In some embodiments, the binding moiety comprises an antibody comprising two polypeptides, wherein each of the two polypeptides comprises a scFv domain and a Fc region, wherein the two Fc regions form a Fc domain, wherein a single IL-18 polypeptide or IL-18 component is fused to the antibody. In some embodiments, the single IL-18 polypeptide or IL-18 component is fused to C-terminus of one of the two polypeptides. In some embodiments, the single IL-18 polypeptide or IL-18 component is fused to N-terminus of one of the two polypeptides.
[0199] In some embodiments, the binding moiety comprises an antibody comprising two polypeptides, wherein each of the two polypeptides comprises a VHH domain and a Fc region, wherein the two Fc regions form a Fc domain. In some embodiments, two or more than two IL-18 polypeptides or IL-18 components are fused to the antibody. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to C-terminus of the two polypeptides. In some embodiments, two IL-18 polypeptides or IL-18 components are fused to N-terminus of the two polypeptides.
[0200] In some embodiments, the binding moiety comprises an antibody comprising two polypeptides, wherein each of the two polypeptides comprises a VHH domain and a Fc region, wherein the two Fc regions form a Fc domain, wherein a single IL-18 polypeptide or IL-18 component is fused to the antibody. In some embodiments, the single IL-18 polypeptide or IL-18 component is fused to C-terminus of one of the two polypeptides. In some embodiments, the single IL-18 polypeptide or IL-18 component is fused to N-terminus of one of the two polypeptides. Linkers
[0201] In some embodiments, there is a linker between the binding moiety and the IL-18 component or IL-18 polypeptide. The length, the degree of flexibility and / or other properties of the linker (s) used in the constructs may have some influence on properties, including but not limited to the affinity, specificity or avidity for one or more particular antigens or epitopes. For example, longer linkers may be selected to ensure that two adjacent domains do not sterically interfere with one another. In some embodiments, shorter linkers are selected for the purpose of curbing the binding affinity of IL-18 polypeptide or IL-18 component against IL-18 receptor. For example, see “modulation of linker length” section.
[0202] In some embodiment, a linker (such as peptide linker) comprises flexible residues (such as glycine and serine) so that the adjacent domains are free to move relative to each other. For example, a glycine-serine doublet can be a suitable peptide linker. In some embodiments, the linker is a non-peptide linker. In some embodiments, the linker is a peptide linker. In some embodiments, the linker is a non-cleavable linker. In some embodiments, the linker is a cleavable linker.
[0203] Other linker considerations include the effect on physical or pharmacokinetic properties of the resulting compound, such as solubility, lipophilicity, hydrophilicity, hydrophobicity, stability (more or less stable as well as planned degradation) , rigidity, flexibility, immunogenicity, modulation of antibody binding, the ability to be incorporated into a micelle or liposome, and the like. Peptide linkers
[0204] The peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence. For example, a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker. See, for example, WO1996 / 34103.
[0205] The peptide linker can be of any suitable length. In some embodiments, the peptide linker is at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 75, 100 or more amino acids long. In some embodiments, the peptide linker is no more than about any of 100, 75, 50, 40, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5 or fewer amino acids long. In some embodiments, the length of the peptide linker is any of about 1 amino acid to about 10 amino acids, about 1 amino acid to about 20 amino acids, about 1 amino acid to about 30 amino acids, about 5 amino acids to about 15 amino acids, about 10 amino acids to about 25 amino acids, about 5 amino acids to about 30 amino acids, about 10 amino acids to about 30 amino acids long, about 30 amino acids to about 50 amino acids, about 50 amino acids to about 100 amino acids, or about 1 amino acid to about 100 amino acids.
[0206] An essential technical feature of such peptide linker is that said peptide linker does not comprise any polymerization activity. The characteristics of a peptide linker, which comprise the absence of the promotion of secondary structures, are known in the art and described, e.g., in Dall’ Acqua et al. (Biochem. (1998) 37, 9266-9273) , Cheadle et al. (Mol Immunol (1992) 29, 21-30) and Raag and Whitlow (FASEB (1995) 9 (1) , 73-80) . A particularly preferred amino acid in context of the “peptide linker” is Gly. Furthermore, peptide linkers that also do not promote any secondary structures are preferred. The linkage of the domains to each other can be provided by, e.g., genetic engineering. Methods for preparing fused and operatively linked bispecific single chain constructs and expressing them in mammalian cells or bacteria are well-known in the art (e.g. WO 99 / 54440, Ausubel, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N. Y. 1989 and 1994 or Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y., 2001) .
[0207] The peptide linker can be a stable linker, which is not cleavable by proteases, especially by Matrix metalloproteinases (MMPs) .
[0208] The linker can also be a flexible linker (such as a GS linker) . Exemplary flexible linkers include glycine polymers (G) n, glycine-serine polymers (including, for example, (GS) n (SEQ ID NO: 501) , (GSGGS) n (SEQ ID NO: 502) , (GGGGS) n (SEQ ID NO: 503) , and (GGGS) n (SEQ ID NO: 504) , where n is an integer of at least one) , glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers are relatively unstructured, and therefore may be able to serve as a neutral tether between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side chains (See Scheraga, Rev. Computational Chem. 11 173-142 (1992) ) . The ordinarily skilled artisan will recognize that design of an antibody fusion protein can include linkers that are all or partially flexible, such that the linker can include a flexible linker portion as well as one or more portions that confer less flexible structure to provide a desired antibody fusion protein structure.
[0209] Furthermore, exemplary linkers also include the amino acid sequence of such as (GGGGS) n (SEQ ID NO: 503) , wherein n is an integer between 1 and 8, e.g. (GGGGS) 3 (SEQ ID NO: 363; referred to as “ (G4S) 3” or “GS3” ) , or (GGGGS) 6 (SEQ ID NO: 505; referred to as “ (G4S) 6” or “GS6” ) . In some embodiments, the peptide linker comprises the amino acid sequence of (GSTSGSGKPGSGEGS) n (SEQ ID NO: 506) , wherein n is an integer between 1 and 3.
[0210] Non-peptide linkers
[0211] Coupling of two moieties may be accomplished by any chemical reaction that will bind the two molecules so long as both components retain their respective activities. This linkage can include many chemical mechanisms, for instance covalent binding, affinity binding, intercalation, coordinate binding and complexation. In some embodiments, the binding is covalent binding. Covalent binding can be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents may be useful in coupling protein molecules in this context. For example, representative coupling agents can include organic compounds such as thioesters, carbodiimides, succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes and hexamethylene diamines. This listing is not intended to be exhaustive of the various classes of coupling agents known in the art but, rather, is exemplary of the more common coupling agents (See Killen and Lindstrom, Jour. Immun. 133: 1335-2549 (1984) ; Jansen et al., Immunological Reviews 62: 185-216 (1982) ; and Vitetta et al., Science 238: 1098 (1987) ) .
[0212] Linkers that can be applied in the present application are described in the literature (see, for example, Ramakrishnan, S. et al., Cancer Res. 44: 201-208 (1984) describing use of MBS (M-maleimidobenzoyl-N-hydroxysuccinimide ester) . In some embodiments, non-peptide linkers used herein include: (i) EDC (1-ethyl-3- (3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4-succinimidyloxycarbonyl-alpha-methyl-alpha- (2-pridyl-dithio) -toluene (Pierce Chem. Co., Cat. (21558G) ; (iii) SPDP (succinimidyl-6 [3- (2-pyridyldithio) propionamido] hexanoate (Pierce Chem. Co., Cat #21651G) ; (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6 [3- (2-pyridyldithio) -propianamide] hexanoate (Pierce Chem. Co. Cat. #2165-G) ; and (v) sulfo-NHS (N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510) conjugated to EDC.
[0213] The linkers described above contain components that have different attributes, thus may lead to bispecific antibodies with differing physio-chemical properties. For example, sulfo-NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NHS-ester containing linkers are less soluble than sulfo-NHS esters. Further, the linker SMPT contains a sterically hindered disulfide bond, and can form antibody fusion protein with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less antibody fusion protein available. Sulfo-NHS, in particular, can enhance the stability of carbodimide couplings. Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone. IL-18, IL-18 Receptor (IL-R) and IL-18 Binding Protein (IL-18 BP)
[0214] Interleukin-18 (IL-18, also known as interferon-gamma inducing factor) is a protein which in humans is encoded by the IL-18 gene. It is a proinflammatory cytokine which potentially can be produced by hematopoietic cells and non-hematopoietic cells. IL-18 can modulate both innate and adaptive immunity and its dysregulation can cause autoimmune or inflammatory diseases. IL-18 binds to IL18R receptor. IL-18 binding protein (IL-18BP) is a protein that binds to IL-18 and blocks binding of IL-18 to IL18R. IL-18 component and IL-18 polypeptide
[0215] The IL-18 component described herein comprises an IL-18 polypeptide. The IL-18 polypeptides can be a wildtype IL-18 polypeptide or an IL-18 variant polypeptide that has one or more modifications as compared to the human wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the IL-18 component further comprises a masking moiety that is connected with the IL-18 polypeptide via a cleavable linker. In some embodiments, the IL-18 component further comprises a linker (such as any of the linkers described in the “linkers” section above) that connects the IL-18 polypeptide and the binding moiety.
[0216] In some embodiments, the IL-18 polypeptide is the wild-type IL-18 polypeptide. In some embodiments, the wildtype IL-18 polypeptide is human IL-18. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1.
[0217] In some embodiments, the IL-18 component or the IL-18 polypeptide has a reduced binding affinity to an IL-18 receptor (e.g., human wildtype IL-18 receptor) relative to the wildtype human IL-18 polypeptide set forth in SEQ ID NO: 1. In some embodiments, the IL-18 polypeptide has a binding affinity to an IL-18 receptor as assessed via EC50 of at least 0.5, 1, 5, 10, 25, 50, 75, 100, 200, 500, 1000 nM on a cell (e.g., NFκB-luc / hIL-18RαRβ HEK293 cells as described in Examples) expresses IL-18 receptor but does not express the antigen bound by the binding affinity. In some embodiments, the binding affinity to an IL-18 receptor as assessed via EC50 (e.g., as described in Examples) or KD is reduced at least by about any of 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, or 95% (e.g., by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%) as compared to the binding affinity of a wildtype IL-18 polypeptide.
[0218] In some embodiments, the IL-18 component or the IL-18 polypeptide has a reduced binding affinity to an IL-18 binding protein (e.g., human wildtype IL-18BP) relative to the wildtype human IL-18 polypeptide set forth in SEQ ID NO: 1.
[0219] In some embodiments the IL-18 component or the IL-18 polypeptide has a) a reduced binding affinity to an IL-18 binding protein (e.g., human wildtype IL-18BP) , and b) a reduced binding affinity to an IL-18 receptor (e.g., human wildtype IL-18 receptor) , relative to the wildtype human IL-18 polypeptide set forth in SEQ ID NO: 1. Exemplary IL-18 components with reduced affinity against IL-18 receptor (e.g., wildtype human IL-18 receptor) A. Attenuation of binding affinity to IL-18 receptor by modification of IL-18 polypeptide
[0220] In some embodiments, the IL-18 polypeptide comprises one or more modifications as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , wherein the one or more modifications attenuate the binding affinity of the IL-18 polypeptide (or the IL-18 component or the construct) against the IL-18 receptor. See e.g., Nature Communications volume 5, Article number: 5340 (2014) ; Nature Structural &Molecular Biology volume 10, pages966-971 (2003) .
[0221] In some embodiments, the IL-18 polypeptide has a reduced binding affinity to IL18Rβ as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) . In some embodiments, the binding affinity is reduced by a) at least about any of 50%, 60%, 70%, 80%, or 90%or b) by 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0222] In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to the wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substation is with an alanine. In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108A, H109A, K112A, D110A, R147A, M150A, G145A, K79A, D98A, and K84A. In some embodiments, the IL-18 polypeptide comprises mutations at two or more (e.g., two, three, four, or five) of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1, e.g., in any combination.
[0223] In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, and D98, wherein amino acid positions are relative to the wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substation is with an alanine. In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108A, H109A, K112A, D110A, R147A, M150A, G145A, K79A, and D98A. In some embodiments, the IL-18 polypeptide comprises a mutation at one or more (e.g., two, three, four, or five) of G108, H109, K112, D110, R147, M150, G145, K79, and D98, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1, e.g., in any combination. Each of these substitutions have been tested and demonstrated the effect of attenuation.
[0224] In some embodiments, the one or more modifications comprises a substitution of G108A.
[0225] In some embodiments, the one or more modifications comprises a substitution of H109A.
[0226] In some embodiments, the one or more modifications comprises a substitution of K112A.
[0227] In some embodiments, the one or more modifications comprises a substitution of D110A.
[0228] In some embodiments, the one or more modifications comprises a substitution of R147A.
[0229] In some embodiments, the one or more modifications comprises a substitution of M150A.
[0230] In some embodiments, the one or more modifications comprises a substitution of G145A.
[0231] In some embodiments, the one or more modifications comprises a substitution of K79A.
[0232] In some embodiments, the one or more modifications comprises a substitution of D98A.
[0233] In some embodiments, the IL-18 component has a reduced binding affinity to IL18Rα as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced a) at least by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%, or b) by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0234] In some embodiments, the one or more modifications comprises a substitution of an amino acid selected from the group consisting of, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, K79, K84, D98, R104 and D132, wherein amino acid positions are relative to the wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substation is with an alanine. In some embodiments, the IL-18 polypeptide comprises mutations at two or more (e.g., two, three, four, or five) of K4A, L5A, K8A, R13A, D17A, E31A, M33A, T34A, D35A, D40A, K53A, R58A, M60A, K79A, K84A, D98A, R104A and D132A, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1, e.g., in any combination.
