Prevention and treatment of post-acute infection syndromes
Connexin 43 hemichannel and NLRP3 inflammasome modulators address the unmet need for treating post-acute infection syndromes by targeting gap junctions and inflammasomes, effectively alleviating symptoms like fatigue and brain fog in conditions such as long COVID.
Patent Information
- Application Number
- PCT/US2025/029419
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-05-14
- Filing Date
- 2025-05-14
- Publication Date
- 2025-11-20
AI Technical Summary
There is a significant unmet medical need for effective treatments and preventive measures for post-acute infection syndromes such as long COVID, long flu, and other chronic conditions resulting from various infections, as current understanding of these syndromes is limited and there are no approved medications available.
The use of connexin hemichannel modulators, particularly connexin 43 hemichannel modulators, and inflammasome modulators, specifically NLRP3 inflammasome modulators, to treat, prevent, and alleviate symptoms associated with post-acute infection syndromes, including long COVID, by targeting gap junctions and inflammasome complexes to address underlying mechanisms.
These modulators effectively treat and prevent symptoms like fatigue, brain fog, neuropathy, and other debilitating issues associated with post-acute infection syndromes by modulating connexin hemichannels and inflammasomes, providing relief and potentially reversing the symptoms.
Smart Images

Figure IMGF000068_0001 
Figure IMGF000070_0001 
Figure IMGF000070_0002
Abstract
Description
E3697-00624 Patent PREVENTION AND TREATMENT OF POST-ACUTE INFECTION SYNDROMES RELATEDAPPLICATIONS
[0001] This application claims the benefit of priority to U.S. Serial No. 63 / 647,539, filed on May 14, 2024, which is incorporated herein in its entirety. FIELD
[0002] The inventions generally to compounds and compositions used for treating and / or preventing post-acute infection syndromes, including long-term sequalae of coronavirus infection and signs and symptoms of long-haul effects resulting from other infections. INCORPORATIONBYREFERENCE
[0003] All publications, patents, related applications, and other written or electronic materials mentioned, identified or referred to herein, including each and every United States patent, United States patent application publication, non-U.S. patent, non-U.S. and PCT published application, article and other document cited or noted herein, and all those listed as References Cited in any patent or patents that issue herefrom, are hereby incorporated by reference in their entirety. The information incorporated is as much a part of this application, and all patents issuing therefrom or claiming priority thereto, as if all of the text and other content was repeated in the application or patent, and will be treated as part of the text and content of this application as filed and any patent issuing therefrom or claiming priority thereto, and any portion of any material incorporated by reference may be included herein by amendment if required or desired. In the event of inconsistent usages between this document and any document incorporated by reference, the usage in the incorporated reference(s) should be considered supplementary to that of this document; for irreconcilable inconsistencies, including definitions appearing in patents or patent applications, the usage in this document controls. SEQUENCE LISTING
[0004] The instant application contains a Sequence Listing which has been submitted electronically and is hereby incorporated by reference in its entirety. Said file is named E3697- 00624_SL.xml created on May 13, 2025, and is about 275,214 bytes in size. TECHNICALINTRODUCTION
[0005] The following includes information that may be useful in providing some background to the present inventions. It is not an admission that any of the information,E3697-00624 Patent publications or documents specifically or implicitly referenced herein are prior art, or important, to the inventions described and claimed herein. It is not a suggestion that the brief introductory descriptions are comprehensive. Many scientific articles have been written about these specialized areas and technical disciplines, as well as books and book chapters.
[0006] Long COVID refers to an array of signs and symptoms that sometimes linger weeks and months, even years, after the person survives a COVID infection. Sometimes the symptoms can go away and come back again. These long-term effects have been documented in the literature. See, e.g., Al-Aly Z, et al. High-dimensional characterization of post-acute sequelae of COVID-19. Nature 594(7862):259-264 (2021); Del Rio C, et al. Long-term Health Consequences of COVID-19. JAMA 324(17):1723–1724 (2020); Huang C, et al. 6-month consequences of COVID-19 in patients discharged from hospital: a cohort study. Lancet 397(10270):220-232 (2021); Taquet M, et al. 6-month neurological and psychiatric outcomes in 236 379 survivors of COVID-19: a retrospective cohort study using electronic health records. Lancet Psychiatry 8(5):416-427 (2021); Wanga V, et al., Long-Term Symptoms Among Adults Tested for SARS-CoV-2—United States, January 2020-April 2021. MMWR Morb Mortal Wkly Rep 70(36):1235-1241 (2021); Lopez-Leon S, et al. More than 50 long- term effects of COVID-19: a systematic review and meta-analysis. Sci Rep 11(1):16144 (2021); Carfi A, Bernabei R, Landi F, for the Gemelli Against COVID-19 Post-Acute Care Study Group. Persistent Symptoms in Patients After Acute COVID-19. JAMA 324(6):603–605 (2020).
[0007] Various names have been used to describe this condition, including long COVID, long-haulers, long-term effects of COVID-19, post-COVID syndrome, chronic COVID syndrome, post-COVID conditions, and post-acute sequelae SARS-CoV-2 infection (PASC). The term long COVID is used in this patent.
[0008] Symptoms reported by long COVID patients range from fatigue, dyspnea, loss of smell to “brain fog” and neuropathy. According to the CDC, other symptoms include those that get worse after physical or mental effort (also known as “post-exertional malaise’), as well as fever, respiratory and heart symptoms including difficulty breathing or shortness of breath, cough, chest pain, fast-beating or pounding heart (also known as heart palpitations), neurological symptoms including difficulty thinking or concentrating (sometimes referred to as “brain fog”), headache, sleep problems, dizziness upon standing up (lightheadedness), pins- and-needles feelings, change in smell or taste, depression or anxiety, digestive symptoms including diarrhea and stomach pain, and other symptoms including joint or muscle pain, rash and changes in menstrual cycles.E3697-00624 Patent
[0009] The incidence of long COVID varies widely between studies, with the majority between about 10% and 30%. See, e.g., Fung KW, et al. Prevalence and characteristics of long COVID in elderly patients: An observational cohort study of over 2 million adults in the US. PLoS Med 20(4):e1004194 (2023). According to one estimate, up to 23 million people in the United States may have developed long COVID as of February 2022. U.S. Government Accountability Office. Science & Tech Spotlight: Long COVID. Available from: https: / / www.gao.gov / products / gao-22- 105666?utm_source=onepager&utm_medium=email&utm_campaign=email_staa. Another study estimated that at least 3 to 5 million US adults have activity-limiting long COVID. Tenforde MW, et al. Point Prevalence Estimates of Activity-Limiting Long-term Symptoms Among United States Adults ≥1 Month After Reported Severe Acute Respiratory Syndrome Coronavirus 2 Infection, 1 November 2021. J Infect Dis 227(7):855-863 (2023). More recently, authors of a paper published in Nature noted that there are at least 65 million long COVID cases worldwide, although they acknowledge this is a conservative estimate based on an incidence rate of 10% of the 651 million documented cases of COVID-19 worldwide. Davis, H.E., et al., Long COVID: major findings, mechanisms and recommendations. Nat Rev Microbiol 21, 133–146 (2023).
[0010] SARS-CoV-2 viruses are not unique in their ability to cause post-acute sequelae. Certain acute infections have long been associated with an unexplained chronic disability in a minority of patients. All manner of infectious agents, including bacteria, viruses, and parasites, has been implicated in the pathogenesis of post-acute infection syndromes, which include “long flu,” “long cold,” and post-treatment Lyme disease syndrome.
[0011] Among well-established post-acute infection syndromes is Q fever fatigue syndrome, which follows infection by the intracellular bacterium Coxiella burnetiid. Morroy, G., et al. Fatigue following acute Q-fever: a systematic literature review. PLoS One 11: e0155884 (2016). This syndrome lingers in a minority of Q fever survivors for prolonged periods and is associated with substantial morbidity. Another post-acute infection syndrome with significant worldwide impact is post-dengue fatigue syndrome, which can follow infection by the mosquito-borne dengue virus. Hung, T.M., et al. The uncertainty surrounding the burden of post-acute consequences of dengue infection. Trends Parasitol. 35: 673–676 (2019). Another post-acute infection syndrome is post-Ebola syndrome. Carod-Artal, F. J. Post-Ebola virus disease syndrome: what do we know? Expert Rev. Anti. Infect. Ther. 13: 1185–1187 (2015). In the past 10 years, substantial evidence has been presented for a post-acute infection syndrome with fatiguing and rheumatic symptoms in a subset of individuals infected withE3697-00624 Patent chikungunya virus, a mosquito-borne virus that causes fever and joint pain in the acute phase. Rodríguez-Morales, A. J., et al. Prevalence of post-chikungunya infection chronic inflammatory arthritis: a systematic review and meta-analysis. Arthritis Care Res. 68: 1849– 1858 (2016); Paixão, E.S., et al. Chikungunya chronic disease: a systematic review and meta- analysis. Trans. R. Soc. Trop. Med. Hyg. 112: 301–316 (2018). Evidence also indicates the possibility of similar post-acute symptoms following infections with other arthritogenic alphaviruses, such as Ross River virus and West Nile virus. Hickie, I., et al. Post-infective and chronic fatigue syndromes precipitated by viral and non-viral pathogens: Prospective cohort study. Br. Med. J. 333: 575–578 (2006).
[0012] Prolonged, debilitating, chronic symptoms have long been reported in a subset of patients after common infections including for example after mononucleosis, a condition generally caused by Epstein–Barr virus (EBV) and after an outbreak of Giardia lamblia, an intestinal parasite that usually causes acute intestinal illness. Several studies identified the association of this outbreak of giardiasis with chronic fatigue (Naess, H., et al. Chronic Fatigue Syndrome after Giardia enteritis: clinical characteristics, disability and long-term sickness absence. BMC Gastroenterol. 12: 13 (2012)), irritable bowel syndrome (IBS)(Litleskare, S., et al. Prevalence of irritable bowel syndrome and chronic fatigue 10 years after Giardia infection. Clin. Gastroenterol. Hepatol. 16: 1064–1072.e4 (2018)); and fibromyalgia (Hunskar, G.S., et al. Prevalence of fibromyalgia 10 years after infection with Giardia lamblia: a controlled prospective cohort study. Scand. J. Pain 22: 348–355 (2021)) persisting for many years. Another post-acute infection syndrome is post-treatment Lyme disease syndrome, which can present as persistent arthralgia, fatigue, and neurocognitive impairments in a minority of patients with Lyme disease after the recommended antibiotic treatment. Rebman, A. W. & Aucott, J. N. Post-treatment Lyme disease as a model for persistent symptoms in Lyme disease. Front. Med. 7: 57 (2020). Other studies have evaluated ME / CFS (myalgic encephalomyelitis / chronic fatigue syndrome) for chronic post-infection sequelae.
[0013] Evidence also points to “long flu”, with a large study showing symptoms persist at least 4 weeks or more after some people are hospitalized for the flu. See, e.g., Fung KW, et al. Prevalence and characteristics of long COVID in elderly patients: An observational cohort study of over 2 million adults in the US. PLoS Med 20(4):e1004194 (2023). Common symptoms among people with “long colds” were coughing, stomach pain, and diarrhea. See Vivaldi, G., et al., Long-term symptom profiles after COVID-19 vs other acute respiratory infections: an analysis of data from the COVIDENCE UK study, eClinicalMedicine 65:102251E3697-00624 Patent (2023). The CDC estimated that 1 in 10 people who get COVID go on to experience long COVID, which was defined in that estimate as symptoms lasting at least 3 months. For this new study comparing long COVID to long colds, the definition was symptoms lasting at least 4 weeks. People with long COVID were more likely than people with long colds to experience problems with taste and smell, hair loss, unusual sweating, higher heart rate, and memory problems.
[0014] The terms post-infectious fatigue syndrome and post-viral fatigue syndrome are sometimes used to describe debilitating fatigue following an infection, often accompanied by other signs and symptoms. Post-infectious and post-viral fatigue syndromes were originally postulated as subsets of ‘chronic fatigue syndrome,’ in which the triggering infectious agent is objectively documented67. However, there appears to be no clear consensus at present about the distinctions across these concepts. It is thus unclear whether these terms should be considered synonymous to the ME / CFS label, any of its subsets, or include a wider range of post-infectious fatigue conditions.
[0015] Gap junctions are specialized intercellular connections found between most animal cell-types. They are expressed in virtually all tissues of the body, except for mature skeletal muscle and mobile cell types such as sperm and erythrocytes and provide regulated physical communication between cells by directly linking the interiors of adjoining cells, allowing various molecules, ions and electrical impulses to directly pass through.
[0016] One gap junction channel is composed of two connexin hemichannels (also referred to as connexons), which connect across the intercellular space between adjacent cells. Each hemichannel of a gap junction resides in the adjacent cell membrane, and each hemichannel is formed by the covalent oligomerization of six individual connexin (Cx) proteins. See, e.g., Yeager (1998) Structure of cardiac gap junction intercellular channels, J Struct Biol 121: 231-245. Hemichannels can comprise one or more different connexin proteins but are usually in the form of homohexamers.
[0017] The human connexin family of genes and proteins now numbers 21. They usually weigh between about 25 and 60 kDa and have an average length of 380 amino acids. All connexins share a common structure as a 4-pass transmembrane (TM) protein that includes several domains, namely, a short intracellular N-terminus (NT), an intracellular loop (IL) and a C-terminus (CT) that is also localized in the cytoplasm, plus two extracellular loops (EL1 and EL2) located outside the cell. The cytoplasmic carboxy terminus can vary considerably in length. See, e.g., Unger, et al., Electron cryo-crystallography of a recombinant cardiac gap junction channel, Novartis Found Symp 1999, 219:22-30 and discussion at 31-43; Leith, E, etE3697-00624 Patent al., The connexin 43 C-terminus: A tail of many tales. Biochimica et Biophysica Acta 2018, 1860(1):48-64.
[0018] Connexin proteins are commonly named according to their molecular weights, e.g. connexin 26 (Cx26) is a connexin protein of 26 kDa, connexin 43 (Cx43) is 43 kDa, etc. The principal structural difference between connexin proteins is the length of the C-terminal cytoplasmic tail, with connexin 26 having almost no tail (16 amino acids), while connexins 43 and 32 have long and intermediate ones (73 and 156 amino acids, respectively).
[0019] While inherited or acquired alterations in the structure and function of connexin proteins have been linked with various diseases (e.g., Delmar, M, et al. Connexins and Disease, Cold Spring Harb Perspect Biol 2018, 10:a029348; Laird and Lampe, Cellular mechanisms of connexin-based inherited diseases. Trends in Cell Biology 2022, 32:58-69), research has also associated connexins with assorted conditions and disorders. See, e.g., Willebrords, J, et al., Connexins and their channels in inflammation Crit Rev Biochem Mol Biol. 2016, 51(6): 413– 439; Feng, J, Becker, DL, et al., Connexin 43 upregulation in burns promotes burn conversion through spread of apoptotic death signals, Burns 2020, 46(6):1389-1397; McDouall, A, Green, CR, et al., Connexins, Pannexins and Gap Junctions in Perinatal Brain Injury. Biomedicines 2022, 10:1445 (2022). Connexins have been proposed as therapeutics targets for a number of conditions, including spinal cord injury, perinatal brain injury, nervous system diseases (e.g. Alzheimer’s disease, Parkinson’s disease), cardiac disorders (e.g. myocardial infarction), ocular disorders (e.g. age-related macular degeneration, diabetic macular edema), acute and chronic wounds (e.g. venous leg ulcers, diabetic foot ulcers), ischemia-reperfusion injury, inflammation, burns and cancer. Reviewed in Laird and Lampe, Therapeutic strategies targeting connexins, Nat Rev Drug Discov. 201817(12): 905-921; Lampe and Laird, Recent advances in connexin gap junction biology, Faculty Reviews 2022, 27:11-14. See Becker DL, et al., Translating connexin biology into therapeutics. Semin. Cell Dev. Biol 2016, 50:49-58. See also the articles in the “Junctional Proteins” issue of FEBS Letters Volume 588, Issue 8, Pages: i, 1185-1490 (April 17, 2014), including Zhang J, et al. Connexin hemichannel induced vascular leak suggests a new paradigm for cancer therapy (p.1365-1371) and Martin PE, et al., Connexins: Sensors of epidermal integrity that are therapeutic targets (p.1304-1314). See also, e.g., Van Campenhout R, et al., Mechanisms Underlying Connexin Hemichannel Activation in Disease. Int J Mol Sci. 22(7):3503 (Apr 2021) and US Pat. Nos. 10,401,188 and 11,401,516, issued for “Channel Modulators.”
[0020] Pannexins are a family of transmembrane channel glycoproteins that include Panx1, Panx2 and Panx3. Pannexins share similar structural features with connexins, consistingE3697-00624 Patent of 4 transmembrane domains, 2 extracellular and 1 intracellular loop, along with intracellular N- and C-terminal tails. Pannexin 1 (Panx1) is a ubiquitously expressed protein forming large conductance channels that are central to various distinct inflammation and injury responses. nPanx1 is expressed in many mammalian tissues, while Panx2 and Panx3 expression is more limited. Panx1 channels have been implicated in ATP release, as well as calcium signaling, and keratinocyte and osteoblast differentiation. One major difference between connexin and pannexin channels is that pannexin channels do not form cell-to-cell channels. Pannexin modulators have previously been described. They include pannexin peptidomimetic compounds (e.g.,10Panx1), as well as probenecid and other compounds of Formula VI, including analogs and prodrugs thereof, as set forth in US Patent No. 10,465,188, issued on November 5, 2019, for “Channel Modulators.”
[0021] Inflammasomes are large, cytosolic molecular complexes that typically consist of a sensor protein, the adaptor protein apoptosis-associated speck-like protein containing a caspase-recruitment domain (ASC), and the proinflammatory caspase, caspase-1. They control activation of the proteolytic enzyme caspase-1. Caspase-1 in turn regulates the proteolytic maturation of Interleukin-1β and IL-18, as well as a rapid, noxious, inflammatory form of cell death termed pyroptosis. Assembly of inflammasome complexes is dependent on cytosolic sensing of pathogen-associated molecular patterns (PAMPs) that gain access to the cytosol during microbial infection. PAMPs are relatively non-specific, highly conserved, pathogenic molecular structures expressed in pathogens, and their products (including, e.g., lipopolysaccharide (LPS), which is found on the outer cell wall of gram-negative bacteria). Being derived from microorganisms, PAMPs drive inflammation in response to infections. In addition, endogenous danger signals (danger-associated molecular patterns, or DAMPs) released from damaged or dying cells also activate inflammasomes. DAMPs are derived from host cells including tumor cells, dead or dying cells, or products released from cells in response to signals such as hypoxia. DAMPs are a large number of related intracellular proteins or nucleic acids released by necrotic cells at the site of necrosis. Because they are derived from host materials, DAMPs induce what are known as sterile inflammatory responses. DAMPs are often created or exposed in environments of trauma, ischemia, or tissue damage and do not require pathogenic infection and drive pathological inflammation in sterile inflammatory diseases including atherosclerosis, Alzheimer’s disease, diabetes and cancer. See Rathinam and Fitzgerald, Inflammasome Complexes: Emerging Mechanisms and Effector Functions. Cell. 2016, 165(4):792-800.E3697-00624 Patent
[0022] Four key inflammasomes have been well characterized, i.e., NLRP1, NLRP3, NLRC4, and AIM2. They regulate innate immunity by serving as a signaling platform, and activation of these any one of these inflammasomes leads to the processing and secretion of inflammatory cytokines, including IL-1β and IL-18.
[0023] The Nod-like receptor protein 3 (NLRP3) inflammasome, is by far the most extensively studied and well-characterized inflammasome. The NLRP3 inflammasome (also sometimes identified as the “nucleotide-binding domain, leucine-rich–containing family, pyrin domain–containing-3” inflammasome) is expressed in various cells of the cardiovascular system, including in cardiomyocytes, endothelial cells, and immune cells. It is a cytosolic multiprotein complex composed of the innate immune receptor protein NLRP3, the adaptor protein apoptosis-associated speck-like protein (ASC), and inflammatory protease caspase-1 (pro-caspase-1). A variety of stimuli can activate the NLRP3 inflammasome. When activated, the NLRP3 protein recruits the adaptor ASC protein and activates pro-caspase-1, resulting in inflammatory cytokine maturation and secretion, which is associated with inflammation and the induction of gasdermin D-dependent pyroptosis.
[0024] Like other inflammasomes, the assembled NLRP3 inflammasome facilitates the release of IL-1β and IL-18, which contribute to innate immune defense and homeostatic maintenance. However, aberrant activation of the NLRP3 inflammasome has been linked to the pathogenesis of various inflammatory diseases, including atherosclerosis, ischemic stroke, Alzheimer's disease, diabetes mellitus and inflammatory bowel disease. Recent studies have revealed that NLRP3 inflammasome activation contributes to not only pyroptosis but also other types of cell death, including apoptosis, necroptosis, and ferroptosis, and the NLRP3 inflammasome has emerged as a therapeutic target for inflammatory diseases. Reviewed in Zhang X, et al., Int J Mol Med. 2023, 51(4):35, which discusses candidate inhibitors of the NLRP3 inflammasome including MCC950 (CP-456,773, CRID3), oridonin (an ent-kaurane diterpenoid), OLT1177 (an orally active β-sulfonyl cyanide molecule), INF39, tranilast (a tryptophan metabolite), CY-09, JC124, 3,4-methylenedioxy-β-nitrostyrene (MNS), parthenolide, BOT-4-one, and others.
[0025] Countries throughout the world are now experiencing the impact of post-acute infection disorders, including long COVID, long flu and long cold, and a greater fraction of the population suffers from infection-associated fatigue, brain fog and other post-infection impairments, making it important to elucidate means by which to treat and protect against the effects of post-acute infection syndromes. These disorders have already become a major burdenE3697-00624 Patent on society with and increased incidence of symptoms and effects of post-acute infection syndromes.
[0026] Post-acute infection syndromes, including long COVID, long flu, long cold, post-treatment Lyme disease syndrome, myalgic encephalomyelitis / chronic fatigue syndrome (ME / CFS), etc., have remained an unmet medical need. The need for therapeutics for post- acute infection syndromes is unmet need. There is currently no approved medication for long COVID or other post-acute infection syndromes, including those described or referenced herein. Such compounds are described herein. BRIEFINTRODUCTIONTOTHEINVENTIONS
[0027] The inventions described and claimed herein have many attributes and embodiments including, but not limited to, those set forth or described or referenced in this brief introduction. It is not intended to be all-inclusive, and the inventions described and claimed herein are not limited to or by the features or embodiments identified in this introduction, which is included for purposes of illustration and outline only and not restriction. Further description and detail is contained in the Detailed Description and claims, all of which, including this introduction, form a part of the patent specification.