[0235] In some embodiments, the IL-18 component comprises an IL-18 polypeptide that comprises two or more (e.g., two, three, four, or five) modifications comprises a substitution of two or more (e.g., two, three, four, or five) amino acids selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, K84, K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1. In some embodiments, the substation is with an alanine. In some embodiments, the IL-18 component comprises an IL-18 polypeptide that comprises two or more (e.g., two, three, four, or five) modifications comprises a substitution of two or more (e.g., two, three, four, or five) amino acids selected from the group consisting of G108A, H109A, K112A, D110A, R147A, M150A, G145A, K79A, D98A, K84A, K4A, L5A, K8A, R13A, D17A, E31A, M33A, T34A, D35A, D40A, K53A, R58A, M60A, R104A and D132A.
[0236] In some embodiments, the IL-18 polypeptide comprises the amino acid sequence of any of SEQ ID Nos: 482-491. B. Masking moiety
[0237] In some embodiments, the IL-18 component comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker.
[0238] In some embodiments, the masking moiety comprises an IL-18 pro-peptide. In some embodiments, the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) . In some embodiments, the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333.
[0239] In some embodiments, the masking moiety comprises a truncated pro-peptide of pro-IL-18. In some embodiments, the truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336.
[0240] In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding.
[0241] In some embodiments, the masking moiety comprises an extracellular domain of IL-18Rα or a fragment thereof. In some embodiments, the fragment of the extracellular domain of IL-18Ra comprises a) the first and the second domains of the extracellular domain, or b) the third domain of the extracellular domain. In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.
[0242] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318. In some embodiments, the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the cleavage linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0243] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318. In some embodiments, the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0244] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, b) a cleavage linker, and c) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356. In some embodiments, the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150. In some embodiments, wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0245] In some embodiments, the IL-18 component comprises, a) an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, and 496-500, or b) an amino acid sequence functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 340-343, 345-352, and 496-500. Cleavable linker
[0246] In some embodiments, the cleavable linker comprises one or more set of amino acid sequences that are recognized and cleaved by one or more proteases. Exemplary masking moieties.
[0247] In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavable linker comprises an amino acid sequence recognized and cleaved by a protease (e.g., a tumor microenvironment (TME) protease, e.g., MMP9, e.g., uPA, e.g., MMP2, e.g., legumain) . In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 333, 336 and 353-356. In some embodiments, the masking moiety comprises two or more set of amino acid sequences set forth in SEQ ID NOs: 333, 336 and 353-356. In some embodiments, the cleavable linker comprises at least one amino acid sequence that is recognized and cleaved by a protease. In some embodiments, the cleavable linker comprises two or more sequences that are recognized and cleaved by proteases. In some embodiments, the two or more sequences are recognized and cleaved by different proteases. In some embodiments, the two or more sequences are recognized and cleaved by the same protease. In some embodiments, the protease is a tumor microenvironment (TME) protease. In some embodiments, the TME protease is urokinase-type Plasminogen Activator (uPA) , matriptase (MTSP-1) , legumain, prostate specific antigen (PSA) , a dipeptidyl peptidase (e.g., DPP4) , hepsin, a matrix metalloprotease (including, but not limited to, e.g., matrix metalloprotease 1 (MMP1) , matrix metalloprotease 2 (MMP2) , matrix metalloprotease 3 (MMP3) , matrix metalloprotease 8 (MMP8) , matrix metalloprotease 9 (MMP9) , matrix metalloprotease 10 (MMP10) , matrix metalloprotease 12 (MMP12) , or matrix metalloprotease 14 (MMP14) ) , a disintegrin and metalloproteinase (ADAM 10, 17, etc. ) , human leukocyte elastase (HLE) , Proteinase 3 (PR3) , prourokinase, plasminogen, staphylokinase, a serine protease, a plasmin, a cathepsin (B, L, S) , a tissue kallikrein and / or a Kallikrein-related peptidase (KLK 1, 2, 3, 6, 7) . In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: VLK, SEQ ID NOs: 337, SEQ ID NO: 338, SEQ ID NO: 339, SEQ ID NOs: 372-377, a sequence described in Kridel et al. (2002) J Biol Chem. 277 (26) : 23788-93, and a sequence described in Chen et al. (2002) J Biol Chem. 277 (6) : 4485-4491.
[0248] In some embodiments, the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 2, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 14, urokinase-type Plasminogen Activator, matriptase and legumain. In some embodiments, the cleavable linker can be recognized and cleaved by two or more proteases (such as ULM, LM9, see examples) . In some embodiments, the cleavable linker has spacer sequences (GS linker) flanking the amino acid sequence recognized by a protease. In some embodiments, the cleavable linker has a length of about 10-40, 15-40, 20-40, 20-30, or 25-30 amino acids. In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377. In some embodiments, the cleavable linker further comprises a spacer sequence, optionally wherein the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases. In some embodiments, cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, wherein each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker. In some embodiments, the spacer sequence comprises a GS linker, optionally the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids. In some embodiments, the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids. In some embodiments, the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids. In some embodiments, the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα, further optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399-407, and SEQ ID NO: 492-493, 495. In some embodiments, the IL-18 polypeptide is a wildtype IL-18 polypeptide. In some embodiments, the wildtype IL-18 polypeptide comprises an amino acid sequence of SEQ ID NO: 1.
[0249] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide, wherein the masking moiety comprises SEQ ID NO: 353.
[0250] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide, b) a cleavable linker, and c) a masking moiety. In some embodiments, the masking moiety comprises SEQ ID NO: 353.
[0251] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide, wherein the masking moiety comprises SEQ ID NO: 354.
[0252] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide, b) a cleavable linker, and c) a masking moiety. In some embodiments, the masking moiety comprises SEQ ID NO: 354.
[0253] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide, wherein the masking moiety comprises SEQ ID NO: 355.
[0254] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide, b) a cleavable linker, and c) a masking moiety. In some embodiments, the masking moiety comprises SEQ ID NO: 355
[0255] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) a masking moiety b) a cleavable linker, and c) an IL-18 polypeptide, wherein the masking moiety comprises SEQ ID NO: 356.
[0256] In some embodiments, the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide, b) a cleavable linker, and c) a masking moiety. In some embodiments, the masking moiety comprises SEQ ID NO: 356.
[0257] In some embodiments, the IL-18 component comprises a masking moiety that prevents (such as inhibits) the IL-18 polypeptide from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, the IL-18 polypeptide is masked to prevent (such as inhibit) the IL-18 polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling) . In some embodiments, the IL-18 polypeptide is masked to prevent (such as inhibit) the IL-18 polypeptides from activating IL-18 receptor mediated signaling (e.g., human IL-18 receptor mediated signaling. A list of exemplary linkers and proteases used for cleavage are included below. Exemplary linkers and proteases
[0258] In some embodiments, the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by at least two, three, or four proteases, optionally wherein the one or more amino acid sequences are recognized and cleaved by a) both legumain and one, two or three of MMP9, MMP2, and MMP14, b) both uPA and one, two or three of MMP9, MMP2, and MMP14, c) all of uPA, legumain, MMP2, MMP14 and MMP9.
[0259] In some embodiments, the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377.
[0260] In some embodiments, the cleavable linker further comprises a spacer sequence. In some embodiments, the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases.
[0261] In some embodiments, the cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases. In some embodiments, at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, wherein each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker.
[0262] In some embodiments, the spacer sequence comprises a GS linker. In some embodiments, the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids.
[0263] In some embodiments, the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids. In some embodiments, the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids. In some embodiments, the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα. In some embodiments, the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356. In some embodiments, the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399-407, and SEQ ID NO: 492-493, 495. C. Modulation of linker length between the binding moiety and the IL-18 component
[0264] In some embodiments, the IL-18 component is fused to the binding moiety. In some embodiments, the IL-18 component is covalently conjugated to the binding moiety. In some embodiments, there is a linker between the binding moiety and the IL-18 component. In some embodiments, there is no linker between the binding moiety and the IL-18 component.
[0265] In some embodiments, the linker is a non-peptidyl linker (e.g., a PEG linker) . In some embodiments, the non-peptidyl linker has a length equivalent to a peptidyl linker of about 1-15 amino acids (e.g., about 1-5 amino acids, e.g., about 5-10 amino acids, e.g., about 10-15 amino acids, e.g., about or no more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids) .
[0266] In some embodiments, the linker is a peptidyl linker (e.g., a GS linker) . In some embodiments, the linker has no more than about 35 amino acids. In some embodiments, the linker has about 15-35 amino acids. In some embodiments, the linker has about 1-15 amino acids. In some embodiments, the linker has about 1-5 amino acids. In some embodiments, the linker has about 5-10 amino acids. In some embodiments, the linker has about 10-15 amino acids. In some embodiments, the linker has a length no more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids. In some embodiments, the linker has a length about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids. IL-18 component or IL-18 polypeptides with reduced affinity against IL-18 binding protein (e.g., wildtype human IL-18 binding protein)
[0267] In some embodiments, the IL-18 component or IL-18 polypeptide has a reduced binding affinity to IL-18BP relative to an IL-18 polypeptide set forth in SEQ ID NO: 1. In some embodiments, the binding affinity is reduced at least by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%, or b) by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%e.g., as measured via KD as discussed below.
[0268] In some embodiments, the one or more mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide comprises mutations at two or more of G3, E6, D54, and N91, e.g., in any combination. In some embodiments, the two or more mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptidecomprises mutations at three or more of G3, E6, D54, and N91, e.g., in any combination. In some embodiments, the three or more mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide comprises mutations at G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide does not comprise mutations at positions other than G3, E6, D54, and / or N91. In some embodiments, the IL-18 polypeptide comprises (or further comprises) mutations at positions other than at G3, E6, D54, and / or N91. In some embodiments, the IL-18 polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, or at least 4 mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the wild-type IL-18 is human IL-18 comprising the amino acid sequence of SEQ ID NO: 1.
[0269] In some embodiments, the IL-18 polypeptide comprises (e.g., further comprises) at least one mutation at a residue selected from the group consisting of Q56, P57, M60, Q103, R104, M113, and N155, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1.
[0270] In some embodiments, the IL-18 polypeptide comprises a mutation at residue G3, wherein the mutation is selected from the group consisting of G3P, G3D, G3E, G3N, and G3S. As used herein, “G3X” means that G, i.e., the wild type amino acid at position 3 of SEQ ID NO: 1, has been replaced with amino acid X. In some embodiments, the mutation is G3P, i.e., the wild type G at position 3 of SEQ ID NO: 1 has been replaced with amino acid P.
[0271] In some embodiments, the variant polypeptide comprises (such as further comprises) a mutation at residue E6, wherein the mutation is selected from the group consisting of E6R, E6K, E6G, E6T, E6A, E6S, E6E, E6L, E6M, and E6N. In some embodiments, the mutation is selected from the group consisting of E6R, E6K, E6G, E6T, E6A, and E6S. In some embodiments, the mutation is selected from the group consisting of E6R and E6K.
[0272] In some embodiments, the variant polypeptide comprises (such as further comprises) a mutation at residue D54, wherein the mutation is selected from the group consisting of D54W, D54H, D54S, D54Q, D54L, D54Y, D54P, D54A, D54F, D54G, and D54T. In some embodiments, the mutation is selected from the group consisting of D54W, D54H, D54S, D54Q, D54L, and D54Y.
[0273] In some embodiments, the variant polypeptide comprises (such as further comprises) a mutation at residue N91, wherein the mutation is selected from the group consisting of N91V, N91A, N91G, N91S, N91I, N91P, N91R, N91T, N91C, N91K, and N91W. In some embodiments, the mutation is selected from the group consisting of N91V, N91A, N91G, and N91S.
[0274] In some embodiments, the variant polypeptide further comprises a mutation at residue R104, wherein the mutation is selected from the group consisting of R104S, R104Y, R104T, R104L, R104V, R104A, R104F, R104H, R104I, and R104N. In some embodiments, the mutation is selected from the group consisting of R104S, R104Y, and R104T. In some embodiments, the IL-18 polypeptide comprises no mutation at residue R104.
[0275] In some embodiments, wherein the IL-18 polypeptide comprises (such as further comprises) a mutation at residue Q56, the mutation is selected from the group consisting of Q56T, Q56G, Q56R, Q56S, Q56D, Q56P, Q56I, Q56Y, Q56H, Q56L, Q56E, Q56F, Q56N, and Q56V. In some embodiments, the mutation is selected from the group consisting of Q56T, Q56G, Q56R, Q56S, Q56D, Q56P, Q56I, and Q56Y.
[0276] In some embodiments, wherein the IL-18 polypeptide comprises (such as further comprises) a mutation at residue P57, the mutation is selected from the group consisting of P57A, P57G, P57R, P57W, P57S, P57T, P57V, P57Q, P57H, P57K, P57N, P57Y, and P57D. In some embodiments, the mutation is selected from the group consisting of P57A, P57G, P57R, P57W, P57S, P57T, and P57V.
[0277] In some embodiments, the IL-18 polypeptide comprises mutations at one or more of G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide comprises mutations at two or more of G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide comprises mutations at three or more of G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide comprises mutations at G3, E6, D54, and N91. In some embodiments, wherein the IL-18 polypeptide comprises a G3P mutation. Additionally or alternatively, in some embodiments, the IL-18 polypeptide comprises a E6R or E6K mutation. Additionally or alternatively, in some embodiments, the IL-18 polypeptide comprises a D54W, D54H, D54S, or D54Q mutation. Additionally or alternatively, in some embodiments, the IL-18 polypeptide comprises a N91V, N91A, N91G, or N91S mutation. In some embodiments, the IL-18 polypeptide does not comprise mutations at positions other than G3, E6, D54, and / or N91. In some embodiments, the IL-18 polypeptide further comprises mutations at positions other than at G3, E6, D54, and / or N91. In some embodiments, the IL-18 polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, or at least 4 mutations are selected from the group consisting of: G3, E6, D54, and N91. In some embodiments, the IL-18 polypeptide further comprises mutations at Q56 and / or P57. In some embodiments, the IL-18 polypeptide does not comprise mutations at positions other than G3, E6, D54, N91, Q56 and / or P57. In some embodiments, the IL-18 polypeptide further comprises mutations at positions other than at G3, E6, D54, N91, Q56 and / or P57. In some embodiments, the IL-18 polypeptide comprises one or more mutations (such as any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 mutations) , wherein at least one, at least 2, at least 3, at least 4 mutations, at least 5 mutations, or at least 6 mutations are selected from the group consisting of: G3, E6, D54, N91, Q56, and P57.
[0278] In some embodiments, the IL-18 polypeptide comprises at least one mutation (or two, or three) at a residue selected from the group consisting of G3, E6, and M60, wherein the amino acid positions is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 polypeptide comprises at least one of a) G3P, G3S, G3E, G3N, G3D, or G3A; b) E6K, E6T, E6R, E6A, E6M, E6L, E6G, E6H, E6S, or E6Y; or c) M60K. In some embodiments, the IL-18 polypeptide further comprises at least one or more (e.g., two, three, four, or five) mutations at a residue selected from the group consisting of V11, D54, Q56, P57, N91, K96, R104, R140, I149, and N155. In some embodiments, the IL-18 polypeptide further comprises at least one of a) D54H, D54W, D54Q, D54S, D54G, D54P, D54L, D54Y, D54F, D54R, or D54A; b) Q56D, Q56P, Q56H, Q56G, Q56T, Q56R, Q56L, Q56I, Q56S, Q56Y, Q56E, or Q56V; c) P57R, P57D, P57V, P57W, P57A, P57N, P57S, P57T, P57Q, P57G, P57K, P57H, P57L, P57I or P57E; d) N91V, N91G, N91A, N91S, N91T, N91R, N91K, N91P, N91I, or N91W; e) R104V, R104T, R104Y, R104F, R104T, R104L, R104S, R104A, R104E, R104I; f) N155K; g) V11I; h) K96D or K96E; i) I149M; or j) K140R.
[0279] In some embodiments, the IL-18 polypeptide comprises mutations at two or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, or thirteen) of F2, G3, E6, V11, Q24, L29, D54, A61, N91, K96, R107, K140, and I149, wherein amino acid positions are relative to a wild type (WT) human IL-18 set forth in SEQ ID NO: 1, e.g., in any combination.
[0280] In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54H, Q56D, P57R, N91V, and R104V. In some embodiments, the IL-18 polypeptide comprises G3S, E6K, D54W, Q56P, P57D, N91G, and R104T. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54W, Q56H, P57V, N91A, and R104Y. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54W, Q56G, P57V, N91V, and R104F. In some embodiments, the IL-18 polypeptide comprises G3E, E6T, D54W, Q56P, P57W, N91V, R104T, and N155K. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54W, Q56T, N91V, and R104T. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54H, Q56T, P57A, and N91A. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54W, Q56P, P57A, N91A, and R104L. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54W, Q56R, P57A, N91S, and R104S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54Q, Q56L, P57W, and N91S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54S, Q56R, P57N, N91G, and R104T. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, P57A, and N91T. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54Q, Q56I, and P57W. In some embodiments, the IL-18 polypeptide comprises G3N, E6K, D54P, Q56S, P57S, N91R, and R104A. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54S, Q56Y, P57T, and N91G. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54S, Q56R, P57N, N91G, and R104S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54L, Q56T, P57A, and N91G. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54S, Q56R, P57R, N91G, and R104S. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54H, Q56E, P57Q, and N91A. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54S, Q56R, P57S, N91G, and R104S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54S, Q56S, P57T, N91G, and R104S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54Y, Q56R, P57G, N91K, and R104S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54Y, Q56T, and P57R. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54Y, Q56T, and P57S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54L, Q56T, P57T, and N91R. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54H, Q56D, P57K, N91V, and R104Y. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54H, Q56Y, P57T, N91V, and R104Y. In some embodiments, the IL-18 polypeptide comprises G3P, E6A, D54W, Q56G, P57G, N91V, and R104Y. In some embodiments, the IL-18 polypeptide comprises G3P, E6M, D54F, Q56D, P57R, and N91P. In some embodiments, the IL-18 polypeptide comprises G3P, E6L, D54H, Q56T, P57V, and N91S. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54H, Q56I, P57H, N91I, and R104Y. In some embodiments, the IL-18 polypeptide comprises G3P, E6G, D54S, Q56S, and P57R. In some embodiments, the IL-18 polypeptide comprises G3E, E6H, D54R, Q56T, and P57H. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54H, Q56R, P57N, N91V, and R104E. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54G, Q56G, P57A, and N91G. In some embodiments, the IL-18 polypeptide comprises G3P, E6S, D54A, Q56D, P57Q, and N91G. In some embodiments, the IL-18 polypeptide comprises G3P, E6G, D54Q, Q56V, and P57W. In some embodiments, the IL-18 polypeptide comprises G3P, E6S, D54W, Q56G, P57A, N91V, and R104I. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54W, Q56P, P57G, N91V, and R104L. In some embodiments, the IL-18 polypeptide comprises G3D, E6K, D54P, Q56S, P57W, and N91W. In some embodiments, the IL-18 polypeptide comprises a substitution comprising G3P. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, and P57A. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54L, Q56G, P57S, and N91V. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, V11I, D54G, Q56G, P57A, and N91G. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54H, Q56Y, and P57S. In some embodiments, the IL-18 polypeptide comprises E6R, D54W, Q56S, and P57Q. In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54L, Q56T, P57Q, and N91V. In some embodiments, the IL-18 polypeptide comprises G3A, E6Y, D54R, Q56S, P57L, and N91G. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, D54L, Q56T, P57I, and N91G. In some embodiments, the IL-18 polypeptide comprises E6G, D54L, Q56T, P57E, N91G, and R104S. In some embodiments, the IL-18 polypeptide comprises G3A, E6Y, D54R, Q56S, P57L, and N91A. In some embodiments, the IL-18 polypeptide comprises M60K, and K96D. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, and K96E. In some embodiments, the IL-18 polypeptide comprises a substitution comprising M60K. In some embodiments, the IL-18 polypeptide comprises G3P, and E6R. In some embodiments, the IL-18 polypeptide comprises G3P, and E6K. In some embodiments, the IL-18 polypeptide comprises G3D, E6K, and N91S. In some embodiments, the IL-18 polypeptide comprises G3S, and I149M. In some embodiments, the IL-18 polypeptide comprises G3P, E6R, and N91S. In some embodiments, the IL-18 polypeptide comprises a substitution comprising E6R. In some embodiments, the IL-18 polypeptide comprises E6R, and N91S. In some embodiments, the IL-18 polypeptide comprises a substitution comprising V11I. In some embodiments, the IL-18 polypeptide comprises G3S, and K140R.
[0281] See below for exemplary IL-18 polypeptides described above that have been generated and tested.
[0282] Table 1. Single-Clone FACS Results for 117 Clones
[0283] The affinities of IL-18 variant polypeptides for hIL-18Rα were assessed by Biolayer Interferometry (BLI) on Octet RED96 using Protein A sensor coated with hIL-18Rα ECD-Fc fusion protein, and WT hIL-18 was used as a control. The binding affinities of WT hIL-18 and IL-18 variant polypeptides for hIL-18Rα ECD-Fc were as shown in Table 2A. Table 2A. Affinities of IL-18 variant polypeptides for hIL-18Rα (as determined by BLI)
[0284] The mutations of theses IL-18 variant polypeptides (i.e., M1-M41, LM1-LM5, MM1-MM2, MM4-MM6, WM1-WM6, WM8, WM10-WM14, corresponding to SEQ ID NOs: 1-4, 8-9, 11-12, 17, 21-22, 26-28, 35, 38-39, 41, 43-44, 49-50, 54-56, 58-59, 65-66, 72-74, 81, 91, 94, 99, 104-105, 114, 116-117, 121-125, 131-134, 139-145, 147, 149-153) were shown in Table 2B. Table 2B.
[0285] As shown in Table 3, all the IL-18 variant polypeptides tested showed potency of activating IL-18 receptor-mediated signaling in a dose dependent manner. Unlike WT hIL-18, the activity of which was greatly decreased (by about 80-fold) in the presence of 1 μg / mL hIL-18BP-hFc, the IL-18 variant polypeptides (i.e., M1-M7, M9-M41, LM1-LM5, MM1-MM2, MM4-MM6, WM1-WM6, WM8, WM10-11, corresponding to SEQ ID NOs: 2-4, 8-9, 11-12, 17, 21, 22, 26-28, 35, 38, 39, 41, 43, 44, 49, 50, 54-56, 58-59, 65-66, 72-74, 81, 91, 94, 99, 104-105, 114, 116-117, 121-125, 131-134, 139-145, 147, 149-150) demonstrated hIL-18 BP-resistant activity with changes of EC50 by no more than 3 folds, indicating that the IL-18 variant polypeptides were significantly less affected by Hil-18BP in view of Hil-18 receptor-mediated signaling activation. One exception is WM6, EC50 of which shows ~12-fold potency loss in the presence of 1 μg / mL hIL-18BP-hFc, which is still a lot better than the WT hIL-18. Table 3. EC50s of IL-18 Variant Polypeptides in hIL-18 Reporter Assay, in the Presence or Absence of 1 μg / mL hIL-18BP-hFc
[0286] PBMC-based assays were performed to test abilities of IL-18 variant polypeptides in activating T / NK cells and inducing hIFNγ release. Briefly, human PBMC cells were seeded in the wells of 96-well plate at a density of 5.0×105 cells per well and cultured for 5 hours before treatment. WT hIL-18 or IL-18 variant polypeptides were serially diluted with 1 ng / mL human IL-12 in (a) the presence or (b) the absence of 1 μg / mL hIL-18 BP-hFc, and then supplemented to the wells. Culture medium was collected from each well after 16 hour incubation at 37℃, and hIFNγ concentration was measured via FRET using a kit (62HIFNGPEG, Cisbio) according to manufacturer’s instructions.
[0287] The tested IL-18 variant polypeptides showed potency of inducing hIFNγ release from PBMC in a dose dependent manner. In addition, as shown in Table 4, the activity of WT hIL-18 was greatly attenuated in the presence of 1 μg / mL hIL-18BP-hFc, with a decrease of EC50 by about 35 folds. In contrast, the IL-18 variant polypeptides (i.e., M11-M13, M15, M17, M21, M24, M29, M32-M33, M35-M36, MM5, WM4-WM6, WM8, WM10-11, corresponding to SEQ ID NOs: 3, 9, 17, 27, 39, 43, 49, 94, 105, 116-117, 133, 143-150) demonstrated hIL-18 BP-resistant activity with changes of EC50 by no more than 2 folds, indicating that the IL-18 variant polypeptides were significantly less affected by hIL-18BP in view of hIFNγ induction. Table 4. EC50s of IL-18 Variant Polypeptides in PBMC Assay, in the Presence or Absence of 1 μg / mL hIL-18BP IL-18 polypeptides with one or more cysteine substitution
[0288] It was found that wildtype IL-18 human polypeptide was difficult to be expressed in a eukaryotic cell (such as CHO cell) . As discussed below, inventors found that by substituting one or more cysteine substitutions in IL-18 polypeptide, the yield and / or purity of the IL-18 polypeptide are significantly increased.
[0289] Wild-type IL-18 and IL-18 variant polypeptides M12 and MM5 were modified (or further modified) to comprise C38S, C68S, and C76S substitutions to generate new variants comprising the amino acid sequences (see SEQ ID Nos: 307-309) .
[0290] Next, the C-termini of each of IL-18-SSS, M12-SSS, and M5-SSS were fused to the N-terminus of a human IgG1 Fc comprising an N297A substitution (EU numbering) to generate IL-18-SSS-Fc_N297A (SEQ ID NO: 319) , M12-SSS_N297A (SEQ ID NO: 320) , and M5-SSS_N-297A (SEQ ID NO: 321) . The fusion polypeptides were expressed in CHO cells, harvested, and purified via Protein A chromatography. The yield of IL-18-SSS-Fc_N297A obtained following one step Protein A purification was 14.7 mg / L, with 65%purity. By contrast, the yield of WT IL-18-Fc_N297A obtained following one step Protein A purification was ~ 16 mg / L, with 11%purity. The yield of M12-SSS-Fc_N297A obtained following one step Protein A purification was 5.6 mg / ml, with 72%purity. By contrast, M12-Fc_N297A was not expressed at a detectable level in 100 mL CHO host cells. The yield of MM5-SSS-Fc_N297A obtained following one step Protein A chromatography was 24.5 mg / L, with 46%purity. Following a further purification step by gel filtration, the yield of MM5-SSS-Fc_N297 was 3.4 mg / L, with 99%purity. By contrast, MM5-Fc_N297A was not expressed at a detectable level in 100 mL CHO host cells.
[0291] M12-SSS was further modified to comprise a C127S substitution to generate M12-SSSS (SEQ ID NO: 322) .
[0292] The C-terminus of M12-SSSS was fused to the N-terminus of a human IgG1 Fc variant comprising an N297A substitution (EU numbering) to generate M12-SSSS-Fc_N297A (SEQ ID NO: 322) . M12-SSSS-Fc_N297A was expressed in CHO cells, harvested, and purified via Protein A chromatography. Introduction of the C127S substitution (i.e., a fourth C→S substitution) led to decreased yield and purity of M12-SSSS-Fc_N297A as compared to the yield and purity of M12-SSS-Fc_N297A (data not shown) .