[0028] SARS-CoV-2 viruses are not unique in their ability to cause post-acute sequelae. Certain acute infections have long been associated with an unexplained chronic disability in a minority of patients. Post-acute infection syndromes represent a substantial healthcare burden, but there is a lack of understanding of the underlying mechanisms, representing a significant blind spot in the field of medicine. Unfortunately, the association between acute infectious diseases and unexplained chronic disability remains understudied, which leads to poor recognition of these conditions in clinical practice. As a result, patients might experience delayed or a complete lack of clinical care. Choutka, J., et al. Unexplained post-acute infection syndromes. Nat Med 28, 911–923 (2022).
[0029] The disclosure is based, in part, on the discovery that connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) can treat, prevent, alleviate and / or reverse one or more signs or symptoms associated with a post-acute infection syndrome, including one or more signs and / or symptoms of long COVID, long flu, post-treatment Lyme disease syndrome, etc.
[0030] The disclosure is also based, in part, on the discovery that inflammasome modulators (e.g., NLRP3 inflammasome modulators), can treat, prevent, alleviate and / or reverse one or more signs or symptoms associated with a post-acute infection syndrome,E3697-00624 Patent including one or more signs and / or symptoms of long COVID, long flu, post-treatment Lyme disease syndrome, etc.
[0031] The disclosure is further based, in part, on the use of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) to treat, prevent, alleviate and / or reverse fatigue associated with a post-acute infection syndrome, including long COVID, long flu, post-treatment Lyme disease syndrome, etc. The disclosure is further based, in part, on the use of inflammasome modulators (e.g., NLRP3 inflammasome modulators), to treat, prevent, treat, alleviate and / or reverse fatigue associated with a post-acute infection syndroms, including long COVID, long flu, post-treatment Lyme disease syndrome, etc. In addition, inventions described herein include the use of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and inflammasome modulators (e.g., NLRP3 inflammasome modulators) to prevent, treat, alleviate and / or reverse weakness and post-exertional malaise associated with post-acute infection syndromes, including those described herein. In addition, inventions described herein include the use of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and inflammasome modulators (e.g., NLRP3 inflammasome modulators) to treat, prevent, alleviate and / or reverse arthralgia, ANA (antinuclear antibody) levels indicative of autoimmunity, and / or neuropathy associated with post-acute infection syndromes, including those described herein.
[0032] The disclosure is also based, in part, on the use of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) to treat, prevent, alleviate and / or reverse brain fog associated with post-acute infection syndromes, including long COVID, long flu, Post-treatment Lyme disease syndrome, etc., as well as associated polyarthralgia. The disclosure is also based, in part, on the use of inflammasome modulators (e.g., NLRP3 inflammasome modulators) to treat, prevent, alleviate and / or reverse brain fog associated with post-acute infection syndromes, including long COVID, long flu, post-treatment Lyme disease syndrome, etc., as well as associated polyarthralgia.
[0033] Numbness and tingling (“pins and needles”), sometimes referred to as paresthesia, is also associated with post-acute infection syndromes, including long COVID. The specification also includes disclosure of inventions based on the use of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) to treat, prevent, alleviate and / or reverse numbness paresthesia associated with post-acute infection syndromes, including long COVID, long flu, etc. The specification also includes disclosure of inventions based on the use of inflammasome modulators (e.g., NLRP3 inflammasome modulators) to treat, prevent, alleviate and / or reverse paresthesia associated with post-acute infection syndromes,E3697-00624 Patent including long COVID, long flu, etc. In addition, inventions described herein include the use of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and inflammasome modulators (e.g., NLRP3 inflammasome modulators) to treat, prevent, alleviate and / or reverse dizziness, vertigo and balance issues associated with post-acute infection syndromes, including those described herein, as well as numbness and loss of sensation, tremors and peripheral neuropathies.
[0034] In addition, connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and inflammasome modulators (e.g., NLRP3 inflammasome modulators) can also treat, prevent, alleviate and / or reverse other neuropsychiatric symptoms such as poor attention, difficulty thinking, difficulty with executive functioning, difficulty with problem-solving, slowed thoughts, sudden (acute), confusion and short-term and long-term memory loss associated with post-acute infection syndromes, including those described herein (e.g., long COVID), as well as difficulty finding the right words, difficulty communicating verbally, as well as other speech and language issues and hallucinations.
[0035] In some embodiments of the inventions, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided to treat, prevent, alleviate and / or reverse one or more signs or symptoms of a post-acute infection syndrome in a subject. In some embodiments, the post-acute infection syndrome is long COVID. In some embodiments, the post-acute infection syndrome is long flu or long cold. In some embodiments, the post-acute infection syndrome is selected from the group consisting of post-treatment Lyme disease syndrome, post-Ebola syndrome, post-Ebola virus disease syndrome, post-dengue fatigue syndrome, post-polio syndrome, post-SARS syndrome, post-acute sequelae of SARS-CoV-2 invention, post chikungunya chronic inflammatory rheumatism, post-chikungunya disease, post-acute COVID-19 syndrome, post-EBV syndrome, post-West Nile virus syndrome, post- Ross River virus syndrome, post-coxsakie B syndrome, post-H1N1 / 09 influenza syndrome, post-VZV syndrome, Q fever fatigue syndrome and post-Giardia lamblia syndrome.
[0036] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided prevent, alleviate and / or reverse systemic symptoms associated with a post-acute infection syndrome, including fatigue, post- exertional malaise, and weakness.E3697-00624 Patent
[0037] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided prevent, alleviate and / or reverse musculoskeletal symptoms associated with a post-acute infection syndrome, including muscle aches, muscle spasms, and joint pain.
[0038] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided prevent, alleviate and / or reverse cardiovascular symptoms associated with a post-acute infection syndrome, including palpitations, tachycardia, and tightness or pain in the chest.
[0039] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided prevent, alleviate and / or reverse cardiovascular symptoms associated with a post-acute infection syndrome, including palpitations, tachycardia, and tightness or pain in the chest.
[0040] brain fog, numbness, weakness, peripheral neuropathies, dizziness, confusion.
[0041] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided to treat, prevent, alleviate and / or reverse one or more signs or symptoms associated with post-acute infection syndromes, including fatigue, brain fog, numbness, neuropsychiatric symptoms weakness, peripheral neuropathies, dizziness, confusion.
[0042] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits comprising one or more connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators) are provided to prevent, alleviate and / or reverse fatigue, brain fog, numbness, weakness, peripheral neuropathies, dizziness, confusion associated with a post-acute infection syndrome.
[0043] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits are provided prevent, alleviate and / or reverse fatigue, jointE3697-00624 Patent pain, joint swelling, and / or abdominal pain or digestive issues associated with a post-acute infection syndrome.
[0044] In some embodiments of the inventions, for example, uses, methods, doses, dose regimens, compositions and kits are provided to prevent, alleviate and / or reverse elevated or abnormal levels of one or more autoimmune markers (e.g., C-reactive protein (CRP), antinuclear antibodies (ANA), antinuclear ribonucleoprotein (anti-RNP) antibodies, and anti- dsDNA antibodies. Patients with extended duration long-COVID-19 syndrome exhibit a distinct immunologic phenotype that includes a poorer SARS-CoV-2 antibody response and autoimmunity. Long COVID patients to be treated as described herein may show a dysregulated immune response, consisting of decreased frequency of detectable neutralizing antibodies, decreased anti-spike antibody levels, and higher frequency of positive ANA titers. See García-Abellán J, et al. Immunologic phenotype of patients with long-COVID syndrome of 1-year duration. Front Immunol. 13:920627 (2022). Persistent positive ANA autoreactivity titers are associated with fatigue, dyspnea, and cough severity in COVID patients. See Cho, OH. Significance of antinuclear antibodies in patients with COVID-19. Korean J Intern Med. 38(3):280-281 (2023).
[0045] It is an object of the invention to provide methods, doses, dose regimens, compositions, and kits for connexin hemichannel modulation (e.g., connexin hemichannel modulation) for the treatment of a subject as described herein. It is another object of the invention to provide methods, doses, dose regimens, compositions, and kits for inflammasome inhibition (e.g., NLRP3 inflammasome inhibition) for the treatment of a subject as described herein. In some embodiments, the subject is a human. In some embodiments, connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) used in methods, compositions and kits of the invention, including to treat or prevent a post-acute infection syndrome, may be referred to as direct connexin hemichannel modulators, including, for example, the compounds of Formula I, including tonabersat and carabersat, and connexin peptidomimetics such as Peptide5, Gap29 and Gap27. In other some embodiments, useful connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) may be referred to as indirect connexin hemichannel modulators, including, for example, the connexin peptidomimetics XG19, Gap19, CXT 1 to CXT 5, Antp / CXT 1 to Antp / CXT 5, as well as anti-connexin antisense compounds, including, for example, SEQ ID NO:1 and other connexin-modulating molecules, peptidomimetics and sequences described herein or known in the art. In some embodiments, the connexin hemichannel modulators are connexin 43 hemichannel modulators. In some embodiments, the connexin hemichannelE3697-00624 Patent modulators (e.g., connexin 43 hemichannel modulators) are used in and useful for methods, compositions and kits of the invention to treat, prevent, reverse or alleviate one or more signs and / or symptoms of a post-acute infection syndrome.
[0046] In some embodiments, inflammasome modulators (e.g., NLRP3 inflammasome modulators) useful in methods, compositions and kits of the invention, including to reverse or alleviate one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.), may be referred to as direct or indirect inflammasome modulators. Useful inflammasome modulators that may be referred to as direct inflammasome modulators include, for example, oridonin, MCC950, tranilast and analogues thereof which directly binds to the NACHT domain of NLRP3 and change its conformation,; OLT1177 and parthenolide which suppress the ATPase activity of NLRP3; CY- 09 which binds to the NACHT domain and inhibits ATPase of NLRP3; BAY11-7082 and VI- 16 which block the binding between TXNIP and NLRP3; NIC7 (NLRP3-inhibitory compound), and its derivatives which inhibit NLRP3-mediated activation of caspase 1 along with the secretion of interleukin (IL)-1β, IL-18 and lactate dehydrogenase. Useful inflammasome modulators that may be referred to as indirect inflammasome modulators include, for example, glyburide, 1673-34-0, FC11A-2, β-hydroxybutyrate, etc., and modulators of ATP-induced inflammasome activation such as tonabersat and other small molecule connexin hemichannel modulators, connexin peptidomimetics including for example, Peptide5, XG19, etc. In some embodiments, the inflammasome modulators are NLRP3 inflammasome modulators. In some embodiments, the inflammasome modulators are direct NLRP3 inflammasome modulators. In some embodiments, the inflammasome modulators are indirect NLRP3 inflammasome modulators. In some embodiments, the inflammasome modulators (e.g., NLRP3 inflammasome modulators) are used in and useful for methods, compositions and kits of the invention relating to reversing or alleviating one or more signs or symptoms of a post-acute infection disorder (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) in a subject, for example a patient, including, for example, a human patient or subject.
[0047] In some embodiments, at least one connexin hemichannel blocker (e.g., connexin 43 hemichannel blocker), indirect inflammasome inhibitor and / or direct inflammasome inhibitor is used to reverse or alleviate or improve one or more signs or symptoms of a post-acute infection disorder (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) in a subject, for example a patient, including, for example, a human patient or subject.E3697-00624 Patent
[0048] In some embodiments of any of these methods a combination pharmaceutical composition that comprises two or more of an agent that decreases connexin hemichannel activity (e.g., connexin 43 hemichannel activity) and an agent that decreases or suppresses inflammasome activity or activation (e.g., an NLRP3 inflammasome inhibitor) is administered to a subject. In some embodiments, an agent that decreases pannexin channel activity (e.g., pannexin 1 channel activity) may be includes with a pharmaceutical composition comprising either agent that decreases connexin hemichannel activity (e.g., connexin 43 hemichannel activity) or an agent that decreases or suppresses inflammasome activity or activation (e.g., an NLRP3 inflammasome inhibitor) or both.
[0049] Modulation of a hemichannel may occur by any means. In some embodiments, for example, modulation may occur by inducing or promoting closure of a hemichannel; by preventing, blocking, inhibiting or decreasing hemichannel opening; by suppressing hemichannel permeability; by suppressing ATP release from hemichannels; and / or by triggering, inducing or promoting cellular internalization of a hemichannel and / or gap junction. Hemichannel modulators include blockers and other compounds that interfere with the passage of molecules through a connexin hemichannel. A hemichannel modulator can block or reduce the release of molecules through a hemichannel to an extracellular space, and / or block or reduce the entry of molecules through a hemichannel into an intracellular space. In some embodiments, hemichannel modulators fully or partially block hemichannel opening. In some embodiments, hemichannel modulators fully or partially block, slow or suppress the leak or the passage of molecules through a hemichannel to or from an extracellular space. In some embodiments, hemichannel modulators are compounds that decrease the open probability of a hemichannel.
[0050] In some embodiments of the invention, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) is a benzoylamino benzopyran. In some embodiments, the benzoylamino benzopyran is a compound according to Formula I. In some embodiments compound according to Formula I is carabersat. In some embodiments compound according to Formula I is tonabersat. In some embodiments, the tonabersat compound is a tonabersat prodrug. In some embodiments the tonabersat prodrug is a compound according to Formula II.
[0051] In some embodiments, the connexin modulator comprises a connexin peptidomimetic. In some embodiments, the connexin peptidomimetic is a connexin43 peptidomimetic. In some embodiments, the connexin 43 hemichannel modulator peptidomimetic molecule is, comprises, or consists essentially of, for example, Peptide5,E3697-00624 Patent Gap19, XG19, CXT 1 to CXT 5, Antp / CXT 1 to Antp / CXT 5, etc., or a compounds selected from Table II (SEQ ID NOS: 101-102, 104, 107-108, 112-117, 119-123, 128-129, 140-207). In some embodiments, the connexin peptidomimetic is a connexin 37, connexin 40 and / or connexin 45 peptidomimetic.
[0052] In some embodiments, the connexin peptidomimetic comprises, consists essentially of, or consists of SRPTEKT (SEQ ID NO:101). In some embodiments, the connexin peptidomimetic comprises, consists essentially of, or consists of Gap19, XG19, Gap26 or Gap27. In some embodiments, the connexin peptidomimetic is a connexin26 peptidomimetic (e.g. Gap26 i.e., VCYDKSFPISHVR (SEQ ID NO:102), a connexin32 peptidomimetic (e.g. INCTLQPGCNSV (SEQ ID NO: 103) or37,43Gap27, which is SRPTEKTIFII (SEQ ID NO: 104) or a connexin45 peptidomimetic, or a connexin50 peptidomimetic (e.g. TAT-Cx50L2, i.e., GGERAPLAADQGSVKKSSSSSKGTKK (SEQ ID NO: 105) or TAT-Cx50CT, i.e., SRARSDDLTV (SEQ ID NO: 106)).
[0053] In some embodiments the connexin hemichannel modulator modulates connexin expression. In some embodiments, the connexin expression modulator modulates connexin 43 expression. In other embodiments, the connexin expression modulator modulates expression of a vascular connexin. In other embodiments, the connexin expression modulator modulates expression of connexin 37, connexin 40 and / or connexin 45. In some embodiments, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) is a connexin (e.g., a connexin 43) antisense molecule. In some embodiments, the connexin modulator may be a connexin 43 antisense polynucleotide comprising, consisting essentially of, or consisting of a sequence according to SEQ ID NOS.1-16 and / or modified versions thereof. In some embodiments, antisense oligonucleotide comprises, consists essentially of, or consists of 5'-GTA ATT GCG GCA AGA AGA ATT GTT TCT GTC-3' (SEQ ID NO:1). In some embodiments, the antisense oligonucleotide may be chemically modified or may be an unmodified oligonucleotide, e.g. a modified or an unmodified DNA oligonucleotide.
[0054] In some embodiments, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) is an anti-connexin (e.g., an anti-connexin 43) antibody (e.g., an anti-connexin monoclonal antibody), an anti-connexin (e.g., an anti-connexin 43) antibody fragment (e.g., an anti-connexin Fab, F(ab’)2, etc.), an anti-connexin (e.g., an anti-connexin 43) engineered antibody (e.g., an anti-connexin single-chain variable (scFv) fragment or scFab, etc.), an anti-connexin (e.g., an anti-connexin 43) Ig domain (e.g., an anti-connexin 43 VHH), an anti-connexin nanobody (Nb), etc. In other embodiments, one or more of these connexinE3697-00624 Patent modulators is directed to a vascular connexin. In other embodiments, one or more of these connexin modulators is directed against connexin 37, connexin 40 and / or connexin 45.
[0055] In some embodiments, the connexin hemichannel modulators used in methods of the invention modulates one or more of connexin 26 or a connexin 26 hemichannel, connexin 30 or a connexin 30 hemichannel, connexin 30.3 or a connexin 30.3 hemichannel, connexin 31 or a connexin 31 hemichannel, connexin 31.1 or a connexin 31,1 hemichannel, connexin 32 or a connexin 32 hemichannel, connexin 50 or a connexin 50 hemichannel and connexin 58 or a connexin 58 hemichannel.
[0056] Other agents useful alone, or together with connexin hemichannel modulators and / or inflammasome modulators in compositions, methods, kits, doses and dose regimens of the invention comprise pannexin channel modulators. In some embodiments, the pannexin channel modulator is a pannexin 1 channel modulator. In some embodiments, the pannexin 1 channel modulator is probenecid. In some embodiments, the pannexin 1 channel modulator an analog or prodrug of probenecid. In some embodiments, the pannexin 1 channel modulator is a compound according to Formula VI in US Patent No. 10,465,188, or an analog or prodrug thereof. In some embodiments, the pannexin 1 channel modulator is a mimetic peptide blocker of pannexin 1 (e.g.,10Panx1, or an analogue of thereof).
[0055] Caspases are a family of intracellular cysteine proteases that cleave a limited number of substrates after aspartic acid residues. The function of caspases has been extensively studied in apoptosis where they play an essential role in the activation and implementation of cellular demise.However, several caspases including the human caspase-1, -4, and -5 are involved in the processing and secretion of pro-inflammatory molecules and are often refereed as “pro-inflammatory caspases. The inflammasome is a multi-protein complex that mediates activation of caspase-1 which promotes the secretion of the proinflammatory cytokines IL-1β and IL-18 as well as pyroptosis, a form of cell death induced by bacterial pathogens. In some embodiments, the inflammasome modulator used to treat, prevent or ameliorate one or more signs or symptoms of a post-acute infection syndrome, disease, disorder or conditions is a compound that modulates caspsase-1 activation or activity. In some embodiments that inflammasome pathway modulator that targets caspase-1 is belnacasan (VX-765).
[0056] NOD-like receptor (NLR), family pyrin domain containing 3 (NLRP3) assembles a protein complex known as the NLRP3 inflammasome upon sensing certain pathogen products or sterile danger signals. This inflammasome processes pro–interleukin-1 β (pro–IL-1β) and pro–IL-18 into bioactive IL-1β and IL-18, respectively, and cleaves gasdermin D (GSDMD). GSDMD amino-terminal fragments form plasma membrane pores that facilitate the secretionE3697-00624 Patent of IL-1β and IL-18 and lead to the inflammatory cell death pyroptosis. Accordingly, GSDMD inactivation results in negligible spontaneous inflammation in various experimental models such as in Nlrp3CA / +mice lacking GSDMD (Nlrp3CA / +;Gsdmd− / −mice). In some embodiments, the inflammasome modulator used to treat, prevent or ameliorate one or more signs or symptoms of a post-acute infection syndrome, disease, disorder or conditions is a compound that modulates GSDMD activation or activity. In some embodiments that inflammasome pathway modulator that targets GSDMD is selected from the group consisting of necrosulfonamide, disulfiram and dimethyl fumarte.
[0057] In some embodiments, a compound or composition for modulation or inhibition of a connexin hemichannel and / or an inflammasome is provided for treatment and is dosed as described herein.
[0058] In some embodiments of the invention, a connexin 43 hemichannel is modulated or inhibited. In some embodiments, a connexin 43 hemichannel is modulated or inhibited in order to reduce the release of ATP from the hemichannel.
[0059] In some embodiments, a compound or composition for modulation or inhibition of an inflammasome is provided for treatment and is dosed as described herein. In some embodiments, a compound or composition for modulation or inhibition of an NLRP3 inflammasomes is provided for treatment and is dosed as described herein.
[0060] In some embodiments, a pannexin 1 channel is modulated or inhibited. In some embodiments, a pannexin 1 channel is modulated or inhibited in order to reduce ATP release from a pannexin channels.
[0061] In some embodiments, the cell or cell population treated using a compound, composition or method of the invention comprises a human cell or a human cell population. In some embodiments, the tissue treated using a compound, composition or method of the invention is a human tissue. In some embodiments, an organ treated using a compound, composition or method of the invention is a human organ. In some embodiments, the subject treated using a compound, composition or method of the invention is a human.
[0062] In some embodiments, the connexin hemichannel modulator or the inflammasome inhibitor is orally, systemically, topically, or parenterally. In some embodiments, administration is local. In some embodiments, the connexin hemichannel modulator or the inflammasome inhibitor is administered to the skin. In some embodiments, the connexin hemichannel modulator or the inflammasome inhibitor is administered transdermally. In some embodiments, the connexin hemichannel modulator or theE3697-00624 Patent inflammasome inhibitor is administered to the eye. In some embodiments, the connexin hemichannel modulator or the inflammasome inhibitor is administered topically to the eye.
[0063] In some embodiments of the present invention for topical administration, e.g. to the skin, to the eye, or to an internal organ, the method comprises administering to the subject a therapeutically effective amount of composition comprising an agent (e.g., a connexin or connexin hemichannel modulator), wherein the composition comprises a compound selected from the group consisting of reverse thermosetting gels, poloxamer gels, nonionic polyoxyethylene-polyoxypropylene block co-polymers (e.g. Pluronic F-127) and cellulose- based carriers (e.g., hydroxyethylcellulose, carboxymethylcellulose hydroxymethylcellulose, hydroxypropylmethylcellulose, etc.) and other pharmaceutically acceptable carriers. In some embodiments, the agent is selected from the group consisting of small molecule, antisense, peptidomimetic, antibody and antibody fragment connexin hemichannel modulators (e.g., a connexin 43 hemichannel modulator). In some embodiments, the connexin 43 hemichannel modulator modulates connexin 43 hemichannel activity (e.g., ATP release). In some embodiments, the connexin 43 hemichannel modulator modulates connexin 43 protein expression. In some embodiments, the connexin 43 protein expression modulator is an antisense molecule. In some embodiments, the connexin 43 antisense molecule is SEQ ID NO:1.