[0293] Next, the potencies of IL-18-SSS-Fc_N297A and M12-SSS-Fc_N297A in activating IL-18 receptor-mediated signaling were characterized. The potency of IL-18-SSS-Fc_N297A showed was comparable to that of wild-type IL-18 (data not shown) , whereas M12-SSS-Fc_N297A showed a ~7-fold potency loss as compared to M12 (data not shown) . The signaling activity of IL-18-SSS-Fc_N297A decreased in the presence of 1 μg / ml hIL-18 BP-hFc ( “BP” ) , whereas M12-SSS-Fc_N297A demonstrated hIL-18 BP-resistant activity in the presence of 1 μg / ml hIL-18BP-hFc. MM5-SSS-Fc_N297A showed a ~220-fold potency loss as compared to MM5, but demonstrated hIL-18 BP-resistant activity in the presence of 1 μg / ml hIL-18BP-hFc. Such results indicate that that the 3 cystine → serine substitutions do not affect IL-18 BP resistance. These data suggests that C38, C68, and C76 are critical for improving the yield of IL-18 and of IL-18 polypeptide-Fc fusion protein during production and following purification, with improved yield and purity. MM5-SSS-Fc_N297A may exhibit a higher half-life than MM5.
[0294] In silico screening was performed based on molecular dynamic simulation, and following AI-based stability assessment, mutation hot spots on each of the four cystines (C38, C68, C76, and C127) of M12 were identified as listed. See Table 5. In addition, structure-guided design was used to identify amino acids in spatial positions which, when substituted to Cys residue (s) , would permit the formation of new, non-native disulfide bond (s) . The mutation strategies shown in Table 5 (i.e., DB6, DB7, DB8, DB9, and DB10) were proposed. Table 5. M12-Derived IL-18 Polypeptide Variants
[0295] The mutation strategies in Table 5 were introduced into IL-18 polypeptide variant M12 to generate new variants M12-DB6, M12-DB7, M12-DB8, M12-DB9, and M12-DB10. (SEQ ID Nos: 311-315) .
[0296] The C-termini of each of M12-DB6, M12-DB7, M12-DB8, M12-DB9, and M12-DB10 variant was fused to a human IgG1 Fc variant comprising an N297A substitution (EU numbering) . The resulting fusion polypeptides, i.e., M12-DB6-Fc_N297A (SEQ ID NO: 323) , M12-DB7-Fc_N297A (SEQ ID NO: 324) , M12-DB8-Fc_N297A (SEQ ID NO: 325) , M12-DB9-Fc_N297A (SEQ ID NO: 326) , and M12-DB10-Fc_N297A (SEQ ID NO: 327) , were expressed in CHO cells, harvested, and purified via Protein A chromatography.
[0297] M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A showed greatly improved expression yields and / or purity than either M12-Fc_N297A or M12-SSS-Fc_N297A. Among M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A, M12-DB6-Fc_N297A exhibited the highest expression yield (313 mg / L) with 89.8%purity (as determined by SEC-HPLC) after one-step Protein A purification. M12-DB8-Fc_N297A was not expressed at detectable levels. The expression yield of M12-DB7-Fc_N297A was about 50%of the yield of M12-DB6-Fc_N297A. M12-DB7-Fc_N297A showed similar purity with M12-DB6-Fc_N297A following Protein A chromatography.
[0298] The high yield and purity, especially the high yield, of DB6 and DB7 are striking. The M12-DB6 format is about 60-fold of the SSS format. The data suggests that the strategy of removing cysteine at position 38 and 68 while introducing C117 to promote a disulfide bond between C117 and C76 is highly advantageous.
[0299] The lower yield of DB7 and undetectableness of DB8 suggests that a C127X substitution may not further improve polypeptide production in mammalian cells. Mutation on the partially exposed site C127 needs delicate design. Based on C38X+C68X+C76+S117C strategy, the 127 site prefers C over A, while the hydrophobic 127I impacts dramatically to the proper folding of IL-18 polypeptide. We further tested corresponding variant IL-18-DB6 polypeptide with C127N, C127T and C127S, and all three can be expressed at comparable levels as DB6. Given the partial exposure nature of the 127 site and the results, one should avoid introducing an amino acid with a hydrophobic side chain at the 127 site under this strategy.
[0300] Next, the potencies of M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A in activating IL-18 receptor-mediated signaling were characterized. M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, M12-DB9-Fc_N297A, and M12-DB10-Fc_N297A showed much higher potency in activating IL-18 receptor-mediated signaling than WT IL-18. The signaling activities of M12-DB6-Fc_N297A, M12-DB7-Fc_N297A, and M12-DB9-Fc_N297A tested were not inhibited in the presence of 1 μg / ml hIL-18BP-hFc.
[0301] Next, “DB6” substitutions, i.e., C38I, C68S, and S117C, were introduced into variant MM5 to generate MM5-DB6 (see SEQ ID NO: 316) .
[0302] “DB6” substitutions were also introduced into wild-type IL-18 to generate WT IL18-DB6 (see SEQ ID NO: 317) .
[0303] An additional variant, WT-DBo was designed by introducing an S117C substitution into wild-type IL-18 (see SEQ ID NO: 318) .
[0304] The C-termini of each of WT IL-18-DB6, WT IL-18-DBo, and MM5-DB6 was fused to the N-terminus of a human IgG1 Fc variant comprising an N297A substitution (EU numbering) . The resulting fusion polypeptides, WT IL18-DB6-Fc_N297A (SEQ ID NO: 328) , WT IL-18-DBo-Fc_N297A (SEQ ID NO: 329) , and MM5-DB6-Fc_N297A (SEQ ID NO: 330) , were expressed in CHO cells, harvested, and purified via Protein A chromatography. The purified preparations were analyzed via SEC and SDS PAGE (data not shown) . There is no detectable protein of WT IL18-DBo-Fc_N297A after same expression and purification procedure. The expression yield of WT IL18-DB6-Fc was 157 mg / L, and WT IL18-DB6-Fc_N297A was 91.6%pure (as determined by SEC-HPLC) following one-step Protein A chromatography. This data confirmed the highly advantageous strategy of promoting a disulfide bond between C76 and C117 while removing cysteine at position 38 and 68. Such data also indicate that merely introducing a disulfide bond between C76 and C117 may not be sufficient to improve fusion polypeptide expression in mammalian cells. Improved expression in mammalian cells is achieved with fusion polypeptides comprising an IL-18 variant that comprises (i) an engineered C76-C117 disulfide bond, (ii) a C38 substitution (see Table 5) , and (iii) a C68 substitution (see Table 5) . MM5-DB6-Fc_N297A consistently shows much higher expression yield and purity than MM5-SSS-Fc_N297A. Such data also suggests that the C38X+C68X+C76+S117C mutation strategy such as “DB6” or “DB7” substitutions are suitable for improving the yield of WT IL-18 and IL-18 variant polypeptides during production in mammalian cells and following purification.
[0305] Next, fusion polypeptides in which the C-terminus of a human IgG1 Fc comprising an N297A substitution (EU numbering) was fused to the N termini of each of variants M12-DB6 and MM5-DB6 were designed. The resulting fusion polypeptides, i.e., Fc_N297A-MM5-DB6 (SEQ ID NO: 332) and Fc_N297A-M12-DB6 (SEQ ID NO: 331) were expressed in CHO cells, harvested and purified via Protein A chromatography. Both Fc_N297A-MM5-DB6 and Fc_N297A-M12-DB6 demonstrated comparable expression yield and purity in CHO cells when compared to the M12-DB6-Fc_N297A or MM5-DB6-Fc_N297A, respectively. Following one-step Protein A chromatography purification, Fc_N297A-MM5-DB6 was ~97%pure (as determined by SEC-HPLC) , and Fc_N297A-M12-DB6 was 89%pure (as determined by SEC-HPLC) . These data suggest that the cystine mutation plus disulfide bond introduction strategy is eligible for Fc fusion in either fusion order.
[0306] Next, the potencies of WT IL18-DB6-Fc_N297A, MM5-DB6-Fc_N297A, Fc_N297A-MM5-DB6 and Fc_N297A-M12-DB6 in activating IL-18 receptor-mediated signaling were characterized. Both WT IL18-DB6-Fc_N297A and MM5-DB6-Fc_N297A exhibited potent IL-18 receptor cell activation signal, stronger than that of WT IL-18. Fc_N297A-MM5-DB6 shown similar potency with WT IL-18, while Fc_N297A-M12-DB6 resulted in much stronger activation signal to the IL-18 reporter cell. In the presence of 1 μg / mL IL-18BP-hFc, activity of WT IL18-DB6-Fc_N297A was greatly decreased, whereas the activity of MM5-DB6-Fc_N297A was resistant to inhibition by IL-18 BP. Both M12-DB6-Fc_N297A and MM5-DB6-Fc_N297A keeps the IL-18 BP resistant activity, meanwhile activity of WT IL18-DB6-Fc_N297A keeps decreased by IL-18 BP, indicating that the “DB6” set of mutations (i.e., C38I, C68S, and S117C, see Table 5) improve expression profile of IL-18 and IL-18 variant without affecting the IL-18BP’s dependency.
[0307] Above all, such results demonstrate that the strategy of introduction C38X+C68X+C76+S117C mutation into a WT IL-18-Fc fusion polypeptide or into an IL-18 variant-Fc fusion polypeptide dramatically improves the expression yield of the fusion polypeptide during production in mammalian cells and improves the yield of purified fusion polypeptide following chromatography, without affecting the IL-18 BP resistant activity. Further, WT IL-18 and IL-18 variants that have been engineered to comprise the “DB6” set of mutations exhibit higher potencies of activating IL-18 receptor-mediated signaling. Such results were observed with fusion polypeptides in which the C-terminus of the Fc region was fused to the N-terminus of the IL-18 variant, as well as with fusion polypeptide in which the C-terminus of the IL-18 variant was fused to the N-terminus of the Fc domain (see Table 6) .
[0308] Table 6.
[0309] In some embodiments, the IL-18 polypeptide comprises a variant polypeptide comprising a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1.
[0310] In some embodiments, the IL-18 variant polypeptide does not comprise a cysteine at position 38, or the IL-18 variant polypeptide does not comprise a cysteine at position 68.
[0311] In some embodiments, the IL-18 polypeptide comprises a) a cysteine at position 117, b) a cysteine at position 76, c) an isoleucine at position 38, and d) an serine at position 68, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1.
[0312] In some embodiments, the IL-18 variant polypeptide does not comprise a cysteine at position 38, and the IL-18 variant polypeptide does not comprise a cysteine at position 68. In some embodiments, the IL-18 variant polypeptide comprises 38S, 38I, 38V, 38L, or 38M, optionally wherein IL-18 variant polypeptide comprises 38S, 38I, or 38V. In some embodiments, the IL-18 variant polypeptide comprises 68S, 68I, 68V, 68L or 68D, optionally wherein the IL-18 variant polypeptide comprises 68S, 68I, or 68L. In some embodiments, the IL-18 variant polypeptide comprises 127C. In some embodiments, the IL-18 variant polypeptide comprises at position 127 an alanine or an amino acid that does not have a hydrophobic side chain at position 127, optionally wherein the amino acid that does not have a hydrophobic side chain is selected from the group consisting of cysteine, serine, threonine, asparagine, glutamine, glycine, and proline, further optionally wherein the amino acid that does not have a hydrophobic side chain is selected from the group consisting of cysteine, serine, and threonine. In some embodiments, the IL-18 variant polypeptide comprises: a) I38, V38, or S38, b) I68, S68, or L68, c) C76, and d) C117. In some embodiments, the IL-18 variant polypeptide comprises I38, S68, C76, and C117. In some embodiments, the IL-18 variant polypeptide comprises V38, I68, C76, C117, optionally wherein the variant polypeptide further comprises A127.
[0313] In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, P57A, and N91T, wherein the amino acid position (s) is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 polypeptide has a) a lower binding affinity with IL-18 receptor, and / or b) a comparable or lower binding affinity with IL-18 binding protein, as compared to a wildtype human IL-18 polypeptide. In some embodiments, the IL-18 polypeptide further comprises a S117C substitution. In some embodiments, the S117C substitution promotes a C76-C117 disulfide bond. In some embodiments, the IL-18 polypeptide further comprises a substitution at C38, optionally wherein the substitution is selected from the group consisting of C38I, C38V, C38L, and C38M, further optionally wherein the substitution is C38I or C38V. In some embodiments, the IL-18 polypeptide further comprises a substitution at C68, optionally wherein the substitution is selected from the group consisting of C68I, C68V, C68S, and C68D, further optionally wherein the substitution is C68I, C68L, or C38S. In some embodiments, the IL-18 polypeptide further comprises a substitution at C76 and / or C127, optionally wherein the C76 substitution is C76Y or C76V, and optionally wherein the C127 substitution is selected from the group consisting of C127A, C127I, C127Y, C127F, and C127L, further optionally wherein the C127 substitution is C127A or C127I. In some embodiments, the variant polypeptide further comprises C38S, C68S, and C76S substitutions, optionally wherein the variant polypeptide further comprises a C127S substitution. In some embodiments, the variant polypeptide further comprises C38I, C68S, and S117C. In some embodiments, the variant polypeptide further comprises C38V, C68I, S117C, and C127A. In some embodiments, the variant polypeptide further comprises C38S, C68I, S117C, and C127I. In some embodiments, the variant polypeptide further comprises C38I, C68I, C76V, and C127I. In some embodiments, the variant polypeptide further comprises C38I, C68L, and C76Y.
[0314] In some embodiments, the IL-18 polypeptide comprises G3P, E6K, D54G, Q56G, P57A, C38I, C68S, S117C, and N91T. In some embodiments, the IL-18 polypeptide further comprises 76C and 127C. In some embodiments, the IL-18 polypeptide further comprises at least one of G108A, H109A, and K112A.