[0064] In some embodiments, the topical composition for use in the methods of the invention comprises poloxamer F-127 (poloxamer 407 or Pluronic F-127). In some embodiments, the composition for use in the methods of the invention comprises about 20-30 mg / mL of a poloxamer F-127. In some embodiments, the composition for use in the methods of the invention comprises about 22-25 mg / mL of a poloxamer F-127. In some embodiments, the composition for use in the methods of the invention comprises about 22.6 mg / mL of a poloxamer F-127.
[0065] In some embodiments, a combination of two or more compounds selected from the group consisting of connexin hemichannel modulators (e.g. connexin hemichannel modulators), pannexin channel modulators (e.g. pannexin 1 channel modulators), inflammasome modulators (e.g. NLRP3 inflammasome modulators) are administered to a cell, to a cell population, to a tissue, to an organ, or to a subject.
[0066] In some embodiments, the connexin hemichannel modulator is administered to a subject using any of the dosing schedules described herein in a therapeutically effective amount.E3697-00624 Patent
[0067] In some embodiments, the amount of connexin modulator administered to a subject in any of the dosing schedules described herein is one or more of the dose amounts described herein (e.g. milligram per milliliter (mg / mL) connexin modulator dosing, micromolar (µM) connexin modulator concentration dosing, milligram (mg) connexin modulator dosing, etc.).
[0068] In some embodiments, the invention provides the use of a connexin modulator in the manufacture of a medicament for treatment of any of the diseases, disorders or conditions described herein. In some embodiments, the medicament comprises, consists essentially of, or consists of, an agent as described herein, including one or more connexin expression or connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators) and / or including one or more inflammasome modulators (e.g., NLRP3 inflammasome modulators). In some embodiments, the agent is, comprises, or consists essentially of, a molecule according to Formula I (e.g., tonabersat or carabersat), a tonabersat prodrug (e.g., a molecule according to Formula II), a connexin peptide mimetic (e.g., XG19, Peptide5, Gap19, an aCT1 peptide (e.g., CXT 1, CXT , CXT 3, CXT 4, CXT 5, or any other C-terminal connexin peptidomimetic, with or without a C-terminally or N-terminally attached cell-penetrating peptide), etc.), and / or a connexin antisense molecule (e.g., SEQ ID NO:1), including in the amounts and / or concentrations described herein.
[0069] In some embodiments, the invention relates to pharmaceutical compositions and articles of manufacture, including kits comprising a therapeutically effective amount of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome inhibitor (e.g., an NLRP3 inflammasome inhibitor), and dose regimens for treating one or more of the diseases, disorders or conditions described herein, including, for example, treatment of one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.). In some embodiments, the kit includes or is associated with instructions (e.g. included instructions, online instructions, QR code instructions, etc.) for use. The instructions may provide instructions for dosing and treating diseases, disorders and conditions described or referred to herein. In some embodiments, the kit includes means for administration of the connexin hemichannel modulator(s) and / or the inflammasome inhibitor(s).
[0070] In some embodiments, a connexin modulator(s) (e.g. a connexin expression modulator, a connexin gap junction modulators, a connexin hemichannel modulators, including, for example, modulators of Cx26, Cx30, Cx30.3, Cx31.1, Cx32, Cx36, Cx37, Cx40,E3697-00624 Patent Cx43, Cx45, Cx50 or Cx58 connexins, gap junctions and / or hemichannels) are combined with a pharmaceutically acceptable carrier or diluent to produce a pharmaceutical composition. In some embodiments, suitable carriers and diluents include buffered, aqueous solutions, isotonic saline solutions, for example phosphate-buffered saline, isotonic water, and the like. In some embodiments, the carrier is a pluronic or poloxamer gel. In some embodiments, the gel is pluronic F-127. In some embodiments, the pharmaceutical composition comprises a buffer. In some embodiments, the buffer comprises or consists essentially of sodium phosphate dibasic heptahydrate or sodium phosphate monobasic or both.
[0071] In some embodiments, methods of the invention, the doses and the dose regimens, and the connexin modulators (e.g. connexin expression modulators, connexin gap junction modulators and connexin hemichannel modulators, including, for example, modulators of Cx26, Cx30, Cx30.3, Cx31.1, Cx32, Cx36, Cx37, Cx40, Cx43, Cx45, Cx50 or Cx58 connexins, gap junctions and / or hemichannels) and / or inflammasome inhibitor(s) (e.g., an NLRP3 inflammasome inhibitor(s)), described herein are used for the treatment of a subject for one or more of the diseases, disorders or conditions described or referred to herein alone or in combination with or in conjunction with another therapeutic agent.
[0072] In some embodiments, doses of the connexin, inflammasome, and / or pannexin modulators described or referenced herein are administered with, or co-formulated for administration to a subject with, effective amounts of one or more compounds selected from the group consisting of anti-microbial agents, antibiotics, antivirals, anti-fungals, anti- parasitics, anti-oxidants, statins and other cholesterol drugs, ACE inhibitors (e.g. ramipril), angiotensin-II antagonists (e.g., losartan), anti-arrhythmic medicines (e.g., amiodarone), anticoagulant medicines (e.g., dabigatran), anti-platelet medicines (e.g., clopidogrel), beta- blockers (e.g., bisoprolol), calcium-channel blockers (e.g., amlodipine), steroidal anti- inflammatories, immunosuppressants, and immunomodulatory agents.
[0073] In some embodiments of any of these methods a combination pharmaceutical composition that comprises two or more of an agent that decreases connexin hemichannel activity (e.g., connexin 43 hemichannel activity) and / or an agent that decreases or suppresses inflammasome activity or activation (e.g., an NLRP3 inflammasome inhibitor) is administered to a subject alone or in combination with one or more of an antiviral agent (e.g., an agent comprising paxlovid, remdesivir, etc.), an anti-inflammatory agent (e.g., an agent comprising baricitinib, tocilizumab, etc.), a steroid or corticosteroid agent (e.g., an agent comprising a cortison, a prednisone, a prednisolone, a methylprednisolone, a dexamethasone, a betamethasone, a hydrocortisone, etc.), an immune suppression agent (e.g., an agentE3697-00624 Patent comprising anakinra, etc.), a complement inhibitor (e.g., an agent comprising empavelia, etc.), other immunosuppressants (e.g., an agent comprising a TNF inhibitor, including Enbrel, Humira, etc.), an antibody agent (e.g., an agent comprising vilobelimab), and other agents including, for example, ivermectin, hydroxychloroquine and chloroquine. Antiviral, anti- inflammatory, steroid, corticosteroid, immune suppression, antibody, and other drugs and agents useful in the treatment of one or more signs or symptoms of a post-acute infection disorder may be administered to a post-acute infection syndrome patient as a combination pharmaceutical in combination with a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator / inhibitor), an inflammasome modulator (e.g, an NLRP3 inflammasome modulator / inhibitor), and / or a pannexin channel modulator (e.g., a Panx 1 channel modulator / inhibitor) or they may be administered separately at or about the same time as a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator / inhibitor), an inflammasome modulator (e.g, an NLRP3 inflammasome modulator / inhibitor) and / or a pannexin channel modulator (e.g., a Panx 1 channel modulator / inhibitor). In some embodiments, doses of one or more of the connexin, inflammasome, and / or pannexin modulators described or referenced herein are co-formulated for administration to a subject with effective amounts of one or more these agents. In some embodiments, doses of one or more of the connexin, inflammasome, and / or pannexin modulators described or referenced herein are administered to a subject with an effective amount of one or more these agents.
[0074] In another aspect the present disclosure provides a method of selecting or quantifying the activity of a candidate compound for the treatment of a post-acute infection disorder. In some embodiments, the method comprises providing a first isolated cell or preparation of cells or tissue; determining ATP levels in the cell or cell preparation or tissue; comparing ATP levels in the cell or cell preparation or tissue to a reference level; contacting it with a test compound (i.e., one or more candidate agents) to the cell or the cell preparation or tissue, or to another to preparation of like or similar cells or tissue(s), and remeasuring ATP levels in the cell or preparation of cells or tissue. The candidate test compound may then be evaluated for dosing in and animal model of a post-acute infection disorder, and for the treatment or prevention of one or more signs or symptoms thereof. In some embodiments, the test compound is a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator). In some embodiments, the test compound is an inflammasome inhibitor or candidate inhibitor (e.g. an NLRP3 inflammasome inhibitor or candidate NLRP3 inflammasome inhibitor). In other embodiments, the test compound may be a pannexin channel modulator (e.g., a pannexin 1 channel modulator). In some embodiments, the test compound isE3697-00624 Patent a small molecule. In some embodiments, the test compound is a small molecule that modulates, may modulate, or is suspected of modulating a connexin hemichannel (e.g., a connexin 43 hemichannel). In some embodiments, the test compound is a small molecule that modulates, may modulate, or is suspected of modulating an inflammasome or inflammasome activity or activation (e.g., an NLRP3 inflammasome inhibitor or NLRP3 inflammasome activity or activation). In some embodiments, the test compound may be a small molecule that modulates, may modulate, or is suspected of modulating release of ATP from a pannexin channel (e.g., a pannexin 1 channel). In some embodiments the cells or cell preparation are human. In some embodiments the cells or cell preparation are rodent. In some embodiments the cells or cell preparation are from a non-human primate.
[0075] In some embodiments, a test compound is administered in a high dose. In some embodiments, a test compound is administered a cell isolated from a patient having a disease, disorder or condition. In some embodiments, the test compound is administered to a stem cell, e.g., an iPS cell. In some embodiments, the test compound is administered to a stem cell, e.g., an iPS, cell derived from a patient (e.g., a patient’s skin or other tissue). In some embodiments, the cell is an isolated human cell. In some embodiments, the cell is derived from a patient’s skin or other tissue. In some embodiments, the isolated human cell is derived from a patient’s bone marrow. In some embodiments, the cell is an isolated human cell and is derived from a patient’s blood.
[0076] In some embodiments, the cell used to contact a test compound or other candidate compound or agent is an isolated human cell that is derived from a patient having a post-acute infection syndrome (e.g., a post-acute infection syndrome referenced or described herein). In some embodiments, the patient is suspected of having post-acute infection syndrome. In some embodiments, the patient has symptoms of a post-acute infection syndrome. In some embodiments, the patient is diagnosed as having a post-acute infection syndrome.
[0077] In some embodiments of this test / screening method, tonabersat, Peptide5 or XG19 is used as a positive control.
[0078] In some embodiments, the invention provides methods for treating a subject or patient for a post-acute infection syndrome (actively or prophylactically or for maintenance) comprising administering to the subject or patient an effective amount of at least one connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or at least one inflammasome modulator (e.g., an NLRP3 inflammasome modulator). Administration to the subject or patient of an effective amount of a connexin hemichannel modulator and / or an inflammasome modulator or pannexin channel modulator lessens, slows, halts, or substantiallyE3697-00624 Patent halts one or more signs or symptoms of a post-acute infection syndrome in the subject or patient.
[0079] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome has one or more of fatigue, brain fog, trouble concentrating, peripheral neuropathy, muscle pain and / or joint pain that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator).
[0080] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome has one or more of fatigue, brain fog, trouble concentrating, peripheral neuropathy, muscle pain and / or joint pain that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator).
[0081] In some embodiments, the uses, methods, doses, dose regimens, compositions and kits prevent, alleviate and / or reverse the presence of one or more elevated autoimmune markers. Autoimmune markers include, for example, those selected from the group consisting of elevated C-reactive protein (CRP), antinuclear antibodies (ANA), antinuclear ribonucleoprotein (anti-RNP) antibodies, anti-dsDNA antibodies, and erythrocyte sedimentation rate (ESR), amongst others.
[0082] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a brain or neurological sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the brain or neurological sign or symptom is selected from the group consisting of brain fog, peripheral neuropathies (pins & needles / numbness any body part), dizziness, confusion, hallucinations, loss of smell and / or taste, phantom smells and / or taste, tinnitus (ringing in ears), internal vibrations / tremors, speech issues / stutter, stroke, seizures, and headaches.E3697-00624 Patent
[0083] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising an ocular sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the ocular sign or symptom is selected from the group consisting of eye pain, burning eye pain, feeling of sand / glass in eyes, eye redness, vision changes, visual disturbances / floaters.
[0084] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a breathing or respiratory sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the breathing or respiratory sign or symptom is selected from the group consisting of shortness of breath, cough, post exertional malaise (tired after minor exertion), and fatigue or extreme fatigue / exhaustion without exertion.
[0085] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a digestive or gastrointestinal sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the digestive or gastrointestinal sign or symptom is selected from the group consisting of nausea, vomiting, diarrhea, bloating, and early satiety (feeling full after eating small amounts of food).
[0086] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a cardiovascular sign or symptom that is / are lessened, slowed, halted, substantiallyE3697-00624 Patent halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the cardiovascular sign or symptom is selected from the group consisting of heart arrythmias, tachycardia, bradycardia and chest pain.
[0087] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a musculoskeletal sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the musculoskeletal sign or symptom is selected from the group consisting of joint pain, muscle pain and bone pain.
[0088] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a dermatological sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the dermatological sign or symptom is selected from the group consisting of skin rashes and hair loss.
[0089] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder comprising a mental health sign or symptom that is / are lessened, slowed, halted, substantially halted, alleviated or improved by administration of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) and / or an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) or pannexin channel modulator (e.g., a Panx 1 channel modulator). In some embodiments, the mental health sign or symptom is selected from the group consisting of anxiety and depression.
[0090] In some embodiments, the subject or patient having or suspected of having a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme diseaseE3697-00624 Patent syndrome, etc.) has one or more signs or symptoms of a post-acute infection disorder selected from the group consisting of flushing of the face, facial paralysis, ptosis, bruising, cold hands and / or feet, heat and / or cold intolerance, feeling of fever without having one, and mottling of hands and / or feet.
[0091] In some embodiments of the methods of the invention, the inflammasome modulator is a direct inflammasome modulator. In some embodiments of the methods of the invention, the inflammasome modulator is an indirect inflammasome modulator. In some embodiments of the methods of the invention, the inflammasome modulator is an NLRP3 inflammasome modulator. In some embodiments of the methods of the invention, the inflammasome modulator is a connexin hemichannel modulator. In some embodiments of the methods of the invention, the NLRP3 inflammasome modulator is a connexin 43 hemichannel modulator.
[0092] In some embodiments of the methods of the invention, the connexin hemichannel modulator is a compound according to Formula I. In some embodiments of the methods of the invention, the connexin hemichannel modulator is a compound according to Formula II. In some embodiments of the methods of the invention, the connexin hemichannel modulator is tonabersat or carabersat. In some embodiments of the methods of the invention, the connexin hemichannel modulator is tonabersat prodrug or a carabersat prodrug. In some embodiments of the methods of the invention, the connexin hemichannel modulator is connexin peptidomimetic. In some embodiments, the peptidomimetic connexin hemichannel modulator is a connexin 43 peptidomimetic. In some embodiments, the peptidomimetic connexin hemichannel modulator is XG19, Peptide5, Gap19, Gap20, Gap22, or any of the alpha CT peptides. In some embodiments, the peptidomimetic connexin hemichannel modulator is another peptidomimetic connexin hemichannel modulator described herein or known in the art. In some embodiments of the methods of the invention, the connexin hemichannel modulator is connexin antisense compound. In some embodiments, the connexin antisense compound is SEQ ID NO:1. In some embodiments, the connexin antisense compound is another connexin antisense compound described herein or known in the art. In some embodiments the connexin hemichannel modulator is a connexin binding compound (e.g., an antibody, antibody fragment, ScFv, etc.)
[0093] In some embodiments of the methods of the invention, the inflammasome modulator is a pannexin channel modulator. In some embodiments, the pannexin channel modulator is an NLRP3 inflammasome modulator. In some embodiments, the pannexin channel modulator is a pannexin 1 channel modulator. In some embodiments, the pannexinE3697-00624 Patent channel modulator compound is a compound according to Formula III. In some embodiments, the pannexin channel modulator compound is probenecid. In some embodiments of the methods described herein, an effective amount of a pharmaceutical composition comprising an agent that decreases pannexin channel activity (e.g., pannexin 1 channel activity including release of ATP) is administered to a cell, subject or patient.
[0094] In some embodiments of the methods of the invention, a therapeutically or prophylactically effective amount of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator), an inflammasome modulator (e.g., an NLRP3 inflammasome modulator), and / or a pannexin channel 1 modulator (e.g., a pannexin channel modulator) is / are administered to a subject or patient to protect against the occurrence of one or more signs and / or symptoms, or an increase one or more signs and / or symptoms, of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.).
[0095] In some embodiments of the methods of the invention, a therapeutically or prophylactically effective amount of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator), an inflammasome modulator (e.g., an NLRP3 inflammasome modulator), and / or a pannexin channel 1 modulator (e.g., a pannexin channel modulator) is / are administered to a subject or patient at least once per day.
[0096] In some embodiments of the methods of the invention, a therapeutically or prophylactically effective amount of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator), an inflammasome modulator (e.g., an NLRP3 inflammasome modulator), and / or a pannexin channel 1 modulator (e.g., a pannexin channel modulator) is / are administered orally, topically, or parenterally to a subject or patient.
[0097] In some embodiments of the methods of the invention, a therapeutically or prophylactically effective amount of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator), an inflammasome modulator (e.g., an NLRP3 inflammasome modulator), and / or a pannexin channel 1 modulator (e.g., a pannexin channel modulator) is / are administered orally, topically, or parenterally to a subject or patient.
[0098] In some embodiments of the methods of the invention, about 80 to about 400 milligrams per day of a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator), is administered to a subject or patient. In some embodiments, the connexin hemichannel modulator is administered in single or divided doses that are administered one or more times per day or per week. In some embodiments, the connexin hemichannel modulator is a compound according to Formula I. In some embodiments, connexin hemichannel modulator is tonabersat. In some embodiments, connexin hemichannel modulator is aE3697-00624 Patent tonabersat prodrug. In some embodiments, the tonabersat prodrug is a compound according to Formula II. In other embodiments of the methods of the invention, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator), such as, for example, a compound according to Formula I (e.g., tonabersat or carabersat) or a compound according to Formula II is administered to a subject in need thereof in amounts including at least about 40 milligrams per dose, at least about 50 milligrams per dose, at least about 60 milligrams per dose, at least about 70 milligrams per dose, at least about 80 milligrams per dose, at least about 90 milligrams per dose, at least about 100 milligrams per dose, from about 40 to about 400 or about 500 milligrams per dose. In some embodiments, the connexin hemichannel modulator dose is administered in single or divided doses and the dose may be administered from 1-4 times daily, 1-4 times every other day, 1-4 times every third day, 1-4 times twice a week or 1-4 times once per week. Antisense and peptidomimetic connexin hemichannel modulator doses include these doses and others described herein.
[0099] In some embodiments, at least about 40 milligrams of tonabersat is administered to a subject or patient. In some embodiments, at least about 80 milligrams of tonabersat, or another compound according to Formula I or according to Formula II, is administered to a subject or patient. In some embodiments, at least about 100 to about 400 milligrams per day of tonabersat, or another compound according to Formula I or according to Formula II, is administered to a subject or patient.
[0100] In some embodiments of the methods of the invention, about 25to about 600 milligrams per day of an inflammasome modulator (e.g., an NLRP3 inflammasome modulator) is administered to a subject or patient.
[0101] In some embodiments of the methods of the invention, about 40 to about 500 milligrams per day of a pannexin channel 1 modulator (e.g., a pannexin channel modulator) is administered to a subject or patient.
[0102] In some embodiments of the methods of the invention, the subject or patient is a human subject or a human patient. DETAILED INVENTION DISCLOSURES
[0103] Post-acute infection syndrome refers to chronic diseases that occur after an acute viral, bacterial or parasitic infection. While not new, the syndrome’s prevalence is significantly growing as a result of the COVID-19 pandemic, in which as many as 10% of infections have led to Long COVID, leaving individuals with lingering, often debilitatingE3697-00624 Patent symptoms. Some researchers estimate that 75 million people globally are suffering with the disease, and as new infections continue to arise daily.
[0104] The inventions described in this patent relate to compounds and compositions for treating and / or preventing post-acute infection syndromes, including long-term sequalae of coronavirus infection and signs and symptoms of long-haul effects resulting from other infections, including but not limited to infections by viruses that cause the “flu” (e.g., Haemophilus influenzae and other influenza viruses including the influenza A or B virus and the parainfluenza virus including parainfluenza virus Type 1, Type 2 and Type 3), microbial infections that cause the common “cold” (e.g., rhinoviruses), infections causing pneumonia (e.g., Chlamydia pneumoniae, Streptococcus pneumoniae, Mycoplasma pneumoniae, and others), infections causing the common “cold” (e.g., rhinoviruses), and infections caused by respiratory syncytial viruses, adenoviruses, enteroviruses, and bacteria such as Moraxella catarrhalis (also known as Neisseria catarrhalis and Branhamella catarrhalis) and others which can also cause pneumonia and middle ear infections, sinus infections, bronchitis, and COPD (a group of lung diseases that can worsen over time and include chronic bronchitis, emphysema, and refractory asthma), for example, as well as the bacterium Borrelia burdorferi (and, more rarely, Borrelia mayonii) which causes Lyme disease and can lead to post-treatment Lyme disease syndrome. About ten percent of the Lyme disease patients have prolonged subjective symptoms of fatigue, cognitive impairment, and / or musculoskeletal pain after antibiotic therapy and are referred to as post-treatment Lyme disease syndrome (PTLDS). The underlying causes, treatment, and epidemiology of PTLDS have remained elusive. Myalgic encephalomyelitis / chronic fatigue syndrome (ME / CFS) is a neuroinflammatory, neuroimmune illness most commonly triggered by infection, such as Epstein-Barr virus, and is a post- infection syndrome, the signs and symptoms of which may be treated as described herein using the compounds and compositions described and referenced here in. Some ME / CFS patients have reported other triggers as well, such as physical accidents and environmental exposures, and they may also be treted as described herein. Post-acute infection syndromes may be diagnosed as described in the art. The signs and symptoms of post-acute infection syndromes are well known.
[0105] Many post-acute infection syndromes have been called “fatigue syndromes,” although this term is likely too narrow to encompass the more complex clinical picture typically seen in such disorders. Although the clinical presentation of a post-acute infection syndrome is heterogeneous, often including long and varied symptom lists, there is significant overlap, and several characteristic symptom clusters can be identified as a common denominator. The primeE3697-00624 Patent manifestations include an overall poor functional status, exertion intolerance, debilitating fatigue, and unrefreshing sleep. Other characteristic features include neurocognitive and sensory impairments, dysautonomia, musculoskeletal complaints, flu-like symptoms, and other feelings of illness. Irritability, mood swings, and signs of depression, as well as a wide range of other nonspecific neurological and immunological symptoms (Box 2), are frequently present.