[0315] In some embodiments, the IL-18 polypeptide comprises E6G, D54L, Q56T, P57E, N91G, and R104S, wherein the amino acid position (s) is relative to a wild-type human IL-18 set forth in SEQ ID NO: 1. In some embodiments, the IL-18 polypeptide has a) a lower binding affinity with IL-18 receptor, and / or b) a comparable or lower binding affinity with IL-18 binding protein, as compared to a wildtype human IL-18 polypeptide. In some embodiments, the IL-18 polypeptide further comprises a S117C substitution. In some embodiments, the S117C substitution promotes a C76-C117 disulfide bond. In some embodiments, the IL-18 polypeptide further comprises a substitution at C38, optionally wherein the substitution is selected from the group consisting of C38I, C38V, C38L, and C38M, further optionally wherein the substitution is C38I or C38V. In some embodiments, the IL-18 polypeptide further comprises a substitution at C68, optionally wherein the substitution is selected from the group consisting of C68I, C68V, C68S, and C68D, further optionally wherein the substitution is C68I, C68L, or C38S. In some embodiments, the IL-18 polypeptide further comprises a substitution at C76 and / or C127, optionally wherein the C76 substitution is C76Y or C76V, and optionally wherein the C127 substitution is selected from the group consisting of C127A, C127I, C127Y, C127F, and C127L, further optionally wherein the C127 substitution is C127A or C127I. In some embodiments, the variant polypeptide further comprises C38S, C68S, and C76S substitutions, optionally wherein the variant polypeptide further comprises a C127S substitution. In some embodiments, the variant polypeptide further comprises C38I, C68S, and S117C. In some embodiments, the variant polypeptide further comprises C38V, C68I, S117C, and C127A. In some embodiments, the variant polypeptide further comprises C38S, C68I, S117C, and C127I. In some embodiments, the variant polypeptide further comprises C38I, C68I, C76V, and C127I. In some embodiments, the variant polypeptide further comprises C38I, C68L, and C76Y.
[0316] In some embodiments, the IL-18 polypeptide comprises E6G, D54L, Q56T, P57E, N91G, C38I, C68S, S117C, and R104S. In some embodiments, the IL-18 polypeptide further comprises 76C and 127C. In some embodiments, the IL-18 polypeptide further comprises at least one of G108A, H109A, and K112A.
[0317] In some embodiments, the IL-18 polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 1-299, 307-318, 465-469, and 482-491. In some embodiments, the IL-18 polypeptide comprises an amino acid sequence having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%identity with the amino acid sequence of any one of SEQ ID NOs: 1-299, 307-318, 465-469, and 482-491.
[0318] In some embodiments, the IL-18 polypeptide comprises an amino acid sequence set forth in any one of SEQ ID NOs: 1-299 and 307-318. In some embodiments, the IL-18 polypeptide comprises an amino acid sequence having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%identity with the amino acid sequence of any one of SEQ ID NOs: 1-299, 307-318. Nucleic Acids, Vectors, Host Cell, and Methods of Producing Constructs Comprising an IL-18 Component
[0319] Nucleic acid molecules encoding the constructs comprising IL-18 components described herein are also contemplated. In some embodiments, provided is one or more nucleic acids encoding a construct comprising an IL-18 component described herein or a portion thereof (e.g., one or more of the polypeptides comprised in the construct) .
[0320] Also provided are vectors in which one or more nucleic acids described herein is inserted.
[0321] In brief summary, the expression of a construct comprising an IL-18 component described herein by a natural or synthetic nucleic acid encoding the construct can be achieved by inserting the nucleic acid into an appropriate expression vector, such that the nucleic acid is operably linked to 5’ and 3’ regulatory elements, including for example a promoter (e.g., a constitutive, regulatable, tissue-specific promoter) and a 3’ untranslated region (UTR) . The vectors can be suitable for replication and integration in eukaryotic host cells. Typical cloning and expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
[0322] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[0323] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) , and in other virology and molecular biology manuals. Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (see, e.g., WO 01 / 96584; WO 01 / 29058; and U.S. Pat. No. 6,326,193) .
[0324] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In some embodiments, lentivirus vectors are used. Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
[0325] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 base pairs (bp) upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
[0326] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1α (EF-1α) . However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV) , human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
[0327] In some embodiments, the expression of the nucleic acid (s) encoding the construct comprising an IL-18 component is inducible. In some embodiments, the nucleic acid (s) encoding the construct is operably linked to an inducible promoter, including any inducible promoter known in the art. In some embodiments, the nucleic acid (s) encoding a construct comprising an IL-18 component described herein has been engineered to encode an epitope tag, e.g., to facilitate purification or detection of the polypeptide. Exemplary epitope tags include, but are not limited to, e.g., 6x His (also known as His-tag or hexahistidine tag) , FLAG, HA, Myc, V5, GFP (green fluorescent protein, e.g., enhanced green fluorescent protein or EGFP) , SUMO (Small ubiquitin-like modifier) , GST (glutathione-S-transferase) , β-GAL (β-galactosidase) , Luciferase, MBP (Maltose Binding Protein) , RFP (Red Fluorescence Protein) , and VSV-G (Vesicular Stomatitis Virus Glycoprotein) .
[0328] A construct of the present disclosure may be produced by any means known in the art. Exemplary techniques for polypeptide production are described below; however, these exemplary techniques are provided for illustrative purposes only and are not intended to be limiting.
[0329] A construct comprising an IL-18 component described herein can be produced using recombinant methods. For recombinant production of a construct comprising an IL-18 component polypeptide, a nucleic acid encoding the construct comprising an IL-18 component is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding construct comprising an IL-18 component may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the construct comprising an IL-18 component) . Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
[0330] Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells, e.g., to allow the vector to replicate independently of the host chromosomal DNA. This sequence can include origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses. Generally, the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may be used because it contains the early promoter) . In some embodiments, provided herein is a host cell comprising one or more nucleic acids encoding the constructs comprising an IL-18 component as described herein, or one or more vectors comprising the one or more nucleic acids encoding the constructs comprising an IL-18 component as described herein. In some embodiments, the host cell is a prokaryotic cell. In some embodiments, the prokaryotic cell is an E. Coli cell. In some embodiments, the host cell is a eukaryotic cell. In some embodiments, the eukaryotic cell is a CHO cell.
[0331] Expression and cloning vectors can contain a selection gene or selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media. Examples of dominant selection use the drugs neomycin, mycophenolic acid and hygromycin. Another example of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up construct-encoding nucleic acid, such as DHFR, glutamine synthetase (GS) , thymidine kinase, metallothionein-I and -II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, and the like. For example, a Chinese hamster ovary (CHO) cell line deficient in endogenous DHFR activity transformed with the DHFR gene is identified by culturing the transformants in a culture medium containing methotrexate (Mtx) , a competitive antagonist of DHFR.
[0332] Alternatively, host cells (particularly wild-type hosts that contain endogenous DHFR) transformed or co-transformed with DNA sequences a construct of interest, wild-type DHFR gene, and another selectable marker such as aminoglycoside 3'-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418.
[0333] Expression and cloning vectors generally contain a promoter that is recognized by the host organism and is operably linked to nucleic acid encoding a construct. Promoters suitable for use with prokaryotic hosts include the phoA promoter, β-lactamase and lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter. However, other known bacterial promoters are suitable. Promoter sequences are known for eukaryotes. Yeast promoters are well known in the art and can include inducible promoters / enhancers regulated by growth conditions. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Examples include without limitation the promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase. The transcription of an IL-18 polypeptide or fusion polypeptide from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses. The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII restriction fragment. Alternatively, the Rous Sarcoma Virus long terminal repeat can be used as the promoter.
[0334] Transcription of a DNA encoding a construct described herein by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, α-fetoprotein, and insulin) . Typically, however, one will use an enhancer from a eukaryotic cell virus.
[0335] Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA.
[0336] Provided herein is a method of producing the construct comprising an IL-18 component, or a portion of the construct thereof. In some embodiments, the method comprises culturing a host cell comprising the nucleic acid, nucleic acids, vector, or vectors as described herein under conditions where the construct comprising an IL-18 component, or portion thereof, is expressed. In some embodiments, the method comprises recovering the construct comprising an IL-18 component, or portion thereof, produced by the host cell. Also provided herein is a method of producing the construct comprising (a) culturing the host cell under conditions where the construct comprising an IL-18 component, or portion thereof, is expressed, and; (b) recovering the construct comprising an IL-18 component, or the portion thereof, produced by the host cell.
[0337] Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above. Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, etc. In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for IL-18 polypeptide variant-or fusion polypeptide-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. Certain fungi and yeast strains may be selected in which glycosylation pathways have been “humanized, ” resulting in the production of an IL-18 polypeptide with a partially or fully human glycosylation pattern. See, e.g., Li et al., Nat. Biotech. 24: 210-215 (2006) .
[0338] Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, duckweed (Leninaceae) , alfalfa (M. truncatula) , and tobacco can also be utilized as hosts.
[0339] Suitable host cells for the expression of a glycosylated construct are also derived from multicellular organisms (invertebrates and vertebrates) . Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar) , Aedes aegypti (mosquito) , Aedes albopictus (mosquito) , Drosophila melanogaster (fruitfly) , and Bombyx mori have been identified.
[0340] Vertebrate cells may be used as hosts, which is a particular advantage of some of the embodiments discussed herein (see e.g., section “IL-18 polypeptides with one or more cysteine modifications” ) . Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651) ; human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36: 59 (1977) ) ; baby hamster kidney cells (BHK, ATCC CCL 10) ; mouse sertoli cells (TM4, Mather, Biol. Reprod. 23: 243-251 (1980) ) ; monkey kidney cells (CV1 ATCC CCL 70) ; African green monkey kidney cells (VERO-76, ATCC CRL-1587) ; human cervical carcinoma cells (HELA, ATCC CCL 2) ; canine kidney cells (MDCK, ATCC CCL 34) ; buffalo rat liver cells (BRL 3A, ATCC CRL 1442) ; human lung cells (W138, ATCC CCL 75) ; human liver cells (Hep G2, HB 8065) ; mouse mammary tumor (MMT 060562, ATCC CCL51) ; TRI cells (Mather et al., Annals N. Y. Acad. Sci. 383: 44-68 (1982) ) ; MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2) . Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR-CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216 (1980) ) ; and myeloma cell lines such as NS0 and Sp2 / 0. For a review of certain mammalian host cell lines suitable for production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N. J., 2003) , pp. 255-268.
[0341] The host cells of the present disclosure may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma) , Minimal Essential Medium ( (MEM) , (Sigma) , RPMI-1640 (Sigma) , and Dulbecco's Modified Eagle's Medium ( (DMEM) , Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58: 44 (1979) , Barnes et al., Anal. Biochem. 102: 255 (1980) , U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5, 122, 469; WO 90 / 03430; WO 87 / 00195; or U.S. Pat. Re. 30, 985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and / or other growth factors (such as insulin, transferrin, or epidermal growth factor) , salts (such as sodium chloride, calcium, magnesium, and phosphate) , buffers (such as HEPES) , nucleotides (such as adenosine and thymidine) , antibiotics (such as GENTAMYCINTM drug) , trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range) , and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to one of skill in the art.
[0342] When using recombinant techniques, the construct comprising an IL-18 component can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the construct comprising an IL-18 component is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio / Technology 10: 163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli.
[0343] The construct comprising an IL-18 component prepared from the cells can be purified using, for example, hydroxyapatite chromatography, hydrophobic interaction chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being among one of the typically preferred purification steps. In some embodiments, a construct comprising an IL-18 component described herein comprises an epitope tag (e.g., a tag attached to the construct via a cleavable linker) to facilitate purification. Exemplary epitope tags include, but are not limited to, e.g., 6x His (also known as His-tag or hexahistidine tag) , FLAG, HA, Myc, V5, GFP (green fluorescent protein, e.g., enhanced green fluorescent protein or EGFP) , SUMO (Small ubiquitin-like modifier) , GST (glutathione-S-transferase) , β-GAL (β-galactosidase) , Luciferase, MBP (Maltose Binding Protein) , RFP (Red Fluorescence Protein) , and VSV-G (Vesicular Stomatitis Virus Glycoprotein. Methods of Treating Disease, Activating hIL-18 receptor-mediated signaling, and Stimulating Antigen-Experienced T-cells or NK cells
[0344] Also provided here are methods of treating a disease or condition in an individual. The methods comprise administering a construct comprising an IL-18 component described herein, a nucleic acid described herein, a vector described herein, and / or a pharmaceutical composition described herein to an individual having the disease or condition. In some embodiments, the disease or condition is a proliferative disorder. In some embodiments the proliferative disorder is cancer. In some embodiments, the cancer is a solid tumor.
[0345] In some embodiments, provided are methods of activating hIL-18 receptor mediated signal in an individual, which methods comprise administering a construct described herein, a nucleic acid described herein, a vector described herein, and / or a pharmaceutical composition described herein to the individual. In some embodiments, provided herein are methods of stimulating antigen-experienced T cells or NK cells in an individual, which methods comprise administering a construct comprising an IL-18 component described herein, a nucleic acid described herein, a vector described herein, and / or a pharmaceutical composition described herein to the individual. In some embodiments of any of the methods herein, the individual is a mammal (e.g., human, non-human primate, rat, mouse, cow, horse, pig, sheep, goat, dog, cat, etc. ) . In some embodiments, the individual is a human. In some embodiments, the individual is a clinical patient, a clinical trial volunteer, an experimental animal, etc. Compositions, Kits and Articles of Manufacture
[0346] Also provided herein are compositions (such as formulations) comprising a construct comprising an IL-18 component, a nucleic acid, a vector, or a host cell described herein.