[0106] The terms post-infectious fatigue syndrome and post-viral fatigue syndrome are sometimes used to describe debilitating fatigue following an infection, often accompanied by other signs and symptoms. Post-infectious and post-viral fatigue syndromes were originally postulated as subsets of ‘chronic fatigue syndrome,’ in which the triggering infectious agent is objectively documented67. However, there appears to be no clear consensus at present about the distinctions across these concepts. It is thus unclear whether these terms should be considered synonymous to the ME / CFS label, any of its subsets, or include a wider range of post-infectious fatigue conditions.
[0107] Long-haul effects of infections in an organism carry significant risks of disability and disease. Some show a greater risk across multiple organ systems (e.g., COVID) while others which may be more limited, for example those with ongoing health risks found mostly in the respiratory system (e.g., influenza).
[0108] Long COVID or post-COVID-19 syndrome first gained widespread recognition among social support groups and later in the scientific and medical communities. This illness is understood to affect COVID-19 survivors at all levels of disease severity, even younger adults, children, and those not hospitalized. See, e.g., Yong SJ. Long COVID or post-COVID- 19 syndrome: putative pathophysiology, risk factors, and treatments. Infect Dis (Lond). 53(10):737-754 (2021).
[0109] While a precise definition of long COVID was initially lacking, the World Health Organization now defines long COVID as “the continuation or development of new symptom 3 months after the initial SARS-CoV-2 infection, with these symptoms lasting for a least 2 months with no other explanation.” See also Thaweethai T, et al. Development of a Definition of Postacute Sequelae of SARS-CoV-2 Infection. JAMA 329(22):1934-1946 (2023). The most common symptoms reported in many studies are fatigue, brain fog and dyspnea that last for months after acute COVID-19. Other persistent symptoms may include other chest and joint pains, palpitations, myalgia, smell and taste dysfunctions, cough, headache, and gastrointestinal and cardiac issues. See Davis, HE, et al., Characterizing longE3697-00624 Patent COVID in an international cohort: 7 months of symptoms and their impact EClincialMedicine 38:101019 (2021).
[0110] Presently, there is limited literature discussing the possible pathophysiology, risk factors, and treatments in long COVID. In brief, long COVID may be driven by long-term tissue damage (e.g. lung, brain, and heart) and pathological inflammation (e.g. from viral persistence, immune dysregulation, and autoimmunity).
[0111] A recent study comparing the viruses that cause COVID-19 and the flu revealed that in the 18 months after infection, patients hospitalized for either COVID-19 or seasonal influenza faced an increased risk of death, hospital readmission, and health problems in many organ systems. Xie, Y, et al., Long-term outcomes following hospital admission for COVID- 19 versus seasonal influenza: a cohort study Lancet Infect Dis 24: 239-255 (2024).
[0112] Post-acute infection syndrome encompasses chronic illnesses that occur after an infection from a virus, bacteria, or parasite. This includes prolonged symptoms after COVID, caused by the SARS-CoV-2 virus, as well as other infections caused by viruses, bacteria, or parasites, or Lyme disease, which is caused by certain types of bacteria. Scientists believe there may be many causes of ME / CFS, including various viral infections. Additionally, long COVID and other post-acute infection syndromes can evolve into ME / CFS. The exact percentages of people who suffer long-term consequences from different infections are not known, but it happens after different viral infections, and also with bacterial infections like Lyme disease.
[0113] There is an unmet need to address post-acute infection syndromes and to identify effective modulators of post-acute infection syndromes and their symptoms.
[0114] The inventions described in this patent relate to compounds and compositions for treating and / or preventing post-acute infection syndromes, including long-term sequalae of coronavirus infection and signs and symptoms of long-haul effects resulting from other infections, including but not limited to infections from coronaviruses. Coronaviruses are named for the crown-like spikes on their surface. There are four main sub-groupings of coronaviruses, known as alpha, beta, gamma, and delta. Human coronaviruses were first identified in the mid- 1960s. The seven coronaviruses that can infect people are currently known to include: 229E (alpha coronavirus); NL63 (alpha coronavirus); OC43 (beta coronavirus); and HKU1 (beta coronavirus). Other human coronaviruses include: MERS-CoV (the beta coronavirus that causes Middle East Respiratory Syndrome, or MERS); SARS-CoV (the beta coronavirus that causes severe acute respiratory syndrome, or SARS); and SARS-CoV-2 (the novel coronavirus that causes coronavirus disease, or COVID-19).E3697-00624 Patent
[0115] The present specification relates in part to compounds, compositions and methods having effects of treating one or more signs and / or symptoms of a post-acute infection syndrome. In some embodiments, the post-acute infection syndrome is long COVID. In some embodiments, the post-acute infection syndrome is long flu. In some embodiments, the post- acute infection syndrome is long cold. In some embodiments, the post-acute infection syndrome is post-treatment Lyme disease syndrome. In some embodiments, the post-acute infection syndrome is ME / CFS or another post-acute infection syndrome as described her or otherwise known in the art.
[0116] In some embodiments, the compounds, compositions and methods comprise at least one connexin hemichannel modulator. In some embodiments, the at least one connexin hemichannel modulator is a connexin 43 connexin hemichannel modulator.
[0117] In some embodiments, the compounds, compositions and methods comprise at least one inflammasome modulator. In some embodiments, the at least one inflammasome modulator is an NLRP3 inflammasome modulator.
[0118] The present specification relates in part to compounds, compositions and methods useful for treating one or more signs and / or symptoms of a post-acute infection syndrome. The present specification relates in part to compounds, compositions and methods useful for protecting against, alleviating, reducing or reversing, in whole or in part, one or more signs and / or symptoms of a post-acute infection syndrome. In some embodiments, the one or more signs and / or symptoms comprises fatigue. In some embodiments, the one or more signs and / or symptoms comprises brain fog. In some embodiments, the one or more signs and / or symptoms comprises another sign or symptom of a post-acute infection syndrome as described here and are known in the art, e.g. neuropathy, paresthesia, polyarthralgia, etc.
[0119] The present specification relates in part to compounds, to compositions containing such compounds, and methods of using the compounds and compositions for treating, preventing, alleviating and ameliorating a post-treatment disorder that is caused, in whole or in part by an infection, and symptoms thereof.
[0120] The present disclosure also provides, among other things, methods of screening for or quantifying the activity of connexin hemichannel modulating agents (e.g., connexin 43 hemichannel modulating agents) that can be used to treat a post-acute infection syndrome. In some embodiments, the inventions include methods of screening for or quantifying the activity of connexin hemichannel modulating agents (e.g., connexin 43 hemichannel modulating agents) that can be used to protect against one or more signs and / or symptoms of a post-acute infection syndrome.E3697-00624 Patent
[0121] The present disclosure also provides, among other things, methods of screening for or quantifying the activity of inflammasome modulating agents (e.g., NLRP3 inflammasome modulating agents) that can be used to treat a post-acute infection syndrome. In some embodiments, the inventions include methods of screening for or quantifying the activity of inflammasome modulating agents (e.g., NLRP3 inflammasome modulating agents) that can be used to protect against one or more signs and / or symptoms of a post-acute infection syndrome.
[0122] The present disclosure also provides methods of determining the efficacy of a connexin hemichannel modulating agent (e.g., a connexin 43 hemichannel modulating agent) to treat one or more signs or symptoms of a post-acute infection syndrome. The present disclosure also provides methods of providing a therapeutic (or higher) loading dose of a connexin hemichannel modulating agent (e.g., a connexin 43 hemichannel modulating agent) followed by lower maintenance dose to treat or prevent one or more signs and / or symptoms of a post-acute infection syndrome.
[0123] The present disclosure also provides methods of determining the efficacy of an inflammasome modulating agents (e.g., an NLRP3 inflammasome modulating agent) to treat one or more signs and / or symptoms of a post-acute infection syndrome. The present disclosure also provides methods of providing a therapeutic (or higher) loading dose of an inflammasome modulating agents (e.g., an NLRP3 inflammasome modulating agent) followed by lower maintenance dose to treat or prevent one or more signs and / or symptoms of a post-acute infection syndrome.
[0124] According to one aspect to the present invention, the compounds and compositions described herein decrease connexin hemichannel opening (e.g., connexin 43 hemichannel opening) to treat one or more signs or symptoms of a post-acute infection syndrome.
[0125] According to another aspect to the present invention, the compounds and compositions described herein decrease inflammasome activity (e.g., NLRP3 inflammasome activity) to treat one or more signs and / or symptoms of a post-acute infection syndrome.
[0126] In another aspect this invention relates to pharmaceutical compositions, articles of manufacture, kits and methods for treating a subject having (or at risk for having) a post- acute infection syndrome by administering a therapeutically effective amount of at least one connexin modulator (e.g., at least one connexin 43 modulator) to a subject or patient. In some embodiments, the agent is administered using a dose and / or dosing regimen described herein. In some embodiments, the agent is administered using another dose and / or dosing regimen. InE3697-00624 Patent some embodiments, one or more signs and / or symptoms of a post-acute infection syndrome is treated.
[0127] In another aspect this invention relates to pharmaceutical compositions, articles of manufacture, kits and methods for treating a subject having (or at risk for having) a post- acute infection syndrome by administering a therapeutically effective amount of at least one inflammasome modulating agent (e.g., at least one NLRP3 inflammasome modulating agent) to a subject or patient. In some embodiments, the agent is administered using a dose and / or dosing regimen described herein. In some embodiments, the agent is administered using another dose and / or dosing regimen. In some embodiments, one or more signs and / or symptoms of a post-acute infection syndrome is treated.
[0128] In one embodiment, a composition or compositions comprising a connexin modulator (e.g., a connexin 43 modulator) or an inflammasome modulator (e.g., an NLRP3 inflammasome inhibitor) or both is / are applied topically, systemically, etc., to a subject.
[0129] In some embodiments, the connexin modulator is a modulator of Cx26, Cx30, Cx31.1, Cx36, Cx37, Cx40, Cx43, Cx45, Cx50, Cx57 or any other connexin in the eye or blood vessels.
[0130] In some embodiments, the connexin modulator is a modulator of Cx26, Cx30, Cx30.3, Cx31, Cx31.1, Cx32, Cx43, Cx45, Cx50, and Cx58, or any other connexin in the epithelium. In some embodiments, the connexin modulator is a Cx43 connexin modulator, for example, a Cx43 expression modulator (e.g., an anti-Cx43 antisense), a Cx43 gap junction modulator or a Cx43 hemichannel modulator (e.g. an anti-connexin 43 peptidomimetic or a small molecule). In some embodiments, the modulator is a modified or unmodified antisense polynucleotide or peptidomimetic, e.g. a modified or unmodified Cx43 antisense polynucleotide or Cx43 peptidomimetic, or other corneal epithelial, endothelial or vascular connexin. In some embodiments, the modulator can include or exclude any of the foregoing connexins.
[0131] In some embodiments, the connexin hemichannel modulator administered daily, weekly, or monthly to a subject. In some embodiments, a therapeutically effective amount of tonabersat is administered.
[0132] In some embodiments, the inflammasome modulator (e.g., NLRP3 inflammasome inhibitor) is administered daily, weekly, or monthly to a subject. In some embodiments, a therapeutically effective amount of tonabersat is administered.
[0133] In some embodiments, the amount of a connexin modulator administered to a subject with one or more signs and / or symptoms of a post-acute infection disorder is one orE3697-00624 Patent more of the particular dose amounts described herein, including, for example, milligram per milliliter (mg / mL) connexin modulator dosing (e.g., a composition comprising or consisting essentially of about or at least about 1-100 mg / mL or more of a connexin hemichannel modulator), micromolar (µM) connexin modulator dosing (e.g., a composition comprising or consisting essentially of a concentration of about or at least about 100-500 µM or more of a connexin modulator), milligram (mg) connexin modulator dosing (e.g., a composition comprising or consisting essentially of about or at least about 40 to 160 mg or more of a connexin modulator), and so on, etc.
[0134] In some embodiments, the connexin hemichannel modulator comprises an orally available small molecule connexin hemichannel modulator (e.g., tonabersat, carabersat, or another small molecule connexin hemichannel modulator according to Formula I). See the Examples herein describing the use of an exemplary connexin hemichannel modulator (tonabersat). In some embodiments, the connexin hemichannel modulator is a prodrug of tonabersat (e.g., a tonabersat prodrug according to Formula II).
[0135] In some embodiments, the connexin modulator comprises a connexin peptidomimetic (e.g., a connexin 43 peptidomimetic). In some embodiments, the connexin peptidomimetic binds to an intracellular portion of a connexin (e.g. XG19). In some embodiments, the connexin peptidomimetic binds to an extracellular portion of a connexin (e.g. Peptide 5). Various connexin peptidomimetics, including connexin43 peptidomimetics, and methods of making them are known in the art.
[0136] In some embodiments, the connexin modulator comprises an antisense molecule (e.g., a connexin43 antisense oligonucleotide). In some embodiments, the connexin 43 antisense polynucleotide comprising, consisting essentially of, or consisting of a sequence according to SEQ ID NOS:1-3, SEQ ID NOS:4-16 and / or modified versions thereof. In some embodiments, the antisense oligonucleotide comprises, consists essentially of, or consists of 5'-GTA ATT GCG GCA AGA AGA ATT GTT TCT GTC-3' (SEQ ID NO:1). In some embodiments, the antisense oligonucleotide may be chemically modified or may be an unmodified oligonucleotide, e.g. a modified or an unmodified DNA oligonucleotide. In some embodiments, oligonucleotides are modified by changing onr or more of the phosphodiester linkages, the ribose backbone and / or the nucleobase. Other modifications are described herein. Other modifications are known in the art and described in various publications, including, for example, in Shen, X. and Corey, DR, Chemistry, mechanism and clinical status of antisense oligonucleotides and duplex RNAs, Nuelic Acids Res.2018 Feb 28; 46(4): 1584–1600. MethodsE3697-00624 Patent of their manufacture are also known in the art. See, e.g., Abramova T, Frontiers and Approaches to Chemical Synthesis of Oligodeoxyribonucleotides, Molecules 2013 Jan; 18(1): 1063–1075; Hao M, et al., Current and Emerging Methods for the Synthesis of Single-Stranded DNA Genes (Basel) 2020 Jan 21;11(2):116. See also Anwar, S., et al. Enhancing the Effectiveness of Oligonucleotide Therapeutics Using Cell-Penetrating Peptide Conjugation, Chemical Modification, and Carrier-Based Delivery Strate and Carrier-Based Delivery Strategies. Pharmaceutics 2023, 15, 1130.
[0137] In some embodiments, a subject or patient is treated with a composition comprising or consisting essentially of 1-50 mg / mL SEQ ID NO:1. In some embodiments, the non-healing surface defect or disorder in a subject is treated with a composition comprising or consisting essentially of about 1-100 mg of SEQ ID NO:1 in the regimens described herein. In some embodiments, administration is to a cell, to a tissue or to an organ. In some embodiments, administration is to the brain. In some embodiments, administration is to the eye. In some embodiments, administration is to the skin. In some embodiments, the connexin modulator administered to a subject or patient (including in one or more amounts described herein) is a small molecule connexin hemichannel modulator (e.g., tonabersat, carabersat, or another small molecule connexin hemichannel modulator according to Formula I). In some embodiments, the connexin hemichannel modulator is a prodrug of tonabersat (e.g., a tonabersat prodrug according to Formula II). In some embodiments, the connexin modulator administered to a subject or patient (including in one or more amounts described herein) is a connexin antisense molecule. In some embodiments, the connexin modulator administered to a subject or patient (including in one or more amounts described herein) is a connexin peptidomimetic (e.g. XG19, Peptide 5, etc.).
[0138] In some embodiments, the therapeutically effective amount of the modulator, e.g. connexin modulator, for example a connexin 43 modulator, connexin 43 gap junction modulator and / or connexin 43 hemichannel modulator, which is effective in methods of the invention, comprises a composition that is about, or at least about, 10 micromolar (10 µM), 15 micromolar (15 µM), or 20 micromolar (20 µM), of a connexin modulator (e.g. SEQ ID NO:1), or any amount within or between any two of these recited dosages. Other effective doses that are effective in methods of the invention for the treatment of ocular surface defects or disorders (e.g. ocular PEDs and PCEDs) include about, or at least about, a composition comprising 30 micromolar (30 µM) or 40 micromolar (40 µM) of a connexin modulator, for example, a connexin 43 modulator, a connexin 43 gap junction modulator and / or a connexin 43E3697-00624 Patent hemichannel modulator (e.g. SEQ ID NO:1). In some embodiments, the therapeutically effective amount of the connexin modulator administered as described is a connexin antisense molecule other than (or in addition to) SEQ ID NO:1. In some embodiments, the therapeutically effective amount of the connexin modulator administered as described is a connexin peptidomimetic (e.g. XG19). In some embodiments, the therapeutically effective amount of the connexin modulator as described is a connexin hemichannel blocker (e.g. tonabersat).
[0139] In some embodiments of these doses and dosing regimens and methods, the connexin modulator dose administered comprises another connexin antisense or modulator, e.g., another Cx43 antisense or Cx43 modulator other than or in addition to SEQ ID NO:1, or a modulator of another ocular or corneal epithelial connexin other than or in addition to Cx43.
[0140] In some embodiments, the modulator is a small molecule connexin hemichannel antagonist. In some embodiments, the modulator is a small molecule connexin hemichannel antagonist and comprises a compound according to Formula I, which includes tonabersat. Tonabersat, a benzoylamino benzopyran, is a modulator of connexin hemichannel activity, including connexin 43 hemichannels. Tonabersat can block or inhibit the opening of or release of molecules into the extracellular space from hemichannels comprising connexin 43.
[0141] In some embodiments, the modulator is a connexin peptidomimetic. Connexin modulators including Peptide5 inhibit Cx43 hemichannel activity and / or ATP release during and following injury. Other connexin modulator peptidomimetics include Gap19 and XG19, and analogues thereof.
[0142] The instant inventions provide, inter alia, (1) methods for treating, preventing or ameliorating one or more signs or symptoms of a post-acute infection disorder in a subject or a patient by administration of a therapeutically effective amount of one or more of a connexin hemichannel modulator (e.g., a connexin 43 expression modulator, a connexin 43 gap junction modulator, a connexin 43 hemichannel modulator, etc.) and an inflammasome modulator (e.g. an NLRP3 inflammasome modulator) in a dose regimen described herein; (2) methods for treating, preventing or ameliorating one or more signs or symptoms of a post-acute infection disorder in a subject or a patient (e.g. a long COVID patient, for example, or another long hauler) by administration of a connexin modulator and / or an inflammasome modulator at doses described herein (e.g. in any of the dosing regimens described herein; and (3) the use of such modulators, including, for example, anti-connexin and / or anti-inflammasome antisense modulators, peptidomimetic modulators and small molecule modulators, in the manufacture of a medicament (e.g. a pharmaceutical composition), and kits containing said medicaments that include or are associated with instructions for use in a method of the invention.E3697-00624 Patent
[0143] In some embodiments, instant inventions provide, inter alia, (1) methods for treating one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) in a subject or a patient by administration of a therapeutically effective amount of at least one connexin modulator (e.g., a connexin expression modulator, a connexin gap junction modulator and / or a connexin hemichannel modulator) and / or at least one inflammasome modulator in a dose regimen described herein to treat the disease, disorder or condition; (2) methods for treating one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post- treatment Lyme disease syndrome, etc.) in a subject or a patient by administration of the connexin modulator and / or inflammasome doses described herein (e.g. in any of the dosing regimens described herein); and (3) the use of such connexin modulators and / or inflammasome modulators, including, for example, small molecule modulators, peptidomimetic modulators and antisense modulators in the manufacture of a medicament (e.g. a pharmaceutical composition), and kits containing said medicaments that include or are associated with instructions for use in a method of the invention for treating one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.).
[0144] In some embodiments, the symptom to be treated is a long-hauler symptom resulting following treatment of an infection.
[0145] In some embodiments, one or more of the connexin modulators described or referenced herein are formulated with one more other therapeutically or prophylactically active agents for use in the methods and regimens described herein. In some embodiments, one or more of the inflammasome modulators described or referenced herein are formulated with one more other therapeutically or prophylactically active agents for use in the methods and regimens described herein. Definitions
[0146] Important inventions protected by issued patents are often copied by infringers. Those who defend accused patent infringers do so before judges and jurors who generally have little or no scientific background or technical knowledge, and will often try to avoid infringement by arguing that claims in a patent don’t mean what they say. They will argue about common words and accepted scientific or technical terms, no matter how well known or easily understood. They also hire “experts” who will testify that they do not understand well- known words or terms and assert that the patent doesn’t sufficiently “describe” an invention, or the meaning of the words used in a claim. No words or arguments are off-limits for accusedE3697-00624 Patent patent infringers. The below definitions are provided to hold off those who would take one or more of the inventions described and claimed herein, and then argue that the patent covering the invention they took should be held invalid because they allegedly don’t understand one or more the words it uses, or by seeking to alter the meaning of one or more words to try and avoid liability for infringement.
[0147] As used herein, the singular forms “a,” “an” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a “connexin hemichannel blocker” or an “inflammasome inhibitor” optionally includes a combination of two or more such molecules, and the like.
[0148] As used herein, the terms “about” and “approximately,” when used to modify a numeric value (e.g., “about 80 mg”) or one or more amounts specified in a range of numeric values (e.g., “about 80 mg to about 400 mg”), indicate the numeric value and functionally equivalent values, as well as reasonable deviations from the value known to or understood by those in the art, including persons of ordinary skill in the art or those skilled in the art. For example, values within ±10% or ±5% are within the intended meaning of a recited value. As such, “about 80 mg” is understood to encompass from “76 mg to 84 mg” or from “72 mg to 88 mg” as if written out each time. Thus, as used herein, the terms “about” and “approximately” intended to convey that similar values promote equivalent results or effects recited in the claims. That is, it is understood that amounts, sizes, formulations, parameters, and other quantities and characteristics are not and need not be exact, but can be approximate and / or larger or smaller, as desired, reflecting tolerances, conversion factors, rounding off, measurement error and the like, and other factors known to those of skill in the art. In general, an amount, size, formulation, parameter or other quantity or characteristic is “about” or “approximate” whether or not expressly stated to be such. It is understood that where “about” is used before a quantitative value, the parameter also includes the specific quantitative value itself, unless specifically stated otherwise. In other words, when ranges are expressed herein as from “about” one particular value, and / or to “about” another particular value, the range also includes from the one particular value and / or to the other particular value, including the variations noted above or understood in the art. For example, if the value “10” is disclosed, then “about 10” is also disclosed. It is also understood that each unit between two particular units are also disclosed. For example, if “10 to 15” (or “10-15”) is disclosed, then 11, 12, 13, and 14 are also specifically disclosed (even it not spelled out in writing), in addition to 10 and 15, as well as “about 11,” “about 12,” “about 13,” and “about 14.”E3697-00624 Patent
[0149] As used herein, the terms “administering” and “administration” refer to any method of providing a compound or composition to a subject. In some embodiments, the compound or composition is a pharmaceutical preparation. Such methods are well known to those skilled in the art and include, but are not limited to, oral administration, transdermal administration, administration by inhalation, nasal administration, topical administration, intravaginal administration, ophthalmic administration, intraaural administration, intradural administration, intracerebral administration, rectal administration, sublingual administration, buccal administration, and parenteral administration, including injectable such as intravenous administration, intra-arterial administration, intramuscular administration, and subcutaneous administration. Administration can be one-time, intermittent, or continuous. In some embodiments, a compound or composition of the invention is administered therapeutically, e.g., to treat an existing, diagnosed or suspected disease, disorder or condition. In some embodiments, a compound or composition of the invention is administered prophylactically, e.g., administered to prevent or inhibit progression of a disease, disorder or condition, or prevent the spread of a disease, disorder or condition.
[0150] As used herein, an “antisense compound,” also referred herein to as “antisense polynucleotides” or “antisense oligonucleotides” (also known as ASOs or AONs), means a compound comprising or consisting of an oligonucleotide, at least a portion of which is complementary to a target nucleic acid to which it is capable of hybridizing, thereby resulting in at least one antisense activity. As used herein, “antisense activity” means any detectable and / or measurable change attributable to hybridization of an antisense compound to its target nucleic acid. In certain embodiments, antisense activity comprises modulation of the amount or activity of a target nucleic acid transcript (e.g., mRNA). In certain embodiments, antisense activity comprises modulation of splicing of a precursor mRNA. Antisense compounds, and their design, manufacture and use are well known in the art. In some embodiments, they comprise single stranded pieces of DNA that match the complementary sequence of a specific mRNA (e.g., a connexin mRNA). In some embodiments, the antisense activity of an antisense compounds prevents or alters the production of a protein (e.g., pannexin 1). In some embodiments, the antisense compound is a connexin 43-directed antisense oligonucleotide. In some embodiments, the antisense compound is an NLRP3-directed antisense oligonucleotide. NLRP3-specific ASOs are known in the art. In some embodiments, the NLRP3-directed antisense oligonucleotide is directed to NLRP3 regions predicted to be in an open, as opposed to folded, conformation based, for example, on their minimum free energy prediction. See, e.g. Braatz, C, et al. (2023). NLRP3-directed antisense oligonucleotides reduce microglialE3697-00624 Patent immunoactivities in vitro. Journal of Neurochemistry, 2023 00:1- 15. https: / / doi.org / 10.1111 / jnc.15778. Kaufmann B, et al. Antisense Oligonucleotide Therapy Decreases IL-1β Expression and Prolongs Survival in Mutant Nlrp3 Mice. J Immunol. 2023 211(2):287-294. In some embodiments, the antisense compound is a pannexin 1-directed antisense oligonucleotide. In some embodiments, antisense polynucleotides or oligonucleotides comprise unmodified nucleotides. In some embodiments, antisense polynucleotides or oligonucleotides comprise one or more modified nucleotides. Many different chemical modifications are currently available. See, e.g., Crooke ST, et al. Antisense technology: an overview and prospectus. Nat Rev Drug Discov. 202120(6):427-453; Crooke ST, et al. Antisense technology: A review. J Biol Chem. 2021296:100416; Kuijper EC, et al. Opportunities and challenges for antisense oligonucleotide therapies. J Inherit Metab Dis.2021 44(1):72-87; Dhuri K, et al. Antisense Oligonucleotides: An Emerging Area in Drug Discovery and Development. J Clin Med. 20209(6):2004. Many articles, book chapters and books have been written that are devoted to all aspects of the design, manufacture and use of antisense technologies, as well as issued patents (see, e.g., US Patent No.9,382,540, issued July 5, 2016, for “Compositions and methods for modulating angiopoietin-like 3 expression), the detail of which are all well-known to those having even ordinary skill in the art and need not be detailed here.
[0151] As used herein, the term “connexin hemichannel modulator” (which may also be referred to herein as a connexin hemichannel, connexin, or hemichannel “inhibitor,” “blocker” or “antagonist”) is a compound that prevents, inhibits, and / or reduces the formation, function or activity of a connexin hemichannel. Connexin hemichannel modulators include chemical-based connexin hemichannel modulators (e.g. tonabersat, carabersat or other compounds within Formula I, or pro-drugs thereof, e.g. compounds of Formula II, which are prodrugs of tonabersat), peptide-based connexin hemichannel modulators (e.g. XG19, Peptide 5, aCT1 peptides, etc.), DNA- and RNA-based connexin hemichannel modulators (e.g. SEQ ID NO:1, etc.), antibody- and antibody fragment-based connexin hemichannel modulators (e.g. monoclonal antibodies, ScFvs, etc.). See, e.g., Willebrords J, et al. Inhibitors of connexin and pannexin channels as potential therapeutics. Pharmacol Ther. 2017 180:144-160. In some embodiments, the connexin hemichannel modulators are connexin 43 hemichannel modulators. Connexin hemichannels are normally closed to maintain cellular homeostasis, but can be activated in pathophysiological processes to serve as toxic membrane pores. For this reason, connexin hemichannels are sometimes considered as “pathological pores” (see Decrock E, et al., Connexin-related signaling in cell death: to live or let die? Cell Death Differ.16(4):524-36E3697-00624 Patent (2009), and the opening of connexin hemichannels facilitates the release of damage-associated molecular patterns (DAMPs), a class of endogenous molecules related to the pathogenesis of inflammatory diseases. In some embodiments, the connexin hemichannel modulator will block, inhibit or reduce the pathological opening of a connexin hemichannel (e.g., pathological opening a connexin 43 hemichannel). In some embodiments, pathological opening of a connexin hemichannel (e.g., pathological opening a connexin 43 hemichannel) results in the release of ATP into the extracellular space, which is blocked, inhibited or reduced by a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator).
[0152] Modulation of a function and / or activity of a connexin hemichannel includes, for example, the prevention, inhibition and / or reduction, in whole or in part, in the expression of a connexin protein, its trafficking and / or assembly as a hemichannel (e.g., a connexin 43 hemichannel). In some embodiments, modulation of a function and / or activity of a connexin hemichannel comprises modulating, blocking, reducing or inhibiting of the flow of molecules through a hemichannel (e.g., a connexin 43 hemichannel), such as ATP or DAMPs, for example. It includes, for example, the flow of molecules from the extracellular space or environment through a hemichannel (e.g., a connexin 43 hemichannel) into a cell, and / or the flow of molecules (e.g. adenosine triphosphate (ATP) or a DAMP) through a connexin hemichannel from the intracellular space or environment of a cell into the extracellular space or environment. Thus, by way of example, modulation may occur by one or more of: reducing, preventing, blocking, inhibiting or decreasing hemichannel formation; inducing or promoting closure of a hemichannel; reducing, preventing, blocking, inhibiting or decreasing hemichannel opening; reducing, preventing, blocking, inhibiting or decreasing hemichannel permeability; inducing coupling between hemichannels; triggering, inducing or promoting cellular internalization of a connexin hemichannel and / or gap junction. Words such as “blocking”, “inhibiting”, “preventing”, “decreasing” and “antagonizing”, and the like, may not be taken to imply complete reducing, blocking, inhibition, prevention, or antagonism. Similarly, “inducing” or “promoting” is not be understood to require complete induction or promotion of formation of a gap junction through hemichannel docking, inducing or promoting the complete closure of a hemichannel; completely preventing, blocking, inhibiting or decreasing hemichannel opening; completely preventing, blocking, inhibiting or decreasing hemichannel permeability; completely inducing coupling between hemichannels; or triggering, inducing or promoting the complete loss of coupling or the complete internalization of a connexin hemichannel and / or gap junction (or group of hemichannels and / or gap junctions) and should be taken to include the partial induction or promotion of any of them.E3697-00624 Patent
[0153] Modulation of a connexin hemichannel includes prevention, inhibition and / or reduction, in whole or in part, of pathological opening of a connexin hemichannel (e.g., pathological opening a connexin 43 hemichannel). In some embodiments, pathological opening of a connexin hemichannel (e.g., pathological opening a connexin 43 hemichannel) results in the release of ATP into the extracellular space.
[0154] Modulation of one or more functions or activities of a connexin hemichannel may occur by any means. Additionally, preventing, blocking, inhibiting and / or reducing a function or activity of a connexin hemichannel (e.g., a connexin 43 hemichannel) may be direct or indirect. Preventing, blocking, inhibiting and / or reducing connexin hemichannel function or activity includes, for example, directly blocking a connexin hemichannel, inducing a conformational change, and modifying a connexin phosphorylation state or its open-close probability. Open probability is a measure of the percentage of time a channel remains open versus being closed (reviewed in Goldberg G S, et al., Selective permeability of gap junction channels Biochimica et Biophysica Acta 20041662:96-101).
[0155] Modulation of a connexin hemichannel also includes suppressing the permeability of a connexin hemichannel (for example, lessening the flow of molecules through a connexin hemichannel, e.g., a connexin 43 hemichannel). In some embodiments, the molecule is adenosine triphosphate (ATP). Thus, in some embodiments, a “hemichannel blocker” is a compound that interferes with the passage of molecules through a connexin hemichannel. A hemichannel blocker can block or decrease hemichannel opening, block, decrease or suppress hemichannel opening, block or reduce the release of molecules through a hemichannel to an extracellular space, and / or block or reduce the entry of molecules through a hemichannel into an intracellular space. Hemichannel blockers include compounds that fully or partially block hemichannel leak or the passage of molecules through a hemichannel (e.g. to or from an extracellular space). Hemichannel blockers also include compounds that decrease the open probability of a hemichannel. Examples of hemichannel blockers include peptides, peptidomimetics, small molecules, antibodies and antibody fragments. Hemichannel blockers include hemichannel modulators and may interfere directly or indirectly with the passage of molecules through a connexin hemichannel, or with the permeability of a connexin hemichannel (e.g., a connexin 43 hemichannel).
[0156] The modulator may be of any chemical nature. As noted, by way of example, the connexin hemichannel modulator may be a nucleic acid (including antisense molecules, RNAi molecules, morpholinos, and other nucleic acids as described herein or known in the art), a peptide or peptidomimetic, or a small molecule or other chemical. Connexin modulatorsE3697-00624 Patent include connexin expression modulators, connexin gap junction modulators and connexin hemichannel modulators, including connexin gap junction modulators that can modulate a connexin hemichannel. In some embodiments, connexin expression modulators, connexin gap junction modulators and / or connexin hemichannel modulators are compounds can modulate – i.e., inhibit, block, prevent, reduce or antagonize, in whole or in part, the function, activity, expression, trafficking and / or assembly of – a connexin 43 hemichannel. However, as stated, the words “inhibit” or “block” or “antagonize” or “modulate” or “prevent” shall not be taken to imply that the function, activity, expression, trafficking and / or assembly of a connexin, a connexin hemichannel (e.g. a connexin 43 hemichannel) or gap junction (e.g. a connexin 43 gap junction) is completely inhibited or blocked or wholly antagonized or modulated or prevented, but should be understood to include any reduction or inhibition in the function, activity, expression, trafficking and / or assembly of a connexin (including its transcription, translation and / or expression), a connexin hemichannel (including its permeability or its opening, or release of ATP, to the extracellular environment) or gap junction (including its opening to an adjacent cell, or creation from hemichannels in adjacent cells).
[0157] Hemichannels and gap junction channels may be present in cells of any type. The modulation of connexins, hemichannels and gap junctions may be in cells of any type. Accordingly, reference to a “connexin,” “hemichannel” or “gap junction” should be taken to include reference to a connexin, a hemichannel or gap junction present in any cell type, unless the context requires otherwise. In some embodiments, the connexin, hemichannel or gap junction is present in an epithelial cell. In some embodiments, the connexin, hemichannel or gap junction is present in an endothelial cell. In some embodiments, the connexin, hemichannel or gap junction is a vascular connexin, hemichannel or gap junction. In some embodiments, the connexin, hemichannel or gap junction is a connexin, hemichannel or gap junction found in vascular endothelial cells and / or vascular smooth muscle cells. In some embodiments, the connexin, hemichannel or gap junction is present in a brain cell, a retinal cell and / or in other cells noted herein or that are targeted in carrying out a method of the invention.
[0158] In some embodiments, the connexin modulator may be a modulator of a connexin hemichannel present in blood vessels, for example, a connexin 43 hemichannel modulator and / or connexin 37 hemichannel modulator, a connexin 40 hemichannel modulator, a connexin 45 hemichannel modulator or another blood vessel connexin hemichannel. In some embodiments, the connexin modulator may be a modulator of a connexin hemichannel present in ocular cells, e.g., in cells of the retina. In some embodiments, the connexin modulator may be a modulator of a connexin hemichannel present in brain cells, e.g., in cells of the amygdala,E3697-00624 Patent hippocampus, hypothalamus and thalamus. In some embodiments, the connexin modulator may be a modulator of a connexin hemichannel present in glial and / or microglial cells. In some embodiments, the connexin modulator is a modulator of a Cx26, Cx30, Cx30.3, Cx31, Cx31.1, Cx32, Cx43, Cx45, Cx50, and / or Cx58 hemichannel, or any other connexin hemichannel in the corneal epithelium. In other embodiments, the connexin modulator is a modulator of any other connexin hemichannel in the eye or in blood vessels, including Cx36 and Cx57 hemichannels in addition to Cx37, Cx40, Cx43 and Cx45 hemichannels.
[0159] In some embodiments, the connexin hemichannel modulator is a connexin 43 hemichannel modulator. In some embodiments, the connexin hemichannel modulator is a modulator of another connexin hemichannel. In some embodiments, the connexin hemichannel modulator is a modulator of one or more of a connexin 26 hemichannel, a connexin 30 hemichannel, a connexin 30.3 hemichannel, a connexin 31 hemichannel, a connexin 31.1 hemichannel, a connexin 32 hemichannel, a connexin 45 hemichannel, a connexin 50 hemichannel, and a connexin 58 hemichannel. In some embodiments, the connexin modulator may be a modulator of a connexin present in blood vessels or endothelial cells, for example, a connexin 37 hemichannel modulator, or a connexin 49 hemichannel modulator, for example. Thus, as used herein, the term “connexin hemichannel modulator” refers generally to connexin hemichannel modulators, but also specifically to connexin 43 hemichannel modulators and modulators of other connexin hemichannels referenced herein, or any other desired target connexin hemichannel. In some embodiments, the connexin hemichannel modulator is a connexin 43 hemichannel modulator, e.g., a modulator of a connexin 43 expression, a connexin 43 hemichannel modulator that inhibits or blocks hemichannel opening including small molecule and peptidomimetic modulators of connexin 43 hemichannel. In some embodiments, the connexin hemichannel modulating agent can include or exclude any of the connexins or connexin hemichannels referenced herein.
[0160] The phrase “consisting essentially of” refers to specified materials and those additional materials that do not materially affect the basic and novel characteristics of a composition or medicament (and / or steps, in the case of a method). Basic and novel characteristics of the inventions are described throughout the specification in the context of the discussion. They include the ability of connexin hemichannel modulators and connexin hemichannel modulator compositions and methods of use thereof to treat or prevent one or more signs and / or symptoms (e.g., fatigue, brain fog, etc.) of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc., and other post-acute infection syndromes). They also include the ability of connexin hemichannel modulators,E3697-00624 Patent connexin hemichannel modulator compositions and methods of using connexin hemichannel modulators and connexin hemichannel modulator compositions to block or modulate connexins, connexin gap junctions and / or connexin hemichannels (e.g., connexin 43 connexins, gap junctions and / or hemichannels) and / or inflammasomes (e.g., NLRP3 inflammasomes). They also include the ability of connexin modulators, connexin modulator compositions and methods of using connexin modulators and connexin modulator compositions to block or modulate one or more connexins (e.g., connexin 43), the expression of one or more connexins (e.g., connexin 43 expression), the activity of one or more connexins (e.g., connexin 43 activity), the formation of connexin gap junctions (e.g., connexin 43 gap junction) and / or the formation of connexin hemichannels (e.g., connexin 43 hemichannels). Basic and novel characteristics of connexin hemichannel modulators, connexin hemichannel modulator compositions and methods of using connexin hemichannel modulators and connexin hemichannel modulator compositions also include the ability of connexin hemichannel modulators and connexin hemichannel modulator compositions to block or modulate the release of ATP and / or DAMPs from connexin hemichannels. Basic and novel characteristics of inflammasome modulator inventions include the ability of inflammasome modulators, inflammasome modulator compositions, and methods of using inflammasome modulators and inflammasome modulator compositions to treat or prevent one or more signs and / or symptoms (e.g., fatigue, brain fog, etc.) of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc., and other post-acute infection syndromes). They also include the ability of inflammasome modulators, inflammasome modulator compositions, and methods of use thereof to block, inhibit or otherwise modulate the activity of one or more inflammasomes (e.g., NLRP3 inflammasome activity). They also include the ability of inflammasome modulators, inflammasome modulator compositions, and methods of use thereof to block, inhibit or otherwise modulate the activation of one or more inflammasomes (e.g., activation of the NLRP3 inflammasome). They also include the ability of inflammasome modulators, inflammasome modulator compositions, and methods of use thereof to block, inhibit or otherwise modulate activation of an inflammatory cascade by one or more inflammasomes (e.g., activation of an inflammatory cascade by the NLRP3 inflammasome). Basic and novel characteristics of pannexin modulator inventions include the ability of pannexin modulators, pannexin modulator compositions, and methods of using pannexin modulators and pannexin modulator compositions (e.g., Panx1 modulators and Panx1 modulator compositions) to treat or prevent one or more signs and / or symptoms (e.g., fatigue, brain fog, etc.) of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatmentE3697-00624 Patent Lyme disease syndrome, etc., and other post-acute infection syndromes). They also include the ability of pannexin modulators, pannexin modulator compositions, and methods of use thereof to block or modulate pannexin (e.g., Panx 1) or release of ATP from pannexin channels (e.g., Panx 1 channels). Material changes in the basic and novel characteristics of inventions, including the compositions, medicaments and methods described herein, include changes or additions that result in unwanted activity, materially diminished activity or clinically materially undesirable activity. Material changes in the basic and novel characteristics of inventions, including the compositions, medicaments and methods described herein, include changes or additions that result in detrimental, disadvantageous or adverse activity. Material changes in the basic and novel characteristics of inventions, including the compositions, medicaments and methods described herein, include changes or additions resulting in detrimental, disadvantageous or adverse activity in treating or preventing a disease, disorder or condition described or referred to herein, for example, or an unwanted or undesirable diminution of the activity of a connexin hemichannel modulator (e.g. a connexin 43 hemichannel modulator), an inflammasome modulator (e.g. an NLRP3 inflammasome modulator) and / or a pannexin modulator (e.g. a pannexin 1 channel modulator). In some embodiments, a composition or medicament of the invention will comprise, consist essentially of, or consist of at least one connexin 43 hemichannel modulator, for example, a connexin 43 antisense molecule, a connexin 43 peptidomimetic hemichannel modulator or small molecule connexin 43 hemichannel blocker (e.g., tonabersat or another compound of Formula I) or a prodrug thereof (e.g., a tonabersat prodrug according to Formula II). In some embodiments, a composition or medicament of the invention will comprise, consist essentially of, or consist of at least one NLRP3 inflammasome modulator, for example, a direct NLRP3 inflammasome modulator and / or an indirect NLRP3 inflammasome modulator. In some embodiments, a composition or medicament of the invention will comprise, consist essentially of, or consist of at least one antisense, peptidomimetic or small molecule NLRP3 inflammasome modulator. In some embodiments, a composition or medicament of the invention will comprise, consist essentially of, or consist of at least one pannexin 1 channel modulator, for example, a pannexin 1 antisense molecule, a pannexin 1 peptidomimetic or small molecule pannexin 1 hemichannel blocker or prodrug thereof.
[0161] As used herein, “effective amount” or “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time as described in the dose regimens herein, to achieve a desired result in treatment of a disease, disorder, defect or condition for which one or more compounds or compositions of the invention are administered to a subjectE3697-00624 Patent or to a patient. For example, and not by way of limitation, a “therapeutically effective amount” can refer to an amount of a connexin hemichannel modulator compound or composition (e.g. a compound or composition comprising or consisting essentially of a connexin 43 hemichannel modulator), to an amount of an inflammasome modulator compound or composition (e.g. a compound or composition comprising or consisting essentially of an NLRP3 inflammasome inhibitor), or to an amount of a pannexin channel modulator (e.g. a compound or composition comprising or consisting essentially of a pannexin 1 channel modulator), including but not limited to those disclosed herein, that is able to treat a disease, defect, disorder or condition when administered in accordance with the invention.
[0162] In some embodiments, “effective amount” or “therapeutically effective amount” refers to an amount effective a compound or composition, at dosages and for periods of time as described in the dose regimens herein or used by those in accordance with methods of the invention, to achieve a desired result or results in the treatment of one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post- treatment Lyme disease syndrome, etc., and other post-acute infection syndromes). Symptoms include those described or referenced herein, for example, post-acute infection fatigue, brain fog, etc. Therapeutically effective amounts include an amount that is sufficient to achieve at least one desired therapeutic result, or to have at least one effect on at least one undesired symptom associated with a disease, disorder, defect or condition, including but not limited to those referenced herein. The specific therapeutically effective dose level for any particular patient may be varied or depend upon a variety of factors including the disorder being treated and the severity of the disorder; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration; the route of administration; the rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed and like factors used in the medical arts in determining dose levels. For example, those in the art may start doses of a compound or composition at levels lower than those required to achieve the desired therapeutic effect and to gradually increase the dosage until the desired effect is achieved. In some embodiments, the result of treatment with an “effective amount” provides a durable result following treatment. In some embodiments, treatment with an effective amount is discontinued following a desired result. In some embodiments, treatment with an effective amount is continued following a desired result. In some embodiments, treatment with an effective amount is paused and then continued following a desired result. The doses disclosedE3697-00624 Patent herein are therapeutically effective amounts; however, the methods are not limited to those doses or dose amounts and include the use of other therapeutically effective amounts.