[0347] Suitable compositions may be obtained by mixing the construct comprising an IL-18 component, the nucleic acid, the vector, or the host cell having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980) ) .
[0348] Also provided are kits comprising a construct comprising an IL-18 component, a nucleic acid, a vector, or a host cell comprising a nucleic acid or vector described herein. The kits may be useful for any of the methods of treatment described herein.
[0349] The kits of the present application are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags) , and the like. Kits may optionally provide additional components such as buffers and interpretative information.
[0350] The present application thus also provides articles of manufacture. The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include vials (such as sealed vials) , bottles, jars, flexible packaging, and the like. Generally, the container holds a composition, and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle) .
[0351] Those skilled in the art will recognize that several embodiments are possible within the scope and spirit of this invention. The invention will now be described in greater detail by reference to the following non-limiting examples. The following examples further illustrate the invention but, of course, should not be construed as in any way limiting its scope. EXEMPLARY EMBODIMENTS
[0352] Embodiment 1. A construct comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide, wherein: the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide; the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker; or the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids; and wherein the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide, optionally wherein the wildtype IL-18 polypeptide has an amino acid sequence of SEQ ID NO: 1, optionally wherein the binding affinity is assessed on a cell expressing an IL-18 receptor and not expressing the antigen.
[0353] Embodiment 2. The construct of embodiment 1, wherein the construct has a single IL-18 component.
[0354] Embodiment 3. The construct of embodiment 1 or embodiment 2, wherein the binding moiety comprises a small molecule.
[0355] Embodiment 4. The construct of any one of embodiments 1-3, wherein the binding moiety does not have a Fc domain.
[0356] Embodiment 5. The construct of any one of embodiments 1-3, wherein the binding moiety comprises a Fc domain.
[0357] Embodiment 6. The construct of embodiment 5, wherein the Fc domain comprises an IgG Fc domain.
[0358] Embodiment 7. The construct of any one of embodiments 1-6, wherein the binding moiety comprises an antibody.
[0359] Embodiment 8. The construct of embodiment 7, wherein the antibody is a monovalent antibody.
[0360] Embodiment 9. The construct of embodiment 7, wherein the antibody is a multivalent antibody.
[0361] Embodiment 10. A construct comprising a single IL-18 component associated with a binding moiety comprising a multivalent antibody that specifically binds to an antigen, wherein the antibody comprises a Fc domain, wherein the single IL-18 component comprising a single IL-18 polypeptide comprising the wildtype IL-18 polypeptide or a variant thereof, optionally wherein the wildtype IL-18 polypeptide comprises an amino acid sequence of SEQ ID NO: 1, and wherein the single IL-18 component is fused to the Fc domain.
[0362] Embodiment 11. The construct of embodiment 10, wherein: the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide, the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, or the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids, wherein the wildtype IL-18 polypeptide has an amino acid sequence of SEQ ID NO: 1, wherein the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide, optionally wherein the binding affinity is assessed on a cell expressing an IL-18 receptor and not expressing the antigen.
[0363] Embodiment 12. The construct of any one of embodiments 9-11, wherein the antibody is a bivalent antibody.
[0364] Embodiment 13. The construct of any one of embodiments 7-12, wherein the antibody is selected from the group consisting of a full-length antibody, a single-chain Fv (scFv) , a Fab, a Fab’, a F (ab’) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a nanobody (VHH) , a Fv-Fc fusion, an scFv-Fc fusion, an scFv-Fv fusion, a diabody, a tribody, and a tetrabody.
[0365] Embodiment 14. The construct of any one of embodiments 7 and 9-13, wherein the antibody is a full-length antibody comprising two heavy chains and two light chains, optionally wherein the two heavy chains comprise one or more modifications that promotes a knob-hole structure.
[0366] Embodiment 15. The construct of any one of embodiments 1-14, wherein the IL-18 component is covalently conjugated to the binding moiety, optionally via a linker between the IL-18 polypeptide and the binding moiety.
[0367] Embodiment 16. The construct of any one of embodiments 1-14, wherein the IL-18 component is fused to the binding moiety, optionally via a linker between the IL-18 polypeptide and the binding moiety, optionally wherein the linker is a peptidyl linker comprising no more than 35 amino acids.
[0368] Embodiment 17. The construct of embodiment 14 or embodiment 16, wherein the IL-18 component is fused to one or two of the heavy chains.
[0369] Embodiment 18. The construct of any one of embodiments 14 and 16-17, wherein the IL-18 component is fused to C-terminus of one or two of heavy chains and / or one or two of the light chains of the full-length antibody.
[0370] Embodiment 19. The construct of any one of embodiments 5-18, wherein the IL-18 component is fused to C-terminus of the Fc domain.
[0371] Embodiment 20. The construct of embodiment 19, wherein the IL-18 component is a single IL-18 component in the construct, optionally wherein the antibody comprises a full-length antibody, a nanobody, a Fab, or a scFv.
[0372] Embodiment 21. The construct of any one of embodiments 1-9 and 11-20, wherein the IL-18 component is fused to the binding moiety via the peptidyl linker, wherein the peptidyl linker has a length of no more than 15 amino acids.
[0373] Embodiment 22. The construct of any one of embodiments 1-21, wherein the antigen is a tumor specific antigen or tumor associated antigen.
[0374] Embodiment 23. The construct of embodiment 22, wherein the tumor is a solid tumor.
[0375] Embodiment 24. The construct of any one of embodiments 1-23, wherein the antigen is a neoantigen.
[0376] Embodiment 25. The construct of any one of embodiments 1-21, wherein the antigen is an antigen expressed by immune cells, optionally wherein the immune cells are tumor infiltrating lymphocytes.
[0377] Embodiment 26. The construct of any one of embodiments 1-21, wherein the antigen is an immune checkpoint target expressed on T cells or NK cells.
[0378] Embodiment 27. The construct of embodiment 26, wherein the antigen is PD-1.
[0379] Embodiment 28. The construct of embodiment 27, wherein the binding domain comprises a heavy chain variable region comprising VH-CDR1, VH-CDR2, VH-CDR3, and a light chain variable region comprising VL-CDR1, VL-CDR2, VL-CDR3, wherein a) the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 470, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 471, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 472, the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 473, the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 474, and the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 475; or b) the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 476, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 477, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 478, the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 479, the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 480, and the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 481.
[0380] Embodiment 29. The construct of any one of embodiments 1-28, wherein the IL-18 polypeptide comprises one or more modifications as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) .
[0381] Embodiment 30. The construct of embodiment 29, wherein the IL-18 polypeptide has a reduced binding affinity to IL18Rβ as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced a) at least by 50%, 60%, 70%, 80%, or 90%or b) by 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0382] Embodiment 31. The construct of embodiment 29 or embodiment 30, wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to the wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally wherein the substitution is with an alanine.
[0383] Embodiment 32. The construct of embodiment 31, wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, and D98, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally wherein the substitution is with an alanine.
[0384] Embodiment 33. The construct of any one of embodiments 29-32, wherein the IL-18 component has a reduced binding affinity to IL18Rα as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced a) at least by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%or b) by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0385] Embodiment 34. The construct of embodiment 33, wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, K79, K84, D98, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally wherein the substitution is with an alanine.
[0386] Embodiment 35. The construct of any one of embodiments 29-34, wherein the IL-18 component comprises an IL-18 polypeptide that comprises two or more modifications comprises a substitution of two or more amino acids selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, K84, K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally the substitution is with an alanine.
[0387] Embodiment 36. The construct of any one of embodiments 1-35, wherein the IL-18 polypeptide comprises the amino acid sequence of any of SEQ ID Nos: 482-491.
[0388] Embodiment 37. The construct of any one of embodiments 1-9 and 10-36, wherein the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker.
[0389] Embodiment 38. The construct of embodiment 37, wherein the masking moiety comprises an IL-18 pro-peptide, optionally wherein the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) , optionally wherein the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333.
[0390] Embodiment 39. The construct of embodiment 38, wherein the masking moiety comprises a truncated pro-peptide of pro-IL-18, optionally wherein the truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336.
[0391] Embodiment 40. The construct of embodiment 37, wherein the masking moiety comprises an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding.
[0392] Embodiment 41. The construct of embodiment 40, wherein the masking moiety comprises an extracellular domain of IL-18Rα or a fragment thereof, optionally wherein the fragment of the extracellular domain of IL-18Ra comprises a) the first and the second domains of the extracellular domain, or b) the third domain of the extracellular domain, optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.
[0393] Embodiment 42. The construct of any one of embodiments 37-41, wherein the cleavable linker comprises one or more set of amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein the one or more proteases are one or more tumor microenvironment (TME) proteases, and wherein the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator, matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease, a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase.
[0394] Embodiment 43. The construct of embodiment 42, wherein the one or more TME proteases are matrix metalloproteases, and wherein the matrix metalloproteases are selected from the group consisting of: matrix metalloprotease 1, matrix metalloprotease 2, matrix metalloprotease 3, matrix metalloprotease 8, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 12, and matrix metalloprotease 14.
[0395] Embodiment 44. The construct of embodiment 41 or embodiment 42, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 2, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 14, urokinase-type Plasminogen Activator, matriptase and legumain.
[0396] Embodiment 45. The construct of any one of embodiments 37-44, wherein the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by at least two, three, or four proteases, optionally wherein the one or more amino acid sequences are recognized and cleaved by a) legumain and one, two or three of MMP9, MMP2, and MMP14, b) uPA and one, two or three of MMP9, MMP2, and MMP14 c) all of uPA, legumain, MMP2, MMP14 and MMP9.
[0397] Embodiment 46. The construct of any one of embodiments 37-45, wherein the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377.
[0398] Embodiment 47. The construct of any one of embodiments 37-46, wherein the cleavable linker further comprises a spacer sequence, optionally wherein the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases.
[0399] Embodiment 48. The construct of any one of embodiments 37-47, wherein the cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, wherein each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker.
[0400] Embodiment 49. The construct of embodiment 47 or embodiment 48, wherein the spacer sequence comprises a GS linker, optionally the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids.
[0401] Embodiment 50. The construct of any one of embodiments 37-49, wherein the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids, optionally wherein: the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids; the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα, further optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356; or the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399- 407, and SEQ ID NO: 492-493, 495.
[0402] Embodiment 51. The construct of any one of embodiments 1-28 and 37-50, wherein the IL-18 polypeptide is a wildtype IL-18 polypeptide comprising an amino acid sequence of SEQ ID NO: 1.
[0403] Embodiment 52. The construct of any one of embodiments 1-51, wherein the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.
[0404] Embodiment 53. The construct of any one of embodiments 1-51, wherein the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0405] Embodiment 54. The construct of any one of embodiments 1-51, wherein the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, b) a cleavage linker, and c) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.
[0406] Embodiment 55. The construct of any one of embodiments 1-54, wherein the IL-18 component comprises, a) an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, and 496-500, or b) an amino acid sequence functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 340-343, 345-352, and 496-500.
[0407] Embodiment 56. The construct of any one of embodiments 1-55, wherein the IL-18 polypeptide has a reduced binding against IL-18 binding protein (IL-18BP) as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced a) at least by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%or b) by about any of 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%.
[0408] Embodiment 57. The construct of any one of embodiments 1-56, wherein the IL-18 polypeptide comprises at least three, four, five, or six mutations at G3, E6, D54, Q56, P57, N91 and R104 of an IL-18 polypeptide, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1.
[0409] Embodiment 58. The construct of any one of embodiments 1-57, wherein the IL-18 polypeptide comprises a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1.
[0410] Embodiment 59. The construct of embodiment 58, wherein the IL-18 polypeptide does not comprise a cysteine at position 38, and / or the IL-18 polypeptide does not comprise a cysteine at position 68.
[0411] Embodiment 60. The construct of embodiment 58 or embodiment 59, wherein the IL-18 polypeptide comprises a) a cysteine at position 117, b) a cysteine at position 76, c) an isoleucine at position 38, and d) an serine at position 68, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1.
[0412] Embodiment 61. The construct of any one of embodiments 1-60, wherein the IL-18 component comprises an amino acid sequence of any one of SEQ ID NOs: 2-299 and 307-318, 465-469, 482-491, optionally wherein the IL-18 component comprises an amino acid sequence of any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, 150, 465-469, 482-491.
[0413] Embodiment 62. One or more nucleic acids encoding the construct or a portion of the construct of any one of embodiments 1-61.
[0414] Embodiment 63. One or more vectors comprising the one or more nucleic acids of embodiment 62.
[0415] Embodiment 64. A host cell comprising the one or more nucleic acids of embodiment 63, or one or more vectors of embodiment.
[0416] Embodiment 65. The host cell of embodiment 64, wherein the host cell is a eukaryotic cell, optionally wherein the host cell is CHO cell.
[0417] Embodiment 66. The host cell of embodiment 64, wherein the host cell is a pro-eukaryotic cell, optionally wherein the host cell is E. coli.
[0418] Embodiment 67. A method of producing the construct of any one of embodiments 1-66 or a portion thereof, comprising: (a) culturing the host cell of embodiment 64 under conditions where the construct or the portion of the construct is expressed, and; (b) recovering the construct or the portion of the construct produced by the host cell.
[0419] Embodiment 68. A method of treating a disease or condition, comprising administering the construct of any one of embodiments 1-66 into an individual in need thereof.
[0420] Embodiment 69. The method of embodiment 68, wherein the disease or condition is a cancer, optionally the cancer is a solid tumor.EXAMPLES
[0421] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g. amounts, temperature, etc. ) but some experimental errors and deviations should be accounted for. The examples below are intended to be purely exemplary of the application and should therefore not be considered to limit the application in any way. The following examples and detailed description are offered by way of illustration and not by way of limitation. Methods Construct expression and purification
[0422] Human IL-18 with site mutations that attenuated binding of human IL-18 to the IL-18 receptor or an activable human IL-18 polypeptide was fused to a tissue specific antigen targeted moiety fused to a human Fc. For example, the N-terminus of the IL-18 polypeptide can be fused to the C-termini of Fc of a tissue specific antigen targeted antibody to construct an immunocytokine. The resulting fusion polypeptides, were expressed in CHO cells, harvested, and purified via one-step Protein A chromatography, with further purification procedure if necessary. The purified preparations were analyzed via size exclusion chromatography and SDS-PAGE. Activation of hIL-18 receptor-mediated signaling by antibody fused hIL-18 attenuation variant
[0423] For off-target activation, an NFκB-luc / hIL-18RαRβ HEK293 cell line stably expressing hIL-18Rα, hIL-18Rβ and an NFκB luciferase reporter gene was used as the reporter cell to determine the abilities of IL-18 polypeptides in activating hIL-18 receptor mediated signaling.
[0424] For on-target activation of anti-PD1 antibody fused to an IL-18 component, a full length human PD1 overexpressing NFκB-luc / hIL-18RαRβ HEK293 stable cell line was generated.
[0425] Briefly, the reporter cells were first seeded in the wells of a white 96-well plate at a density of 3.0×104 cells per well. WT hIL-18 or the construct (e.g., an antibody fused to an IL-18 component) was serially diluted in medium. Luminescence intensity was measured after 16 hours of incubation at 37℃. Human PBMC-Based hIFNγ Release Assays
[0426] PBMC-based assays were performed to test abilities of IL-18 variant polypeptides in activating T / NK cells and inducing hIFNγ release. Briefly, human PBMC cells were seeded in the wells of 96-well plate at a density of 5.0×105 cells per well and cultured for 5 hours before treatment. Wild-type (WT) hIL-18 or IL-18 variant polypeptides were serially diluted with 1 ng / mL human IL-12 in (a) the presence or (b) the absence of 1 μg / mL hIL-18 BP-hFc, and then supplemented to the wells. Culture medium was collected from each well after 16 hours incubation at 37℃, and hIFNγ concentration was measured via FRET using a kit (62HIFNGPEG, Cisbio) according to manufacturer’s instructions. Example 1: Structure-guided site-directed mutagenesis mediated attenuation of IL-18 fused with tissue-specific antigen targeted antibody
[0427] For tissue-specific targeting and tunable activity, IL-18 polypeptides with attenuated binding to the IL-18 receptor were fused with a tissue-specific antigen targeting antibody (FIG. 1) . The construct comprising an IL-18 component) can comprise any full-length IgG antibody (such as any tissue specific antigen targeting antibody) and any IL-18 polypeptide (e.g., those disclosed herein) . Various construct formats are shown in FIG. 2A. For example, an anti-PD1 antibody fused with the IL-18 polypeptide MM5-DB6 in the three formats were prepared and tested for IL-18 binding activity. Among the three constructs comprising an IL-18 component, PD1-MM5 with an IL-18 polypeptide at the C terminus of the Fc domain showed significantly lower IL-18 arm potency than that of fusions with IL-18 variant at the N-terminus (FIG. 2B, Table E1) . Attenuation variants of the IL-18 polypeptides were further designed based on the “Fab-IL18” format. Table E1: binding affinities of various fusion formats
[0428] One strategy of IL-18 activity attenuation could be achieved by structure-guided site-directed mutagenesis. We hypothesized that mutations on single site or several amino acids of IL-18 that involves in either the binding to IL-18Rα or the binding to IL-18Rβ would result in decreased IL-18 activity. Take PD1-MM5 as example, seven MM5-DB6 variants with single site substitution to Alanine on the IL-18Rβ binding sites were constructed (FIG. 2C) . In consistent with the structure information, all the seven mutated MM5-DB6 and PD1 antibody fusion proteins (PD1-MM5-A1 to PD1-MM5-A7) show significantly decreased IL-18 arm activity (FIG. 2D, Table E2) . For key amino acids G108, H109, K112 which involves in IL-18Rβ interaction, IL-18 polypeptides comprising a single site mutation on each of the site resulted in greatly attenuated IL-18 signaling activity. These results strongly support our hypothesis, structure guided mutagenesis on single site or several sites simultaneously would achieve IL-18 attenuation. Table E2: Construct Receptor activation
[0429] Tissue-specific targeting of attenuated IL-18 antibody fusion was supposed to be have tunable IL-18 activity in the specific tissue such as tumor microenvironment (TME) , the activity of tissue targeted IL-18 could be tested in presence of antigen overexpressed system. For example, PD1 antibody fused attenuated IL-18 variant could be tested by the PD1 overexpressed IL-18 signaling reporter assay for on-target activation or the PD1-dependent cis-signaling (FIG. 3A) . When compared to the non-PD1 overexpressed IL-18 reporter assay (PD1-) , greatly increased potencies of PD1 antibody fused attenuated IL-18 variants (PD1-MM5-A1, PD1-MM5-A2, PD1-MM5-A3) rather than the WT IL-18 in activate the PD1+ IL-18 reporter assay were observed (FIG. 3B, Table E3) . The other site-mutated attenuation of PD1-MM5 fusion proteins (PD1-MM5-A4 to PD1-MM5-A7) also shows enhanced potency in PD1+ system (data not shown) . The difference in potency of PD1 antibody fused IL-18 polypeptide variants between PD1-and PD1+ reporter assay, i.e. the EC50-2 / EC50-1 is reported as the therapeutic index (TI) for IL-18 variant in specific tissue. These results demonstrate that IL-18 attenuated variant fused with specific tissue targeting antibody has greatly expanded therapeutic window for IL-18 activity. Table E3: Calculated therapeutic windows for anti-PD1 constructs comprising an IL-18 polypeptide Example 2: masking strategy mediated attenuation of IL-18 fused with tissue-specific antigen targeted antibody
[0430] IL-18 activity attenuation could also be achieved by the masking strategy, in which, the antibody fused IL-18 variants was linked to a masking moiety with a cleavable linker. For example, masked IL-18 variant fused with masking moiety IL-18Ra extracellular (R) or IL-18Ra domain 1&2 (D12) could be fused to the C-termini of IL-18 by a cleavable linker (L1) in the PD1-IL18 format. As shown in FIGs. 4A and 4B testing the IL-18 signaling in IL-18 reporter assay and human PBMC assay, the IL-18 arm potency of PD1 antibody fused either IL-18 variant M12-DB6 (PD1-M12) or MM5-DB6 (PD1-MM5) was strikingly decreased by Ra masking (PD1-M12-R-L1, PD1-MM5-R-L1) . Another advantage of masking strategy is the activity of IL-18 could be restored when the masking moiety is removed. In the in vitro study, when the PD1 antibody fused masking IL-18 was treated by an enzyme recognize the linker L1, both PD1-M12-R-L1 and PD1-MM5-R-L1 restored IL-18 activity (FIGs. 4A and 4B, Tables E4 and E5) . By using another masking moiety D12, the masked PD1-M12-D12 and masked PD1-MM5-D12 shows greatly attenuated activity than the corresponding unmasked molecules (FIGs. 4C and 4D, Tables E6 and E7) . Table E4: Activation of IL-18 signaling of various fusion formats Table E5: Activation of IL-18 signaling of various fusion formats Table E6: Activation of IL-18 signaling of various fusion formats Table E7: Activation of IL-18 signaling of various fusion formats
[0431] Masking strategy was also tested by using another anti-PD1 antibody (notated by “k” ) fused M12 or MM5. As shown in FIG. 5A and FIG. 5B, when the IL-18 variant was masked by IL-18Ra (notated by “R” ) fused to another antibody, the IL-18 activity was observed to be attenuated (Tables E8, E9) . A variety of linkers between IL-18 variant and masking moiety were also tested in the PD1-MM5-R, similar to the L1 linkers shown in FIG. 4, the other three linkers with different amino acid sequences fused PD1-MM5-R still show greatly attenuated IL-18 arm activity (FIGs. 5C and 5D, Tables E10, E11) . Modification in Fc fragment of the PD1-MM5-R did not affect the effectiveness of attenuation strategy (data not shown) . These results strongly demonstrate that masking strategies effectively attenuates IL-18 polypeptides and when fused to antibodies, and this attenuation is reversible when the masking moiety is removed. Table E8: Activation of IL-18 signaling of various construct formats Table E9: Activation of IL-18 signaling of various construct formats Table E10: Activation of IL-18 signaling of various construct formats Table E11: Activation of IL-18 signaling of various construct formats Example 3: Variable linker length mediated attenuation of IL-18 fused with tissue-specific antigen targeted antibody
[0432] The N-terminal conformation of IL-18 influences IL-18’s engagement with IL-18 receptors and receptor mediated IL-18 signaling. Thus, we hypothesized that the linker length between Fc and N-terminal of IL-18 influences IL-18 receptor binding. The 15 amino acid glycine-serine linker on PD1-MM5 was either deleted (L0) or decreased to 5 amino acids in length (L5) . Decreasing the linker length from 15 amino acids significantly attenuated IL-18 mediated IL-18 receptor activation (FIG. 6, Table E12) . This result confirmed our hypothesis that the shorter the linker between Fc and IL-18 variant, the lower activity of IL-18 variant fused tissue targeted antibody protein. PD1-MM5 with L5 or L0 showed a larger therapeutic index than that of PD1-MM5 (with a 15 AA linker; L15) . Table E12: Therapeutic window of various construct formats Example 4: Attenuation of monovalent IL-18 fused with tissue-specific antigen targeted antibody
[0433] Based on the construct format mentioned in FIG. 2C, a monovalent construct comprising one IL-18 polypeptide fused with antibody in heterodimer format was also constructed. Take PD1-MM5 as example, the monovalent version (PD1-MM5-K) shows significantly decreased IL-18 reporter activity than that of PD1-MM5, resulting in a larger therapeutic index as assayed by the PD1+ and PD1-reporter assay system (FIG. 7, Table E13) . Table E13: Therapeutic window of various construct formats Example 5: Attenuated IL-18 variant fused with tissue-specific antigen targeted antibody
[0434] IL-18 polypeptides with attenuated binding to IL-18 receptors were also achieved by a combination of the above strategies (e.g., via masking or through IL-18 mutations) . These polypeptides are also effective when fused with binding moieties, such as antibody. For example, when using both the mutagenesis and masking strategies, both the attenuated PD1-MM5-A1-R and PD1-MM5-A2-R showed unexpected decreased activity in PD1 negative IL-18 reporter assay, with no activation of signaling up to 1000 nM in concentration, and minimal activation in PD1+ IL-18 reporter system (FIGs. 8A-8B, Table E14) . These results demonstrate that combination of the above-mentioned strategies would produce a range of IL-18 polypeptides that could be used in the antibody fusions to obtain constructs with varying degrees of receptor activation. Table E14: Activation of IL-18 signaling of various construct formats Example 6: Format screening of attenuated IL-18 variant fused with tissue-specific antigen targeted antibody
[0435] Three formats of a monovalent construct comprising a IL-18 polypeptide and a tissue-specific antigen targeting antibody are shown in FIGs. 9A-9C. Several PD1 antibody fused activable IL-18 variants were constructed and tested for both on-target and off-target IL-18 receptor pathway activation. Anti-PD1 antibodies fused one (e.g., monovalent) activable IL-18 with or without variable linker length, structure-guided mutations, or both were generated and tested. The corresponding molecules without masking moiety were also constructed as control. As shown in FIGs. 10A-10G, Table E15-E20, the anti-PD1 antibody fused to activable IL-18 polypeptides all showed greatly attenuated IL-18 activity, with substantially expanded therapeutic index. The corresponding non-masked antibody-IL18 fusions also show greatly expanded therapeutic index. These results strongly support that the formats disclosed in FIGs. 9A-9C are suitable for tissue-specific antigen targeting antibody fused attenuated IL-18 development. Table E15: Therapeutic window of various construct formats Table E16: Therapeutic window of various construct formats Table E17: Therapeutic window of various construct formats Table E18: Therapeutic window of various construct formats Table E19: Therapeutic window of various construct formats
[0436] The present disclosure is not to be limited in scope by the specific embodiments described which are intended as single illustrations of individual aspects of the disclosure, and any compositions or methods which are functionally equivalent are within the scope of this disclosure. It will be apparent to those skilled in the art that various modifications and variations can be made in the methods and compositions of the present disclosure without departing from the spirit or scope of the disclosure. Thus, it is intended that the present disclosure cover the modifications and variations of this disclosure provided they come within the scope of the appended claims and their equivalents.