[0163] In some embodiments, a compound, composition or preparation can be administered in a “prophylactically effective amount”; that is, an amount effective for prevention of a disease, disorder or condition, including one or more signs and / or symptoms of a post-acute infection syndrome described or referenced herein (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc., and other post-acute infection syndromes). As used herein, “prophylactically effective amount” refers to an amount effective to achieve or assure a desired prophylactic result, including, for example, treating or preventing one or more signs and / or symptoms of a post-acute infection syndrome described or referenced, including, for example, fatigue, brain fog, etc. The compounds and compositions herein can be used to prevent, inhibit, or reduce the occurrence of, one or more signs or symptoms of a post-acute infection syndrome.
[0164] A “maintenance dose” or a “preventative dose” is a dose intended to be a therapeutically effective or a prophylactically effective dose. In some embodiments, the maintenance doses may be therapeutically effective doses and others may be sub- therapeutic doses. We have discovered dosing regimens and oral dosage formulations for the administration of maintenance doses of connexin hemichannel modulators and inflammasome modulators. For example, in some embodiments, the invention features a method of treating one or more signs and / or symptoms of a post-acute infection syndrome in a subject by (i) administering a loading-dose of a connexin hemichannel modulator and / or an inflammasome modulator to the subject; and (ii) administering one or more maintenance doses of the connexin hemichannel modulator and / or an inflammasome modulator to the subject, wherein each of the loading-dose and the maintenance doses are administered in an amount that together are sufficient to treat the one or more signs and / or symptoms of a post-acute infection syndrome. For example, the loading dose can be administered by injection (e.g., subcutaneously) or orally followed by maintenance dosing administered orally, intravenously, nasally, subcutaneously or transdermally. In some embodiments, the loading-dose is administered orally. In some embodiments, the loading-dose is administered by injection or infusion. For example, the intravenously (e.g., as a bolus or infusion) administered loading-dose can be administered in an amount sufficient to produce a mean steady-state concentration of the connexin hemichannel modulator and / or an inflammasome modulator in the subject. In some embodiments, the introductory or loading dose is about 40 mg to about 100 mg (or other dose described herein) administered daily and the maintenance dose is about 100 mg to about 200 mg administeredE3697-00624 Patent about once a week. In some embodiments, the introductory dose is about 80 mg to about 200 mg and the dose in the maintenance period is about 200 mg to about 300 mg administered once a week. In some embodiments, the dose for the induction phase, e.g., the introductory or loading dose, is a dose of 100 mg administered at least once per day and the dose for the maintenance phase is about 200 mg once a week.
[0165] As used herein, a “gap junction,” a “connexin gap junction” and a “connexin gap junction channel” refer to two hemichannels connected across an intercellular space between adjacent cells that allow certain molecules to flow between the cells. They refer to the intercellular channels or clusters of intercellular channels (gap junction plaques) that allow direct diffusion of ions and small molecules between adjacent cells. Gap junctions have been studies for decades and are well known in the art.
[0166] All connexins share the same topological structure, including four transmembrane domains, two extracellular loops (EL1 and EL2), a cytoplasmic loop (CL) and amino (NT) and carboxyl termini (CT) in the cytoplasm. The carboxyl termini exhibit the greatest heterogeneity in amino acid sequences, whereas the transmembrane and extracellular domains are most conserved among the connexin isoforms. In general, connexins are expressed in the endoplasmic reticulum, transported to the Golgi apparatus to form hexamers (connexons), trafficked to the plasma membrane as connexin hemichannels, which then flow laterally to fuse with gap junction plaque and assemble with connexin hemichannels from apposing cells, forming into gap junctions. Thus, connexin hemichannels exist on plasma membranes before forming gap junctions. The presence of connexin hemichannels, however, does not always lead to the formation of gap junctions. For example, hemichannels formed by connexin 43, the most widely expressed connexin, can remain non-junctional on cell membranes if adequate adhesion molecules are not expressed. Non-junctional connexin structures are also reported in vivo. In one study using atomic force microscopy, hemichannels were found to account for about 12–17% of the total number of plaques in gap junction preparations from rat hearts (Lal R, John SA, Laird DW, Arnsdorf, MF. Heart gap junction preparations reveal hemiplaques by atomic force microscopy. Am. J. Physiol. 1995268:C968– C977), suggesting that connexin hemichannels may possess substantial permeation capacity in some critical organs. Connexin hemichannels are normally closed to maintain cellular homeostasis, but can be activated in pathophysiological processes to serve as toxic membrane pores, and have been referred to by some as “pathological pores.” As used herein, the term “hemichannel” (or “connexin hemichannel”) is a structure comprised of connexin proteins, typically homo- or hetero-meric hexamers of connexin proteins that form the pore for a gapE3697-00624 Patent junction between the cytoplasm of two adjacent cells. The hemichannel is supplied by a cell on one side of the junction, and by a cell on the other side, with two hemichannels from opposing cells normally coming together to form the complete intercellular gap junction channel. However, as noted, in some cells, and in cells under some circumstances, the hemichannel itself is active as a conduit between the cytoplasm and the extracellular space allowing the transference of ions and small molecules (e.g. ATP). Like their gap junction counterparts, connexin hemichannels have been long-studied and are also well known in the art.
[0167] Increased connexin 43 hemichannel opening is associated with inflammasome pathway activation and inflammation. As used herein, the term “inflammasome modulator” (which may also be referred to as an inflammasome “inhibitor,” “blocker” or “antagonist”) is a compound that directly or indirectly prevents, inhibits, and / or reduces the formation, function or activity of an inflammasome (e.g., an NLRP3 inflammasome), including, for example, prevention, inhibition and / or reduction in the function and / or activity and / or the formation of an inflammasome (e.g., an NLRP3 inflammasome), including its assembly. In some embodiments, activation of an inflammatory cascade by the NLRP3 inflammasome is modulated (e.g. inhibited, blocked or downregulated) by a direct NLRP3 inflammasome modulator. In some embodiments, activation of an inflammatory cascade by the NLRP3 inflammasome is modulated (e.g. blocked or downregulated) by an indirect modulator of the NLRP3 inflammasome. In some embodiments, a direct or indirect inflammasome modulator may include or exclude any known direct or indirect inflammasome modulator. In some embodiments, activation and / or activity of the NLRP3 inflammasome is modulated (e.g. blocked, inhibited or downregulated) by a connexin hemichannel modulator. In some embodiments, an inflammasome modulator may include a connexin hemichannel modulator. In some embodiments, an inflammasome modulator may exclude a connexin hemichannel modulator. Both connexin hemichannel modulation (e.g. connexin 43 hemichannel modulation) and inflammasome modulation (e.g. NLRP3 inflammasome modulation) are useful in treating or preventing one or more of the diseases, defects, disorders or conditions described or referenced herein (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc., and other post-acute infection syndromes). Both connexin hemichannel modulation (e.g. connexin 43 hemichannel modulation) and inflammasome modulation (e.g. NLRP3 inflammasome modulation) are useful in treating or preventing one or more signs and / or symptoms of a post-acute infection syndrome (e.g. fatigue, brain fog, etc.). Pannexin channel modulators and pannexin channel modulator compositions (e.g. Panx1 channelE3697-00624 Patent modulators and compositions) will also be useful in treating and / or preventing one or more signs and / or symptoms of a post-acute infection syndrome.
[0168] In some embodiments, a compound, composition or preparation can be administered in a “prophylactically effective amount”; that is, an amount effective for prevention of a disease, disorder or condition, including one or more signs and / or symptoms of a post-actue infection syndrome described or referenced herein (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.). As used herein, “prophylactically effective amount” refers to an amount effective to achieve or assure a desired prophylactic result, including, for example, treating or preventing one or more signs and / or symptoms of a post- acute infection syndrome described or referenced, including, for example, fatigue, brain fog, etc.
[0169] In some embodiments, a disease, defect, disorder or condition is treated with an inflammasome modulator (e.g. a modulator of the NLRP3 inflammasome) that may not be a connexin modulator (e.g. a connexin 43 hemichannel modulator). Inflammasome modulators include those described, for example, in Leung and Lowery, The patent landscape of inflammasome modulators. Nature Reviews Drug Discovery 19, 158 (2020). See also Chauhan, D., et al., Therapeutic modulation of inflammasome pathways. Immunol Rev.297(1): 123–138 (Sept 2020). Inflammasome modulators include selective G-protein coupled receptor 40 (GPR40) agonists (e.g. fasiglifam, which inhibits inflammasome activation by blocking formation of apoptosis-associated speck-like protein (ASC) containing a caspase recruitment domain (CARD), an inflammasome component), and ethyl pyruvate, which significantly suppresses activation of the NLRP3 inflammasome. Other inflammasome modulators unrelated to connexins and connexin hemichannels are known in the art.
[0170] The term “in vivo” (Latin for “within the living”) refers to use in a whole, living organism as opposed to an ex vivo or in vitro controlled environment. Animal testing, clinical trials, and use in humans or other living subjects are forms of in vivo research. In vivo testing is often employed over in vitro to observe the overall effects of an experiment on a living subject. Ex vivo work or experimentation is done in live isolated cells, tissues or organs, rather than in a whole organism, for example, cultured cells derived from biopsies. Once cells are disrupted and individual parts are tested or analyzed, this is referred to as in vitro. Methods carried out in vivo include the use of animal models for research. In vivo methods also include the use of methods in humans and other subjects, including for therapy. The term “ex vivo” (Latin: “out of the living”) refers to use outside an organism, and is used to indicate methods, work, experimentation or measurements done in or on tissue in an artificialE3697-00624 Patent environment outside an organism. Ex vivo work is often done with the minimum alteration of natural conditions. Ex vivo conditions often allow methods, work, experimentation and / or measurements to be carious out under more controlled conditions than may be possible in in vivo experiments (in the intact organism), albeit at the expense of altering the "natural" environment. A main difference between in vitro and ex vivo assays is that the former is simply a cell system established in a cell culture or in a laboratory. In contrast, the latter is a tissue directly taken from a living organism, or a tissue that has been created artificially. The term “in vitro” (“within the glass,” or “in glass,” e.g., in a test tube or petri dish). In vitro experiments were historically conducted in glass test tubes and Petri dishes, however, modern laboratory practices include the use of single-use plasticware, and other non-glass instruments, in part to avoid cross-contamination, the need for washing, sterilization, etc. In vitro experiments are often performed on cells or cultures of cells, which sometimes include immortalized human or other animal cell lines, or other cell lines, and sometimes include bacteria. When the test subjects are cells, they are derived from living organisms or cell lines and maintained in culture in special conditions. Sometimes those conditions seek to mimic physiological circumstances including temperature and sterility. There is a wide variety of cell types which in many cases can be amplified in plastic flasks and distributed in plates with hundreds of small wells for high throughput screening, for example. Some cell types cannot adhere to plastic and are cultured in suspension, forming aggregates. Three-dimensional cell systems may also be used where the higher cell-cell interaction adds another layer of complexity to cellular communication. Furthermore, advanced in vitro systems such as the organ-on-a-chip technology, offer a next level of complexity introducing, for example, microfluidic channels that reproduce human blood and / or airflow. These are only some examples of in vitro methodologies. The activity of a connexin modulators, connexin hemichannel modulators, inflammasome modulators, inflammasome activation modulators, and pannexin channel modulators may be evaluated by in vitro, ex vivo and in vivo techniques, including those known in the art.
[0171] As used herein, “kit” means a collection of at least two components constituting the kit. Together, the components constitute a functional unit for a given purpose. Individual member components may be physically packaged together or separately. For example, a kit comprising an instruction for using the kit may or may not physically include the instruction with other individual member components. Instead, the instruction can be supplied as a separate member component, either in a paper form or an electronic form which may be supplied on computer readable memory device or downloaded from an internet website, or as a recordedE3697-00624 Patent presentation. As used herein, “instruction(s)” means documents or information describing relevant materials or methodologies pertaining to a kit. These materials may include any combination of the following: background information, list of components and their availability information (purchase information, etc.), brief or detailed protocols for using the kit, trouble-shooting, references, technical support, and any other related documents. Instructions can be supplied with the kit or as a separate member component, either as a paper form or an electronic form which may be supplied on computer readable memory device or downloaded from an internet website, or as a recorded presentation. Instructions can comprise one or multiple documents, and include future updates. Kits may include one or more connexin modulators, one or more connexin hemichannel modulators, one or more inflammasome modulators, one or more inflammasome activation modulators, and / or one or more pannexin channel modulators, alone or in any combination.
[0172] The term “fatigue” refers to a feeling of weariness, tiredness, and / or lack of energy. Fatigue reduces energy, the ability to do things and the ability to focus. Ongoing fatigue can affect quality of life and state of mind. Fatigue can be mental or physical. It is often classified into physical fatigue, such as muscle fatigue, and mental fatigue, such as brain and sensory system fatigue. The inventions described and claimed herein can treat mental fatigue. The inventions described and claimed herein can also help to treat physical fatigue. Fatigue, which often refers to weariness, a lack of energy and / or motivation is different from drowsiness, which often refers to feeling the need to sleep. Drowsiness and apathy (a feeling of not caring about what happens), however, can be symptoms that go along with fatigue. In the present disclosure, “fatigue” can also include “loss of focus.” Fatigue is often characterized by fatigue that is not relieved with rest and is also often associated with physical symptoms. Fatigue can also be determined by evaluating its length and associated physical symptoms (including one or more of, for example, post-exertional malaise; unrefreshing sleep; impaired memory or concentration; muscle pain; polyarthralgia; sore throat; tender lymph nodes; or new headaches). Fatigue may also be determined and evaluate using an electroencephalogram (EEG) device known in the art (e.g., a device comprising a dry-contact EEG electrode to measure EEG data operably coupled to at least one processor to calculate a frequency domain representation of the EEG data, detect spectral features indicative of fatigue based on the frequency domain representation, and determining whether the brain is fatigued based on the detection). Compounds, compositions, kits and methods described herein may be used to treat fatigue resulting from a post-acute infection syndrome (e.g., long COVID, long flu, post- treatment Lyme disease syndrome, etc.).E3697-00624 Patent
[0173] Common signs / symptoms of “brain fog,” also known as mental fog or a clouding of consciousness, can include one or more of the following: difficulty concentrating, irritable mood, low energy or fatigue, headaches, trouble recalling information, anxious mood, confusion, and insomnia. Brain fog may be determined by medical or other evaluation. Diagnostic blood testing and medical imaging, such as MRI, are also sometimes used in the diagnosis of brain fog. Compounds, compositions, kits and methods described herein may be used to treat brain fog resulting from a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.).
[0174] Other post-acute infection syndrome symptoms, including for example, joint pain, sleep disturbance, anxiety, headache, and other symptoms described or referenced herein or known in the art, including those set forth in the Example, may also be treated with compounds, compositions, kits and methods described herein (e.g. connexin 43 hemichannel modulators, NLRP3 inflammasome modulators, etc.). Symptoms of a post-acute infection syndrome may be determined, diagnosed or evaluating using methods known in the art, including differential diagnosis.
[0175] With regard to long COVID, for example, a detailed clinical history regarding the onset and duration of current symptoms, underlying medical comorbidities, the severity of COVID-19, and medication history is obtained by treating providers during follow-up visits and hospitalization records of COVID-19 related admission, if any, are reviewed thoroughly, including pertinent diagnostic tests performed. Given post-acute COVID-19 syndrome is an evolving clinical entity, currently, there are no guidelines regarding its management. Nevertheless, until further guidance is available, this novel clinical entity is be considered a diagnosis of exclusion, with other complications associated with COVID-19 and other acute alternative diagnoses being ruled out with, for example, pertinent laboratory and radiologic assessment, including reinfection with SARS-CoV-2. See Chippa V, et al. Post-Acute Coronavirus (COVID-19) Syndrome. [Updated 2023 Feb 3]. In: StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2024 Jan-, and the descriptions of tests and assessments noted therein, which may include routine laboratory assessments, pulmonary imaging, cardiac function tests such as EKG and echocardiography, neuroimaging that includes vascular (CT / MRI) and neuropsychological testing if clinically indicated in patients presenting with neuropsychiatric manifestations.
[0176] As used herein, the term “modulator” refers to connexin hemichannel modulators, a pannexin channel modulators, direct inflammasome modulators and indirect inflammasome modulators. A modulator may refer to at least one, any two or more, any threeE3697-00624 Patent or more, or all compounds and compositions selected from the group consisting of connexin hemichannel modulators, a pannexin channel modulators, direct inflammasome modulators and indirect inflammasome modulators.
[0177] As used herein, the terms “optional” or “optionally” means that the subsequently described event or circumstance can or cannot occur, and that the description includes instances where said event or circumstance occurs and instances where it does not.
[0178] As used herein, the term “pannexin channel modulator” (which may also be referred to as a pannexin channel or pannexin “inhibitor,” “blocker” or “antagonist”) is a compound that prevents, inhibits, and / or reduces the formation, function or activity of a pannexin channel, including, for example, the prevention, inhibition and / or reduction, in whole or in part, in the expression of a pannexin protein, its trafficking and / or assembly as a channel. Pannexin channel modulators include chemical-based pannexin channel modulators (e.g. probenecid, or a compound according to Formula VI in US Patent No. 10,465,188, etc.), peptide-based pannexin hemichannel modulators (e.g.10Panx1), DNA- and RNA-based pannexin channel modulators, antibody- and antibody fragment-based pannexin channel modulators (e.g. monoclonal antibodies, ScFvs, etc.). See, e.g., Koval, M, et al. Pharmacology of pannexin channels. Current Opinion in Pharmacology 2023 69:102359; Navis, KE, et al. Pannexin 1 Channels as a Therapeutic Target: Structure, Inhibition, and Outlook ACS Chem. Neurosci. 2020, 11, 15, 2163–2172; Willebrords J, et al. Inhibitors of connexin and pannexin channels as potential therapeutics. Pharmacol Ther.2017180:144-160. In some embodiments, the pannexin channel modulators are pannexin 1 (Panx1) channel modulators. Pannexin modulation (e.g., pannexin 1 modulation) will be useful in treating or preventing one or more of the diseases, defects, disorders or conditions described herein by inhibiting ATP release from a pannexin channel (e.g., a pannexin 1 channel).
[0179] References in the specification and claims to parts by weight of a particular agent or component in a composition denotes the weight relationship between the agent or component and any other agents or components in the composition or article for which a part by weight is expressed. Thus, in a compound or composition containing 2 parts by weight of component X and 5 parts by weight component Y, X and Y are present at a weight ratio of 2:5, and are present in such ratio regardless of whether additional components are contained in the compound. A weight percent (wt. %) of a component, unless specifically stated to the contrary, is based on the total weight of the formulation or composition in which the component is included. Thus, the amount of X in a compound or composition containing X (5 wt.%) contains 5% X.E3697-00624 Patent
[0180] Peptidomimetics are molecules able to mimic natural peptides and proteins. Generally, peptidomimetics are structural or functional mimics (e.g., identical or similar) to a paradigm polypeptide (i.e., a polypeptide that has a biological or pharmacological function or activity). The terms “peptidomimetic” and “mimetic” (also known or referred to as peptide mimetics) include synthetic or recombinantly manufactured compounds, including polyamides and poly(amino acid) polymers, that have the same or substantially the same characteristics of protein or peptide regions that they mimic. Typically, a peptidomimetic will have the same or substantially the same structural and / or functional characteristics of protein or peptide regions they mimic. A peptidomimetic modulator (also sometimes referred to as a “modulator peptide,” a “modulator peptidomimetic,” a “mimetic” or a “peptidomimetic inhibitor”) comprises a peptide or peptide-like molecule that is able to serve as a model for a peptide substrate upon which it is structurally based and to modulate (i.e., inhibit, lessen, decrease or reduce) one or more activities of the peptide substrate on which is structurally based.
[0181] In some embodiments, the peptidomimetics and mimetics comprise one or more or all naturally occurring amino acids. In some embodiments, the peptidomimetics and mimetics comprise one or more or all L-amino acids. In some embodiments, the peptidomimetics and mimetics comprise one or more or all D-amino acids. D-peptide peptidomimetics include D-peptides designed to mimic natural L-peptides. The peptide bonds formed by D-amino acids are more resistant to proteases than those formed by L-amino acids. In some embodiments, the peptidomimetics and mimetics comprise one or more L-amino acids and one or more D-amino acids. In some embodiments, a peptidomimetic can be a mimetic composed entirely of natural amino acids, composed entirely synthetic chemical compounds, composed entirely of non-natural amino acids, composed entirely of analogues of naturally- occurring and / or non-naturally-occurring amino acids, or a chimeric molecule composed of partly of natural amino acids and partly of non-natural occurring amino acids or analogs of amino acids. In some embodiments, a peptidomimetic comprises any amount of natural amino acid conservative substitutions as long as such substitutions also do not substantially alter mimetic activity. In some embodiments, peptidomimetics are unmodified.
[0182] In some embodiments, peptidomimetics are modified. In some embodiments, a peptidomimetic is a modified or chemically modified peptide. In some embodiments, peptidomimetics is a modified peptide that has one or more peptide linkages optionally replaced by a linkage selected from the group consisting of, for example, -CH2NH-, -CH2S-, - CH2-CH2-, - CH=CH- (cis and trans), -COCH2-, -CH(OH)CH2-, and -CH2SO-. In some embodiments, a peptidomimetics is chemically modified to include unnatural aminoE3697-00624 Patent acid substitutions, backbone amide bond modifications, rigid scaffolds, added hydrophobic residues, and / or in other ways known in the art. In some embodiments, a peptidomimetic is a modified peptide-like molecule. In some embodiments, a modified peptide-like peptidomimetic contains one or more or all non-naturally occurring amino acids or is a peptoid. Although their backbones are similar, side chains of peptides are attached to the α-carbon in peptides, while peptoids have side chains attached to the amide nitrogen. This modification confers resistance to proteolytic degradation. Peptoids include poly-N-substituted glycines. See, e.g., Wolf LM, et al. Peptoids: Emerging Therapeutics for Neurodegeneration J Neurol Neuromedicine 2017 2(7):1-5. Other peptidomimetics known in the art include, for example, peptide-like molecules which contain a constrained amino acid, a non-peptide component that mimics peptide secondary structure, or an amide bond isostere. See, e.g., Goodman and Ro, Peptidomimetics for Drug Design, in “Burger's Medicinal Chemistry and Drug Discovery” Vol. 1 (ed. M. E. Wolff; John Wiley & Sons 1995), pages 803-861. A peptidomimetic that contains a constrained amino acid or a constrained non-naturally occurring amino acid can include, for example, an α-methylated amino acid, an α,α-dialkyl- glycine or α-aminocycloalkane carboxylic acid; an Nα-Cα cylized amino acid, an Nα- methylated amino acid, a β- or γ-amino cycloalkane carboxylic acid, an α,β-unsaturated amino acid, a β, β-dimethyl or β-methyl amino acid, a β-substituted-2,3-methano amino acid, an NCδ or Cα-Cδ cyclized amino acid, or a substituted proline or another amino acid mimetic. A peptidomimetic that mimics peptide secondary structure can contain, for example, a nonpeptidic β-turn mimic; γ-turn mimic; mimic of β-sheet structure; or mimic of helical structure, each of which is well known in the art. A peptidomimetic that contains an amide bond isostere, for example, may contain an amide bond isostere such as a retro-inverso modification, a reduced amide bond, a methylenethioether or methylenesulfoxide bond, a methylene ether bond, an ethylene bond, a thioamide bond, a trans-olefin or fluoroolefin bond, a 1,5-disubstituted tetrazole ring, a ketomethylene or fluoroketomethylene bond, or another amide isostere. One skilled in the art understands that these and other peptidomimetics are encompassed within the meaning of the term “peptidomimetic” as used herein.
[0183] Peptidomimetics that are structurally similar to portions of a connexin (e.g., connexin 43), an inflammasome (e.g., an NLRP3 inflammasome) or a pannexin (e.g., pannexin 1) can be used to produce a therapeutic or prophylactic effect.
[0184] Peptidomimetics useful as connexin hemichannel modulating agents include peptide and peptide-like molecules capable of down-regulating, reducing or decreasing, in whole or in part, one or more biological actions or activities of a connexin hemichannel, suchE3697-00624 Patent as, for example, preventing the docking of hemichannels to form gap-junction-mediated cell- cell communications, or preventing the opening of hemichannels to expose the cell cytoplasm to the extracellular millieu, and so on.
[0185] By way of example, in some embodiments, a peptidomimetic mimics an extracellular loop of connexins involved in hemichannel-hemichannel docking and cell-cell channel formation, and / or an extracellular loop of a connexin hemichannel, as well as an extracellular loop or the intracellular loop or intracellular C-terminus of a connexin. In some embodiments, a peptidomimetic mimics an extracellular loop, intracellular loop or intracellular C-terminus of connexin 43. In some embodiments, a peptidomimetic mimics an portion of another connexin, including those listed herein.
[0186] Compositions of the invention may comprise one or more connexin peptidomimetics that can serve as connexin hemichannel modulators (also referred to “mimetic connexin hemichannel modulators” or “peptidomimetic connexin hemichannel modulators”). Connexin peptidomimetics are known in the art and many connexin peptidomimetics useful as peptidomimetic connexin hemichannel modulators are described or referenced herein. All known connexin isoforms are structurally similar, being composed of four transmembrane domains, two extracellular loops (EL1, EL2) bound in conformation by extracellular disulfide bonds, a single intracellular loop (IL), an amino-terminus (NT), and a carboxyl-terminus (CT). Connexin peptidomimetics useful as connexin hemichannel modulators include, for example, EL1 extracellular loop-binding peptidomimetics such as Gap 26 and P5, EL1 extracellular loop-binding peptidomimetics such as Peptide5, Gap 27, and P180-195, IL intracellular loop- binding peptidomimetics such as Gap19, Gap20 and Cx43L2 peptide, and intracellular CT- binding peptidomimetic connexin hemichannels modulators such as XG19, JM2, cSRC, TAT- Cx43, TAT-CT10, and the alpha CT peptidomimetics such as alpha CT-1, alpha CT-2, alpha CT-3, etc. See, e.g., King DR, et al. Mechanisms of Connexin Regulating Peptides. Int J Mol Sci. 2021 22(19):10186: Simon, Á, et al. Peptide Binding Sites of Connexin Proteins. Chemistry 2020, 2:662-673. FDA-approved peptidomimetics drugs include Romidepsin (Istodax), Atazanavir (Reyataz), Saquinavir (Invirase), Oktreotid (Sandostatin), Lanreotide (Somatuline), Plecanatide (Trulance), Ximelagatran (Exanta), Etelcalcetide (Parsabiv), and Bortezomib (Velcade).
[0187] The first extracellular loops of connexin 37, connexin 40 as well as connexin 43 are mimicked by peptides under the Gap26 code. Gap27 and Peptide5, on the other hand, mimic regions of the second extracellular loop. Gap27 targets connexin 32, connexin 40 and connexin 43, while Peptide5 is used for connexin 43 inhibition. Other peptidomimetics include JM2E3697-00624 Patent (VFFK-GVKDRVKGRSD; SEQ ID NO:134), ΔSH3, CT9 (RPRDDLEI; SEQ ID NO:135) and CT9-TAT, CT10 (SRPRDDLEI; SEQ ID NO:136), αCT (RQPKIWFPNRRKPWKK- RPRPDDLEI (SEQ ID NO:137) in which the inhibitor peptide includes the connexin 43 C- terminal amino acids 374–382 (RPRPDDLEI; SEQ ID NO:141) that encompass the ZO-1- binding sequence, which is in turn attached at its N-terminus to a 16-amino acid antennapedia internalization vector) mimic the C-terminal tail of connexin 43 and Gap24 (GHGDPLHLEEVKC; SEQ ID NO:138) reproduces a sequence of the cytoplasmic loop of connexin 32 while TAT-Gap24 (YGRKKRRQRRRGHGDPLHLEEVKC; SEQ ID NO:139) also mimics a portion of the intracellular loop of connexin 43. Both L2 and Gap19 also mimic the cytoplasmic loop of connexin 43. Peptides and peptidomimetics useful in the compositions and methods of the invention also include those set forth in Tables II and III. In some embodiments, a peptidomimetic connexin hemichannel modulator has been modified to increase stability, to improve bioavailability and / or to increase cell membrane permeability, for example, by linking the amino or carboxy terminus to a cellular internalization transporter. Cellular internalization transporters include those described herein or otherwise known in the art or later developed. In some embodiments, a peptidomimetic corresponds to at least one portion of a connexin (e.g., connexin 43) that can be used to modulate a connexin hemichannel activity (including, for example, release of ATP).
[0188] In some embodiments, a peptidomimetic corresponds to at least one portion of an inflammasome (e.g., an NLRP3 inflammasome). In some embodiments, by way of example, an NLRP3 inflammasome peptidomimetic comprises a sequence corresponding to segment of an NLRP3 inflammasome component (e.g., an amino (N)-terminal pyrin domain (PYD), a carboxy (C)-terminal LRR, or a central NBD-containing ATPase domain (NACHT)), or to an apoptosis-associated speck-like protein containing a CARD (ASC). Inhibitors constituents of the NLRP3 Inflammasome include VX-740 (Pralnacasan) and its analog VX-765, which are peptidomimetic inhibitors of caspase-1.
[0189] Small-molecule inflammasome modulators useful in methods of the invention the orally bioavailable proteasome inhibitor NIC-0102 (IUPAC / Chemical Name: ((R)-1-((S)- 2-(2,6-difluorobenzamido)-3-phenylpropanamido)-3-methylbutyl)boronic acid). NIC-102 specifically prevents NLRP3 inflammasome activation but has no effect on NLRC4 or AIM2 inflammasomes. NIC-0102 induces the polyubiquitination of NLRP3, interferes with the NLRP3-ASC interaction, and blockes ASC oligomerization, thereby inhibiting NLRP3 inflammasome activation. In addition, NIC-0102 also inhibits the production of pro-IL-1β.E3697-00624 Patent
[0190] In some embodiments, a peptidomimetic corresponds to at least one portion of a pannexin (e.g., pannexin 1) to modulate pannexin channel activity (including, for example, release of ATP). In some embodiments, the pannexin 1 peptidomimetic comprises or consists essentially of H-Trp-Arg-GIn-Ala-Ala-Phe-Val-Asp-Ser-Tyr-OH (also known as10Panx).
[0191] Peptidomimetics encompass those described herein, as well as those as may be known in the art, whether now known or later developed.
[0192] The term “pharmaceutical formulation” refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which does not contain additional components that are unacceptably toxic to a subject to which the formulation would be administered. A “pharmaceutical composition” refers to a mixture of substances suitable for administering to a subject that includes one or more active ingredients or pharmaceutical agents (e.g., one or more connexin hemichannel modulators (e.g., one or more connexin 43 hemichannel modulators), one or more inflammasome modulators (e.g., one or more NLRP3 inflammasome modulators) or a combination of one or more connexin hemichannel modulator and one or more inflammasome modulators). For example, a pharmaceutical composition may comprise one or more compounds of the invention and a sterile aqueous solution or a pharmaceutically acceptable carrier.
[0193] A “pharmaceutically acceptable carrier,” as used herein, refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which can be safely administered to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
[0194] As used herein, the term “prevent” or “preventing” refers to precluding, averting, obviating, forestalling, stopping, or hindering something from happening. It is understood that where reduce, inhibit or prevent are used herein, unless specifically indicated otherwise, the use of the other two words is also expressly disclosed, and that they refer to reducing, inhibiting or preventing in whole or in part for the therapeutic and / or prophylactic purposes described herein.
[0195] Prodrugs are well known to those in the art with knowledge of chemistry. As used herein, a “prodrug” is understood to refer to a compound that, after administration, is metabolized or otherwise converted to an active or more active form with respect to at least one biological property, relative to itself. To produce a prodrug, a pharmaceutically active compound (e.g., tonabersat), or a suitable precursor thereof, is modified chemically such that the modified form is less active or inactive, but the chemical modification is effectively reversible under certain biological conditions such that a pharmaceutically active form of theE3697-00624 Patent compound is generated by metabolic or other biological processes. A prodrug can have, relative to the drug, altered metabolic stability or transport characteristics, fewer side effects or lower toxicity, or improved flavor, for example (see the reference Nogrady, 1985, Medicinal Chemistry A Biochemical Approach, Oxford University Press, New York, pages 388-392). Prodrugs can also be prepared using compounds that are not drugs but which upon activation under certain biological conditions generate a pharmaceutically active compound. As used herein, for example, a “tonabersat prodrug” or “prodrug of tonabersat” refers to a compound that undergoes a chemical conversion, through a metabolic process or otherwise (e.g., within the body of the mammal or other subject receiving the compound) into an active form of tonabersat that has a desired effect. In other words, a tonabersat prodrug includes a compound that upon activation releases tonabersat or an active analog thereof.
[0196] A “small molecule” is a low molecular weight organic compound and gernally includes compounds with a molecular weight less than about 600-1200 daltons. Small molecule connexin modulators include the compounds of Formula I. A small molecule can be an active agent of a prodrug. Small molecules prodrugs include the compounds of Formula II, which are prodrugs of the small molecule connexin hemichannel modulator, tonabersat. The molecular weight of tonabersat is about 392 daltons. Weight average molar mass or weight average molecular weight is the ratio of the total mass of all molecules to the total number of moles in the sample. This value is also known as the average molecular weight, which for tonabersat is about 392 daltons, depending on the preparation and its purity. This is noted because infringers have in the past used values for molecular weight versus average molecular weight to confuse and deceive courts into believing, for example, that the compound it commercializes that is identical to a claimed compound, and thus infringes the claim, is not the claimed compound because the “molecular weight” of the compound referred to in the claim is different from the “average molecular weight” of the infringing compound.
[0197] As used herein, the term “subject” or the like, including “individual,” and “patient”, all of which may be used interchangeably herein, refers to any mammal, including humans, domestic and farm animals, and zoo, wild animal park, sports, or pet animals, such as dogs, horses, cats, sheep, pigs, cows, etc. In some instances, however, a patient may refer to a subject afflicted with specific a condition, disease, defect, syndrome or disorder. The terms “subject” and “patient” include human and veterinary subjects. The preferred mammal herein is a human, including adults, children, and the elderly. Preferred sports animals are horses and dogs. Preferred pet animals are dogs and cats. The subject may be, for example, an aquatic parkE3697-00624 Patent animal, such as a dolphin, whale, seal or walrus. In certain embodiments, the subject, individual or patient is a human. The term “subject” does not denote a particular age or sex. In some embodiments, subjects may include animals used in scientific experiments (e.g. mice, rats, rabbits, sheep, goats, or other laboratory subjects). In other embodiments, the term “subjects” may exclude one or more or all animals used in scientific experiments, and a method may specify that is does not include one or more or all animals used in scientific experiments. In some embodiments, subjects may include non-animals and other things used in scientific experiments (e.g., fruit flies, cells, cell cultures, tissues, organs, 3D tissue culture (such as organs-on-a-chip). In other embodiments, the term “subjects” may exclude one or more or all non-animals or other things used in scientific experiments and a method may specify that is does not include one or more or all non-animals or other things used in scientific experiments.
[0198] In some embodiments of the disclosed methods, a subject has been diagnosed with a need for treatment of one or more signs and / or symptoms associated with a post-acute infection syndrome.
[0199] As used herein, “treatment” (and grammatical variations thereof such as “treat” or “treating”) refers to an attempt to alter the course of the individual, tissue or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Thus, the term “treatment” includes the management or care of a subject, or of a patient, with the intent to cure, ameliorate, stabilize, or prevent a disease, disorder, defect or condition. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, disorder, defect or condition, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, disorder, defect or condition. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, disorder, defect or condition; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, disorder, defect or condition; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, disorder, defect or condition. In various aspects, the term covers any treatment of a subject, including a mammal (e.g., a human), and includes: (i) preventing a disease, disorder or condition from occurring in a subject that can be predisposed to the disease, disorder or condition but has not yet been diagnosed as having it; (ii) inhibiting a disease, disorder or condition, i.e., arresting or slowing its development; or (iii) relieving a disease, disorder or condition, i.e., causing regression of the disease, disorder or condition. In some embodiments, the subject is a mammal such as a primate, and, in further embodiments,E3697-00624 Patent the subject is a human. In some embodiments, the subject is a non-human mammal. Treatment does not necessarily imply that a subject or patient is treated until total recovery following treatment, or that treatment of a subject or patient results in total recovery. Accordingly, “treatment” may also include maintaining or promoting a complete or partial state of remission in a subject or patient, or an alleviation or relief from symptoms of the disease, disorder, defect of conditions being treated, whether in whole or in part, temporary or permanent. The term “preventing” means preventing in whole or in part or ameliorating or controlling. The term “ameliorate,” “ameliorating” and “amelioration” and the like refer an improvement in one or more signs or symptoms of a post-acute infection syndrome or condition, a reduction in the severity of one or more signs or symptoms of a post-acute infection syndrome or condition, or an inhibition of progression or worsening of one or more signs or symptoms of a post-acute infection syndrome or disorder (e.g., stabilizing one or more signs or symptoms of a post-acute infection syndrome or disorder). In the case of long COVID, long flu, long cold, post-Lyme disease treatment syndrome, etc., an improvement can be a lowering or a reduction in one or more signs or symptoms or effects of the post-acute infection syndrome disorder.
[0200] In some embodiments, “treat,” “treating”, or “treatment” means the administration of therapy to an individual who already manifests at least one sign or symptom of a post-acute infection syndrome, disease or condition or who has previously manifested at least one sign or symptom of a post-acute infection syndrome, disease or condition. For example, “treating” can include alleviating, abating or ameliorating at least one sign or symptom of a post-acute infection syndrome, disease or condition, preventing additional one or more signs and / or symptoms, ameliorating an underlying cause of one or more signs and / or symptoms, inhibiting at least one sign or symptom of a post-acute infection syndrome, disease or condition, e.g., arresting the development of the syndrome, and / or relieving at least one sign or symptom of a post-acute infection syndrome, disease or condition, causing regression of at least one sign or symptom of a post-acute infection syndrome, disease or condition, relieving at least one sign and / or symptom caused by a post-acute infection syndrome, disease or condition, or stopping at least one sign and / or symptom caused by a post-acute infection syndrome, disease or condition. For example, the term “treating” in reference to a post-acute infection syndrome, disorder, disease or condition, means a reduction in severity of one or more signs and / of symptoms associated with that particular post-acute infection syndrome, disorder, disease or condition. Therefore, treating a post-acute infection syndrome, disorder, disease or condition does not necessarily mean a reduction in severity of all symptoms associated with a post-acute infection syndrome, disorder, disease or condition and does not necessarily mean aE3697-00624 Patent complete reduction in the severity of one or more signs and / or symptoms associated with a post-acute infection syndrome, disorder, disease or condition.
[0201] In some embodiments, compounds, compositions, methods, and kits of the invention are used in the treatment of a subject or a patient for one or more signs and / or symptoms of a post-acute infection syndrome.
[0202] In some embodiments, compounds, compositions, methods, and kits of the invention are used alleviation of one or more signs or symptoms of, or diminishment of one or more direct or indirect pathological consequences of a post-acute infection syndrome.
[0203] Any modulator that is capable of eliciting a desired inhibition of the passage (e.g., transport) of molecules through a connexin gap junction and / or connexin hemichannel (e.g., ATP), may be used in embodiments of the invention and dosed according to the one or more of the schedules described herein. Any connexin agents that modulates the passage of molecules through a gap junction or connexin hemichannel (e.g., a connexin 43 gap junction or connexin 43 hemichannel) are also provided in particular embodiments (e.g., those that modulate, block or lessen the passage of molecules from the cytoplasm of a cell into an extracellular space or adjoining cell cytoplasm, including ATP). Such anti-connexin modulators may modulate the passage of molecules through a gap junction or connexin hemichannel with or without gap junction uncoupling (blocking the transport of molecules through gap junctions). Such compounds include, for example, binding proteins (e.g. scFvs, antibodies, etc.), polypeptides (e.g. peptidomimetics), polynucleotides (e.g., antisense compounds) and organic compounds (e.g. tonabersat and compounds of Formula I and / or prodrugs thereof, including the tonabersat prodrugs of Formula II) that can, for example, block the function or activity of a gap junction or a hemichannel in whole or in part (e.g. by modulating release of ATP from connexin hemichannels). Chemical Connexin Hemichannel Modulators
[0204] In some embodiments, the modulator used in methods of the invention is a gap junction closing or blocking compound or hemichannel closing or blocking compound (e.g. tonabersat). In some embodiments, the modulator can be a small molecule, which may also be referred to herein as an anti-connexin or a connexin or connexin gap junction or connexin hemichannel modulator. In some embodiments, methods of the invention feature the use of compounds of Formula I, for example tonabersat and / or carabersat, to directly and immediately block Cx43 hemichannels and to cause a concentration and time-dependent reduction in GJ coupling and / or hemichannel inhibition (e.g., blocking hemichannel opening and / or modulating or blocking ATP release from connexin hemichannels). Carabersat is N-[(3R,4S)-E3697-00624 Patent 6-acetyl-3-hydroxy-2,2-dimethyl-3,4-dihydrochromen-4-yl]-4-fluorobenzamide) and is also referred to as trans-(+)-6-acetyl-4-(S)-(4-fluorobenzoylamino)-3,4-dihydro-2,2-dimethyl-2H- 1-benzo[b]pyran-3R-ol,hemihydrate. Tonabersat is also known by the IUPAC name N- [(3S,4S)-6-acetyl-3-hydroxy-2,2-dimethyl-3,4-dihydrochromen-4-yl]-3-chloro-4- fluorobenzamide or (3S-cis)-N-(6-acetyl-3,4-dihydro-3-hydroxy-2,2-(dimethyl-d6)-2H-1- benzopyran-4-yl)-3-chloro-4-fluorobenzamide).
[0205] In some embodiments, the anti-connexin or connexin or connexin gap junction or connexin hemichannel modulator is a compound according to Formula I:
[0206] wherein Y is C—R1;
[0207] R1 is acetyl;
[0208] R2 is hydrogen, C3-8 cycloalkyl, C1-6 alkyl optionally interrupted by oxygen or substituted by hydroxy, C1-6alkoxy or substituted aminocarbonyl, C1-6alkylcarbonyl, C1-6alkoxycarbonyl, C1-6alkylcarbonyloxy, C1-6alkoxy, nitro, cyano, halo, trifluoromethyl, or CF3-S-; or a group CF3-A-, where A is —CF2—,—CO—, —CH2—, CH(OH), SO2, SO, CH2— O, or CONH; or a group CF2H-A′- where A′ is oxygen, sulphur, SO, SO2, CF2 or CFH; trifluoromethoxy, C1-6alkylsulphinyl, perfluoro C2-6alkylsulphonyl, C1-6alkylsulphonyl, C1-6 alkoxysulphinyl, C1-6 alkoxysulphonyl, aryl, heteroaryl, arylcarbonyl, heteroarylcarbonyl, phosphono, arylcarbonyloxy, heteroarylcarbonyloxy, arylsulphinyl, heteroarylsulphinyl, arylsulphonyl, or heteroarylsulphonyl in which any aromatic moiety is optionally substituted, C1-6 alkylcarbonylamino, C1-6 alkoxycarbonylamino, C1-6 alkyl-thiocarbonyl, C1-6 alkoxy- thiocarbonyl, C1-6 alkyl-thiocarbonyloxy, 1-mercapto C2-7 alkyl, formyl, or aminosulphinyl, aminosulphonyl or aminocarbonyl, in which any amino moiety is optionally substituted by one or two C1-6alkyl groups, or C1-6alkylsulphinylamino, C1-6alkylsulphonylamino, C1-6 alkoxysulphinylamino or C1-6 alkoxysulphonylamino, or ethylenyl terminally substituted byE3697-00624 Patent C1-6alkylcarbonyl, nitro or cyano, or —C(C1-6alkyl)NOH or —C(C1-6alkyl)NNH2; or amino optionally substituted by one or two C1-6 alkyl or by C2-7 alkanoyl;
[0209] one of R3 and R4 is hydrogen or C1-4 alkyl and the other is C1-4 alkyl, CF3, or CH2Xa, where Xais fluoro, chloro, bromo, iodo, C1-4alkoxy, hydroxy, C1-4alkylcarbonyloxy, —S—C1-4 alkyl, nitro, amino optionally substituted by one or two C1-4 alkyl groups, cyano or C1-4 alkoxycarbonyl; or R3 and R4 together are C2-5 polymethylene optionally substituted by C1-4alkyl;
[0210] R5 is C1-6 alkylcarbonyloxy, benzoyloxy, ONO2, benzyloxy, phenyloxy or C1- 6 alkoxy and R6 and R9 are hydrogen or R5 is hydroxy and R6 is hydrogen or C1-2 alkyl and R9 is hydrogen;
[0211] R7is heteroaryl or phenyl, both of which are optionally substituted one or more times independently with a group or atom selected from chloro, fluoro, bromo, iodo, nitro, amino optionally substituted once or twice by C1-4 alkyl, cyano, azido, C1-4 alkoxy, trifluoromethoxy and trifluoromethyl;
[0212] R8 is hydrogen, C1-6 alkyl, OR11 or NHCOR10 wherein R11 is hydrogen, C1- 6 alkyl, formyl, C1-6 alkanoyl, aroyl or aryl-C1-6 alkyl and R10 is hydrogen, C1-6 alkyl, C1-6alkoxy, mono or di C1-6alkyl amino, amino, amino-C1-6alkyl, hydroxy-C1-6alkyl, halo-C1-6 alkyl, C1-6 acyloxy-C1-6 alkyl, C1-6 alkoxycarbonyl-C1-6 alkyl, aryl or heteroaryl; the R8—N— CO—R7 group being cis to the R5 group; and
[0213] X is oxygen or NR12where R12is hydrogen or C1-6alkyl.