[0437] All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
[0438] The present invention has been described in terms of particular embodiments found or proposed by the present inventor to comprise preferred modes for the practice of the invention. It will be appreciated by those of skill in the art that, in light of the present disclosure, numerous modifications and changes can be made in the particular embodiments exemplified without departing from the intended scope of the invention. For example, due to codon redundancy, changes can be made in the underlying DNA sequence without affecting the protein sequence. Moreover, due to biological functional equivalency considerations, changes can be made in protein structure without affecting the biological action in kind or amount. All such modifications are intended to be included within the scope of the appended claims. SEQUENCE SUMMARY TABLE
Claims
1.A construct comprising an IL-18 component associated with a binding moiety that specifically binds to an antigen, wherein the IL-18 component comprises an IL-18 polypeptide, wherein:1) the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide;2) the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker; or3) the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids; andwherein the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide, optionally wherein the wildtype IL-18 polypeptide has an amino acid sequence of SEQ ID NO: 1, optionally wherein the binding affinity is assessed on a cell expressing an IL-18 receptor and not expressing the antigen.2.The construct of claim 1, wherein the construct has a single IL-18 component.3.The construct of claim 1 or claim 2, wherein the binding moiety comprises a) a small molecule, or b) a Fc domain, optionally wherein the binding moiety comprises a Fc domain, further optionally wherein the Fc domain is an IgG Fc domain.4.The construct of any one of claims 1-3, wherein the binding moiety comprises an antibody, optionally wherein the antibody is a monovalent antibody.5.The construct of claim 4, wherein the antibody is a multivalent antibody.6.A construct comprising a single IL-18 component associated with a binding moiety comprising a multivalent antibody that specifically binds to an antigen, wherein the antibody comprises a Fc domain, wherein the single IL-18 component comprising a single IL-18 polypeptide comprising the wildtype IL-18 polypeptide or a variant thereof, optionally wherein the wildtype IL-18 polypeptide comprises an amino acid sequence of SEQ ID NO: 1, and wherein the single IL-18 component is fused to the Fc domain.7.The construct of claim 6, wherein:1) the IL-18 polypeptide comprises one or more modifications as compared to a wildtype IL-18 polypeptide,2) the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, or3) the IL-18 component further comprises a peptidyl linker that connects the IL-18 polypeptide and the binding moiety, wherein the peptidyl linker has a length of no more than 15 amino acids,wherein the wildtype IL-18 polypeptide has an amino acid sequence of SEQ ID NO: 1, wherein the IL-18 component has a lower binding affinity to an IL-18 receptor than the wildtype IL-18 polypeptide, optionally wherein the binding affinity is assessed on a cell expressing an IL-18 receptor and not expressing the antigen.8.The construct of any one of claims 5-7, wherein the antibody is a bivalent antibody.9.The construct of any one of claims 4-8, wherein the antibody is selected from the group consisting of a full-length antibody, a single-chain Fv (scFv) , a Fab, a Fab’, a F (ab’) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a nanobody (VHH) , a Fv-Fc fusion, an scFv-Fc fusion, an scFv-Fv fusion, a diabody, a tribody, and a tetrabody.10.The construct of any one of claims 4-9, wherein the antibody is a full-length antibody comprising two heavy chains and two light chains, optionally wherein the two heavy chains comprise one or more modifications that promotes a knob-hole structure.11.The construct of any one of claims 1-10, wherein the IL-18 component is a) covalently conjugated to the binding moiety, optionally via a linker between the IL-18 polypeptide and the binding moiety, or b) fused to the binding moiety, optionally via a linker between the IL-18 polypeptide and the binding moiety, optionally wherein the linker is a peptidyl linker comprising no more than 35 amino acids.12.The construct of claim 10, wherein the IL-18 component is fused to one or two of the heavy chains, optionally wherein the IL-18 component is fused to C-terminus of one or two of heavy chains and / or one or two of the light chains of the full-length antibody.13.The construct of any one of claims 3-12, wherein the IL-18 component is fused to C-terminus of the Fc domain, optionally wherein the IL-18 component is a single IL-18 component in the construct, further optionally wherein the antibody comprises a full-length antibody, a nanobody, a Fab, or a scFv.14.The construct of any one of claims 1-13, wherein the IL-18 component is fused to the binding moiety via the peptidyl linker, wherein the peptidyl linker has a length of no more than 15 amino acids.15.The construct of any one of claims 1-14, wherein the antigen is a tumor specific antigen or tumor associated antigen, optionally wherein the tumor is a solid tumor, further optionally wherein the antigen is a neoantigen, further optionally wherein a) the antigen is an antigen expressed by immune cells, optionally wherein the immune cells are tumor infiltrating lymphocytes; or b) the antigen is an immune checkpoint target expressed on T cells or NK cells, optionally wherein the antigen is PD-1, further optionally wherein the binding domain comprises a heavy chain variable region comprising VH-CDR1, VH-CDR2, VH-CDR3, and a light chain variable region comprising VL-CDR1, VL-CDR2, VL-CDR3, wherein a) the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 470, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 471, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 472, the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 473, the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 474, and the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 475; or b) the VH-CDR1 comprises the amino acid sequence of SEQ ID NO: 476, the VH-CDR2 comprises the amino acid sequence of SEQ ID NO: 477, the VH-CDR3 comprises the amino acid sequence of SEQ ID NO: 478, the VL-CDR1 comprises the amino acid sequence of SEQ ID NO: 479, the VL-CDR2 comprises the amino acid sequence of SEQ ID NO: 480, and the VL-CDR3 comprises the amino acid sequence of SEQ ID NO: 481.16.The construct of any one of claims 1-15, wherein the IL-18 polypeptide comprises one or more modifications as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , wherein:a) the IL-18 polypeptide has a reduced binding affinity to IL18Rβ as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , further optionally wherein the binding affinity is reduced a) at least by 50%, 60%, 70%, 80%, or 90%, or b) by 50%-60%, 60%-70%, 70%-80%, 80%-90%, or 90%-95%;b) the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, and K84, wherein amino acid positions are relative to the wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally wherein the substitution is with an alanine, further optionally wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, and D98, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally wherein the substitution is with an alanine;c) the IL-18 component has a reduced binding affinity to IL18Rα as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced a) at least by any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%or b) by 10%-20%, 20%-30%, 30%-40%, 40%-50%, 50%-60%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-96%, 96%, -97%, 97%-98%, and / or 98%-99%, further optionally wherein the one or more modifications comprises a substitution of an amino acid selected from the group consisting of K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, K79, K84, D98, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally wherein the substitution is with an alanine; and / ord) the IL-18 component comprises an IL-18 polypeptide that comprises two or more modifications comprises a substitution of two or more amino acids selected from the group consisting of G108, H109, K112, D110, R147, M150, G145, K79, D98, K84, K4, L5, K8, R13, D17, E31, M33, T34, D35, D40, K53, R58, M60, R104 and D132, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1, optionally the substitution is with an alanine.17.The construct of any one of claims 1-16, wherein the IL-18 polypeptide comprises the amino acid sequence of any of SEQ ID NOs: 482-491.18.The construct of any one of claims 1-9 and 6-17, wherein the IL-18 component further comprises a masking moiety, wherein the IL-18 polypeptide and the masking moiety are connected via a cleavable linker, optionally wherein:a) the masking moiety comprises an IL-18 pro-peptide, optionally wherein the IL-18 pro-peptide comprises a pro-peptide of human IL-18 (hIL-18) , further optionally wherein the pro-peptide of hIL-18 comprises the amino acid sequence of SEQ ID NO: 333, further optionally wherein the masking moiety comprises a truncated pro-peptide of pro-IL-18, further optionally wherein the truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336; orb) the masking moiety comprises an extracellular domain of IL-18Rα, an extracellular domain of IL-18Rβ, an IL-18 binding protein, a fragment of any one of the preceding, or a variant of any one of the preceding, optionally wherein the masking moiety comprises an extracellular domain of IL-18Rα or a fragment thereof, further optionally wherein the fragment of the extracellular domain of IL-18Ra comprises 1) the first and the second domains of the extracellular domain, or 2) the third domain of the extracellular domain, further optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356.19.The construct of any one of claims 18, wherein the cleavable linker comprises one or more set of amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein:a) the one or more proteases are one or more tumor microenvironment (TME) proteases, and optionally wherein the one or more TME proteases are selected from the group consisting of: urokinase-type Plasminogen Activator, matriptase, legumain, prostate specific antigen, a dipeptidyl peptidase, hepsin, a matrix metalloprotease, a disintegrin and metalloproteinase, human leukocyte elastase, Proteinase 3, prourokinase, plasminogen, staphylokinase, a cathepsin, a tissue kallikrein and a Kallikrein-related peptidase, further optionally wherein the one or more TME proteases are matrix metalloproteases, and further optionally wherein the matrix metalloproteases are selected from the group consisting of: matrix metalloprotease 1, matrix metalloprotease 2, matrix metalloprotease 3, matrix metalloprotease 8, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 12, and matrix metalloprotease 14;b) the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by one or more of matrix metalloprotease 2, matrix metalloprotease 9, matrix metalloprotease 10, matrix metalloprotease 14, urokinase-type Plasminogen Activator, matriptase and legumain;c) the cleavable linker comprises one or more amino acid sequences that are recognized and cleaved by at least two, three, or four proteases, optionally wherein the one or more amino acid sequences are recognized and cleaved by a) legumain and one, two or three of MMP9, MMP2, and MMP14, b) uPA and one, two or three of MMP9, MMP2, and MMP14 c) all of uPA, legumain, MMP2, MMP14 and MMP9;d) the cleavable linker comprises one or more amino acid sequences selected from the group consisting of: SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 339, and SEQ ID NOs: 372-377;e) the cleavable linker further comprises a spacer sequence, optionally wherein the cleavage linker comprises two spacer sequences flanking both N-and C-terminus of the amino acid sequence that is recognized and cleaved by one or more proteases, further optionally wherein the spacer sequence comprises a GS linker, and further optionally the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids; and / orf) the cleavage linker comprises two or more set of amino acid sequences that are recognized and cleaved by one or more proteases, optionally wherein at least one of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, further optionally wherein each of the two or more set of amino acid sequences that are recognized and cleaved by one or more proteases is flanked by two spacer sequences in the cleavage linker, further optionally wherein the spacer sequence comprises a GS linker, and further optionally the GS linker has a length of no more than about 10, 9, 8, 7, 6, or 5 amino acids.20.The construct of claim 19, wherein the cleavage linker consists of no more than about 50, 40, 35, or 30 amino acids, optionally wherein:1) the cleavage linker consists of no less than about 10, 15, 20, or 25 amino acids;2) the cleavage linker consists of about 25 to about 30 amino acids, and wherein the masking moiety comprises an extracellular domain of IL-18Rα, further optionally wherein the masking moiety comprises an amino acid sequence of any one of SEQ ID NOs: 353-356, or a functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 353-356; or3) the cleavage linker comprises any one of amino acid sequences of SEQ ID NOs: 399-407, and SEQ ID NO: 492-493, 495.21.The construct of any one of claims 1-15 and 18-20, wherein the IL-18 polypeptide is a wildtype IL-18 polypeptide comprising an amino acid sequence of SEQ ID NO: 1.22.The construct of any one of claims 1-21, wherein the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising a truncated pro-peptide of pro-IL-18 comprises an amino acid sequence of SEQ ID NO: 336, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of no more than about 50, 40, 30, 25, 20, 15, 12, or 10 amino acids.23.The construct of any one of claims 1-21, wherein the IL-18 component comprises from N-to C-terminus, a) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, b) a cleavage linker, and c) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.24.The construct of any one of claims 1-21, wherein the IL-18 component comprises from N-to C-terminus, a) an IL-18 polypeptide comprises any one of SEQ ID NOs: 1-299 and 307-318, optionally wherein the IL-18 polypeptide comprises any one of SEQ ID NOs: 39, 133, 311, 316, 465-469, 482-491, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, and 150, b) a cleavage linker, and c) a masking moiety comprising an amino acid sequence of any one of SEQ ID NOs: 353-356, optionally wherein the cleavage linker has a length of about 10-40, 10-30, 20-30, or 25-30 amino acids.25.The construct of any one of claims 1-24, wherein the IL-18 component comprises, a) an amino acid sequence of any one of SEQ ID NOs: 340-343, 345-352, and 496-500, or b) an amino acid sequence functional variant thereof comprising at least 80%, 85%, 90%, 95%, 97%, 98%, or 99%sequence identity of any one of SEQ ID NOs: 340-343, 345-352, and 496-500.26.The construct of any one of claims 1-25, wherein the IL-18 polypeptide has a reduced binding against IL-18 binding protein (IL-18BP) as compared to a corresponding wildtype IL-18 polypeptide (e.g., SEQ ID NO: 1) , optionally wherein the binding affinity is reduced at least by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%.27.The construct of any one of claims 1-26, wherein the IL-18 polypeptide comprises at least three, four, five, or six mutations at G3, E6, D54, Q56, P57, N91 and R104 of an IL-18 polypeptide, wherein amino acid positions are relative to a wildtype IL-18 human polypeptide set forth in SEQ ID NO: 1.28.The construct of any one of claims 1-27, wherein the IL-18 polypeptide comprises a cysteine at position 117 and a cysteine at position 76, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1, optionally wherein the IL-18 polypeptide does not comprise a cysteine at position 38, and / or the IL-18 polypeptide does not comprise a cysteine at position 68, further optionally wherein the IL-18 polypeptide comprises a) a cysteine at position 117, b) a cysteine at position 76, c) an isoleucine at position 38, and d) an serine at position 68, wherein the amino acid position is relative to the wild-type IL-18 polypeptide set forth in SEQ ID NO: 1.29.The construct of any one of claims 1-28, wherein the IL-18 component comprises an amino acid sequence of any one of SEQ ID NOs: 2-299 and 307-318, 465-469, 482-491, optionally wherein the IL-18 component comprises an amino acid sequence of any one of SEQ ID NOs: 39, 133, 311, 316, 27, 3, 105, 143, 144, 145, 43, 9, 17, 81, 117, 147, 149, 150, 465-469, 482-491.30.One or more nucleic acids encoding the construct or a portion of the construct of any one of claims 1-29.31.One or more vectors comprising the one or more nucleic acids of claim 30.32.A host cell comprising the one or more nucleic acids of claim 30, or one or more vectors of claim 31, optionally a) wherein the host cell is a eukaryotic cell, further optionally wherein the host cell is CHO cell, or b) wherein the host cell is a pro-eukaryotic cell, further optionally wherein the host cell is E. coli.33.A method of producing the construct of any one of claims 1-29 or a portion thereof, comprising:(a) culturing the host cell of claim 32 under conditions where the construct or the portion of the construct is expressed, and;(b) recovering the construct or the portion of the construct produced by the host cell.34.A method of treating a disease or condition, comprising administering the construct of any one of claims 1-29 into an individual in need thereof, optionally wherein the disease or condition is a cancer, further optionally the cancer is a solid tumor.