[0214] For any of the Markush groups set forth above, in some embodiments, each group can include or exclude any of the species listed for that group.
[0215] In some embodiments, the small molecule connexin modulator can be Tonabersat, carabersat, or SB-204269. SB-204269 is also known as (trans-(+)-6-acetyl-4S-(4- fluorobenzoylamino)-3, 4-dihydro-2,2-dimethyl-2H-benzo[b]pyran-3R-ol). Carabersat is also known as N-[(3R,4S)-6-Acetyl-3-hydroxy-2,2-dimethyl-3,4-dihydro-2H-chromen-4-yl]-4- fluorobenzamide. Tonabersat is also known as N-(6-Acetyl-3-hydroxy-2,2-dimethyl-3,4- dihydro-2H-chromen-4-yl)-3-chloro-4-fluorobenzamide.
[0216] For any of the Markush groups set forth above, that group can include or exclude any of the species listed for that group.
[0217] In some embodiments, the modulator may be a prodrug of any the compounds for use in this invention. In one aspect the connexin modulator prodrug of this invention may be a compound of Formula II:E3697-00624 Patent
[0218] wherein
[0219] Q is O or an oxime,
[0220] R2is H,
[0221] A is a direct bond, -C(O)O*-, -C(R3)(R4)O*-, -C(O)O-C(R3)(R4)O*-, or - C(R3)(R4)OC(O)O*- wherein the atom marked * is directly connected to R1,
[0222] R3and R4are selected independently from H, fluoro, C1-4alkyl, and C1-4fluoroalkyl, or R3 and R4 together with the atom to which they are attached form a cyclopropyl group,
[0223] R1is selected from groups [1], [2], [2A],[3], [4], [5] and [6] wherein the atom marked ** is directly connected to A:
[0224] Wherein R5and R6are each independently selected from H, C1-4alkyl, C1-4fluoroalkyl, and benzyl;
[0225] R7is independently selected from H, C1-4alkyl, and C1-4fluoroalkyl;
[0226] R8is selected from: (i) H, C1-4 alkyl, or C1-4 fluoroalkyl,E3697-00624 Patent (ii) the side chain of a natural or unnatural amino acid or peptide as described herein, and (iii) biotin or chemically linked to biotin;
[0227] R9is selected from H, –N(R11)(R12), –N+(R11)(R12)(R13)X-, and – N(R11)C(O)R14;
[0228] wherein R11, R12, and R13 are independently selected from H, C1-4 alkyl, and C1-4fluoroalkyl, R14 is H, C1-4 alkyl, or C1-4 fluoroalkyl, R15 is selected from C1-4 alkyl and C1-4 fluoroalkyl, and X- is a pharmaceutically acceptable anion.
[0229] In some aspects, R2 is B-R21 wherein, B is a direct bond, -C(O)O*-, -C(R23)(R24)O*, C(O)OC(R23)(R24)*, or -C(R23)(R24)OC(O)O* wherein the atom marked * is directly connected to R21, R23 and R24 are selected independently from H, fluoro, C1-4 alkyl, and C1-4 fluoroalkyl, R21 is selected from groups
[0021] ,
[0022] , [22A],
[0023] ,
[0024] ,
[0025] and
[0026] wherein the atom marked ** is directly connected to B:wherein R5, R6, R7, R8, R9, and R15 are as defined herein.
[0230] For any of the Formula II Markush groups set forth above, that group can include or exclude any of the species listed for that group.
[0231] In some aspects, the peptide as described herein can be a connexin modulator, calmodulin modulator, or pannexin modulator.
[0232] In some aspects,E3697-00624 Patent Q is an oxime of formula =NOR43, wherein R43is (i) selected from H, C1-4 fluoroalkyl or optionally substituted C1-4 alkyl, and (ii) -A300-R300 wherein A300is a direct bond, -C(O)O*-, -C(R3)(R4)O*-, -C(O)O-C(R3)(R4)O*-, or - C(R3)(R4)OC(O)O*- wherein the atom marked * is directly connected to R300, R3 and R4 are selected independently from H, fluoro, C1-4 alkyl, and C1-4 fluoroalkyl, or R3and R4together with the atom to which they are attached form a cyclopropyl group, R300 is selected from groups [1], [2], [2A], [3], [4], [5] and [6] wherein the atom marked ** is directly connected to A300:
[0233] wherein R5 and R6 are each independently selected from H, C1-4 alkyl, C1-4 fluoroalkyl, and benzyl; R7is independently selected from H, C1-4alkyl, and C1-4fluoroalkyl; R8 is selected from: (i) H, C1-4 alkyl, or C1-4 fluoroalkyl, (ii) the side chain of a natural alpha-amino acid, and (iii) biotin or chemically linked to biotin; R9 is selected from H, -N(R11)(R12), –N+(R1l)(R12)(R13)X-, and -N(R11)C(O)R14; wherein R11, R12, and R13 are independently selected from H, C1-4 alkyl, and C1-4 fluoroalkyl, R14 is H, C1-4 alkyl, or C1-4 fluoroalkyl, R15 is selected from C1-4 alkyl and C1-4 fluoroalkyl, and X- is a pharmaceutically acceptable anion.E3697-00624 Patent
[0234] In an embodiment R43is C1-4alkyl optionally substituted with a phosphate group (P(O)OR61R62). In an example of such an embodiment OR43 is -OCH2P(O)OR61OR62, wherein R61 and R62 are independently H or C1-4 alkyl.
[0235] In another embodiment of Formula II R43is an amino acid derivative having the structure C(O)CH(R100)NH2 wherein the group R100 is the side chain of a natural or unnatural amino acid or a peptide as described herein.
[0236] In one embodiment of Formula II R8is selected from: (i) H, C1-4 alkyl, or C1-4 fluoroalkyl, (ii) the side chain of a natural alpha-amino acid, and (iii) biotin or chemically linked to biotin.
[0237] In some embodiments, the natural amino acid is selected from one of the 22 canonical amino acids. In some embodiments, the unnatural amino acid is selected from any amino acid which is not one of the 22 canonical amino acids. In some embodiments, the unnatural amino acid is selected from: (cis)-3-Aminobicyclo[2.2.1]heptane-2-carboxylic acid hydrochloride, exo-cis-3-Aminobicyclo[2.2.1]hept-5-ene-2-carboxylic acid hydrochloride, cis-2-Amino-2-methylcyclohexanecarboxylic acid hydrochloride, (R)-2-(Boc- amino)octanedioic acid, Boc-4-(Fmoc-amino)-L-phenylalanine, Boc-(2-indanyl)-Gly-OH, (R)-4-Boc-3-morpholineacetic acid, (S)-4-Boc-3-morpholineacetic acid, Boc-pentafluoro- D-phenylalanine, Boc-pentafluoro-L-phenylalanine, Boc-Phe(2-Br)-OH, Boc-Phe(4-Br)-OH, Boc-D-Phe(4-Br)-OH, Boc-D-Phe(3-Cl)-OH, Boc-Phe(4-NH2)-OH, Boc-Phe(3,5-F2)-OH, 2- (4-Boc-piperazino)-2-(2-fluorophenyl)acetic acid, 2-(4-Boc-piperazino)-2-(4- fluorophenyl)acetic acid, 2-(4-Boc-piperazino)-2-phenylacetic acid, 2-(4-Boc-piperazino)-2- (3-pyridyl)acetic acid, penicillamine, thialysine, quisqualic acid, canavanine, azetidine-2- carboxylic acid, Carboxyglutamic acid, Hydroxyproline, Hypusine, and Pyroglutamic acid.
[0238] In one embodiment of Formula II OR43 is -OC(O)CH(CH(CH3)2)NH2.
[0239] For any of the Formula II Markush groups set forth above, in some embodiments, each group can include or exclude any of the species listed for that group.
[0240] In some embodiments “promoiety” refers to a species acting as a protecting group which masks a functional group within an active agent, thereby converting the active agent into a pro-drug. The active agent may be any of the modulators or ocular therapeutics disclosed herein. Typically, the promoiety will be attached to the drug via bond(s) that are cleaved by enzymatic or non-enzymatic means in vivo, thereby converting the pro-drug into its active form. In some embodiments the promoiety may also be an active agent. In someE3697-00624 Patent embodiments the promoiety may be bound to a connexin modulator, a connexin gap junction modulator, or a connexin hemichannel modulator. In some embodiments the promoiety may be bound to any of the polynucleotides, peptides or peptidomimetics, small molecule antagonists and / or other treatments disclosed herein. In some embodiments the promoeity may be bound to a compound of Formula I. In some embodiments the pro-drug may be a compound of Formula II.
[0241] In some embodiments the promoiety may be any peptidomimetic or peptide antagonist of this disclosure. In some embodiments, the promoeity is a single amino acid which is optionally protected on its functional groups. In some embodiments, the promoeity is a targeting species. In some embodiments, the promoeity is a substrate for an influx or efflux transporters on the cell membrane, for example those described in Gaudana, R. et al. The AAPS Journal, 12:3, 348-360 (2012). The promoeity can be, for example, chemically-linked biotin. The promoeity can be, for example, chemically-linked D-serine.
[0242] In some embodiments, compounds of Formula I or Formula II, e.g., tonabersat, carabersat or analogues thereof, are nonionic, are in the form of a free base, a free acid, or a pharmaceutically acceptable salt. By way of example, a pharmaceutically acceptable salt includes a hydrochloride salt and salts derived from acid including, but not limited to, hydrobromic acid, hydrochloric acid, phosphoric acid, acetic acid, fumaric acid, maleic acid, salicylic acid, citric acid, oxalic acid, lactic acid, malic acid, succinic acid, methanesulphonic acid and p-toluene sulphonic acid, a salt of itself. In one embodiment, the salt is a hydrochloride salt. In one embodiment, the salt is a succinate salt.
[0243] In other embodiments, one or more polymorph, one or more isomer, and / or one or more solvate of a compound of Formula I or Formula II, e.g., tonabersat, carabersat or analogues thereof, may be used. Peptidomimetic Connexin Hemichannel Modulators
[0244] In some embodiments, connexin modulators, including connexin, connexin gap junction and connexin hemichannel modulators, useful in methods of the invention include not only organic molecule-based connexin hemichannel modulators, but also but also connexin peptides or peptidomimetics, such as connexin 43 peptides or peptidomimetics, sometimes referred to anti-connexin peptides or peptidomimetics, e.g., anti-connexin hemichannel blocking peptides or peptidomimetics, which may be used in methods of the invention and dosed according to the one or more of the schedules described herein. They include, for example, peptides or peptidomimetic connexin modulators comprising or consisting essentially of sequences corresponding to portions of connexin extracellular domains, connexinE3697-00624 Patent transmembrane regions, and connexin carboxy-terminus regions. In some embodiments, connexin, connexin gap junction and connexin hemichannel modulators useful in methods of the invention include connexin 43 peptides or peptidomimetics with sequences according to a portion of the amino acid sequence of SEQ ID NO:100 (connexin 43 protein).
[0245] In some embodiments, the connexin modulators useful in methods of the invention for treating a disease, disorder, defect in a subject are anti-connexin 43 peptides or peptidomimetics. In some embodiments, anti-connexin 43 peptides or peptidomimetic that may be used in methods of the invention and dosed according to the one or more of the regemins described herein is a peptide comprising or consisting essentially of a portion of an extracellular domain of a connexin (e.g. connexin 43) and / or a peptide comprising or consisting essentially of a portion of a carboxy-terminal portion of a connexin (e.g. connexin 43), including those described and / or referenced herein.
[0246] The protein sequence of connexin 43 is shown below. Connexin 43 (SEQ ID NO:100) Met Gly Asp Trp Ser Ala Leu Gly Lys Leu Leu Asp Lys Val Gln Ala 1 5 10 15 Tyr Ser Thr Ala Gly Gly Lys Val Trp Leu Ser Val Leu Phe Ile Phe 20 25 30 Arg Ile Leu Leu Leu Gly Thr Ala Val Glu Ser Ala Trp Gly Asp Glu 35 40 45 Gln Ser Ala Phe Arg Cys Asn Thr Gln Gln Pro Gly Cys Glu Asn Val 50 55 60 Cys Tyr Asp Lys Ser Phe Pro Ile Ser His Val Arg Phe Trp Val Leu 65 70 75 80 Gln Ile Ile Phe Val Ser Val Pro Thr Leu Leu Tyr Leu Ala His Val 85 90 95 Phe Tyr Val Met Arg Lys Glu Glu Lys Leu Asn Lys Lys Glu Glu Glu 100 105 110 Leu Lys Val Ala Gln Thr Asp Gly Val Asn Val Asp Met His Leu Lys 115 120 125 Gln Ile Glu Ile Lys Lys Phe Lys Tyr Gly Ile Glu Glu His Gly Lys 130 135 140 Val Lys Met Arg Gly Gly Leu Leu Arg Thr Tyr Ile Ile Ser Ile Leu 145 150 155 160 Phe Lys Ser Ile Phe Glu Val Ala Phe Leu Leu Ile Gln Trp Tyr Ile 165 170 175 Tyr Gly Phe Ser Leu Ser Ala Val Tyr Thr Cys Lys Arg Asp Pro Cys 180 185 190E3697-00624 Patent Pro His Gln Val Asp Cys Phe Leu Ser Arg Pro Thr Glu Lys Thr Ile 195 200 205 Phe Ile Ile Phe Met Leu Val Val Ser Leu Val Ser Leu Ala Leu Asn 210 215 220 Ile Ile Glu Leu Phe Tyr Val Phe Phe Lys Gly Val Lys Asp Arg Val 225 230 235 240 Lys Gly Lys Ser Asp Pro Tyr His Ala Thr Ser Gly Ala Leu Ser Pro 245 250 255 Ala Lys Asp Cys Gly Ser Gln Lys Tyr Ala Tyr Phe Asn Gly Cys Ser 260 265 270 Ser Pro Thr Ala Pro Leu Ser Pro Met Ser Pro Pro Gly Tyr Lys Leu 275 280 285 Val Thr Gly Asp Arg Asn Asn Ser Ser Cys Arg Asn Tyr Asn Lys Gln 290 295 300 Ala Ser Glu Gln Asn Trp Ala Asn Tyr Ser Ala Glu Gln Asn Arg Met 305 310 315 320 Gly Gln Ala Gly Ser Thr Ile Ser Asn Ser His Ala Gln Pro Phe Asp 325 330 335 Phe Pro Asp Asp Asn Gln Asn Ser Lys Lys Leu Ala Ala Gly His Glu 340 345 350 Leu Gln Pro Leu Ala Ile Val Asp Gln Arg Pro Ser Ser Arg Ala Ser 355 360 365 Ser Arg Ala Ser Ser Arg Pro Arg Pro Asp Asp Leu Glu Ile 370 375 380
[0247] In some embodiments, connexin 43 (Cx43) and other connexin peptide modulators useful in carrying out methods of the invention include peptides such as Peptide5, i.e., VDCFLSRPTEKT (SEQ ID NO:107), as Gap19, i.e., KQIEKKFK (SEQ ID NO:108), Gap26, i.e., VCYDKSFPISHVR (SEQ ID NO:102), Gap27, a peptide called alpha connexin carboxyl terminus 1 (αCT1), and more, each targeting different binding sites with varying specificity and size. The connexin mimetic peptide Gap27, targeted to the SRPTEKTIFFI sequence (amino acids 204–214) on the second extracellular loop of Cx43 (SEQ ID NO:109), is a versatile inhibitor of connexin-mediated communication. In some embodiments the connexin 43 modulator may comprise or consist essentially of, for example, a peptide or peptidomimetic comprising or consisting essentially of SRPTEKTIF (SEQ ID NO:110).
[0248] In addition to Peptide5, Gap19, Gap 26, and Gap 27, another peptidomimetic particularly useful in the compositions, doses and dosing methods and schedules, kits and articles of manufacture disclosed herein is the fusion peptide designated XG19, i.e.,E3697-00624 Patent lclrpvGGKQIEIKKFK, wherein lower case denotes the D-isomer [SEQ ID NO:111]). The XG19 peptidomimetic and its connexin modulation actions are described in US Patent No. 11,466,069, incorporated in its entirety herein by reference, as noted above.
[0249] In some embodiments, the invention provides compositions for use in the methods of the invention for treating a subject or a patient disease, or administration to a subject (e.g., in a laboratory) comprising a construct comprising (a) a targeting carrier peptide derived from the X-protein of the Hepatitis B virus and (b) a peptide capable of interacting with an intracellular domain of a connexin. In some embodiments, the targeting carrier peptide derived from the X-protein of the Hepatitis B virus comprises an amino acid sequence selected from the group consisting of all targeting carrier peptide described in US Patent No. 11,466,069. In some embodiments, the peptide capable of interacting with an intracellular domain interacts with the intracellular domain of one or more of connexin Cx26, Cx30, Cx30.3, Cx31.1, Cx32, Cx36, Cx37, Cx40, Cx43, Cx45, Cx50 and Cx58, including those described herein. In some embodiments, the peptide capable of interacting with an intracellular domain interacts with the intracellular domain of connexin 43. In some embodiments, the peptide capable of interacting with the intracellular domain of connexin 43 includes any of the connexin 43 intracellular interacting peptides described in US Patent No.11,466,069, as well as those peptides described herein that interact with the intracellular domain of connexin 43.
[0250] In some embodiments, the connexin 43 modulators which may be used in methods of the invention can comprise peptides having a sequence comprising or consisting essentially of, for example, one or more of the following sequences: “Peptide 1” ADCFLSRPTEKT (SEQ ID NO: 112), “Peptide 2” VACFLSRPTEKT (SEQ ID NO: 113), “Peptide 11” VDCFLSRPTAKT (SEQ ID NO: 114), “Peptide 12” VDCFLSRPTEAT (SEQ ID NO: 115), “Peptide 5” VDCFLSRPTEKT (SEQ ID NO: 107), “Mod1” CFLSRPTEKT (SEQ ID NO: 116) and “Mod2” LSRPTEKT (SEQ ID NO: 117). In some embodiments, the carboxy-terminus of an anti-connexin peptide or peptidomimetic modulator can be modified. In some embodiments, the carboxy-terminus modification can comprise n-alkyl chains which can optionally be further linked to hydrogen or other moieties. In some embodiments, the connexin 43 peptides can include or exclude any of the peptides listed above or disclosed herein.
[0251] In some embodiments, the peptide or peptidomimetic comprises or consists essentially of from 7 to 40 amino acids of a connexin including, e.g., SEQ ID NO: 101 (SRPTEKT), SEQ ID NO: 107 (VDCFLSRPTEKT) and does not comprise a connexin C- terminal peptide.E3697-00624 Patent
[0252] Anti-connexin agents include peptides having an amino acid sequence that comprises about 5 to 20 contiguous amino acids of a connexin protein such as connexin 43 (SEQ ID NO:100), peptides having an amino acid sequence that comprises about 8 to 15 contiguous amino acids of connexin 43, or peptides having an amino acid sequence that comprises about 11 to 13 contiguous amino acids of connexin 43. Other anti-connexin agents include a peptide having an amino acid sequence that comprises at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, at least about 10, at least about 11, at least about 12, at least about 13, at least about 14, at least about 15, at least about 20, at least about 25, or at least about 30 contiguous amino acids of connexin 43. Other anti-connexin 43 modulators comprise the extracellular domains of connexin 43, for example, peptide or peptidomimetic comprising or consisting essentially of SRPTEKT (SEQ ID NO: 101) or VDCFLSRPTEKT (SEQ ID NO: 107).
[0253] In other anti-connexin compounds, mimetic peptides are based on the extracellular domains of connexin 43 corresponding to the amino acids at positions 37-76 and 178-208 of connexin 43 protein sequence. Thus, certain anti-connexin peptides useful in methods of the invention have an amino acid sequence comprising or consisting essentially of about 7 to about 40 of the amino acids corresponding to the regions at positions 37-76 and 178- 208 of the connexin 43 protein sequence. The peptides need not have an amino acid sequence identical to those portions of the connexin 43 protein sequence, and conservative amino acid changes may be made such that the peptides retain binding activity or functional activity in the assays described herein and otherwise known in the art. In other embodiments, mimetic peptides are based on peptide target regions within the connexin protein other than the extracellular domains (e.g. portions of the connexin 43 protein sequence not corresponding to positions 37-76 and 178-208).
[0254] In addition to therapeutically effective modified or unmodified peptide or peptidomimetics comprising or consisting essentially of a portion of an extracellular or transmembrane domain or C-terminal domain of a connexin 43, for example, other embodiments include modified or unmodified peptides or peptidomimetics comprising or consisting essentially of a portion of, for example, an extracellular or transmembrane domain of one or more other target connexins may be used in methods of the invention described herein. Other embodiments include modified or unmodified peptides or peptidomimetics comprising or consisting essentially of, for example, a portion of an extracellular or transmembrane domain of one or more other connexins found in blood vessels (e.g. endothelium, etc.), cells of a target organ (e.g., kidney, liver, eye, brain, skin, etc.).E3697-00624 Patent
[0255] In some embodiments, the anti-connexin peptidomimetic useful in a method of the invention is a connexin 45 peptidomimetic modulator comprising portions of the connexin 45 protein that antagonize or inhibit or block connexin-connexin interactions. In some embodiments the connexin 45 modulator may comprise, for example, a peptide or peptidomimetic comprising or consisting essentially of a portion of the E2 or C terminal domain of connexin 45, for example, comprising SRPTEKT (SEQ ID NO: 101). The peptide or peptidomimetic may also comprise, for example DCFISRPTEKT (SEQ ID NO: 118). Exemplary peptide sequences for connexin 45 peptides and peptidomimetic modulators useful in methods of the invention are also provided in Table 63 of US Patent No. 10,465,188.
[0256] In some embodiments, a connexin modulator comprises a peptide comprising an amino acid sequence corresponding to a portion of a transmembrane region of connexin 45 or a C-terminal region of connexin 45. In particular non-limiting embodiments, for example, the anti-connexin compound is a peptide having an amino acid sequence that comprises about 3 to about 30 contiguous amino acids of the known connexin 45 sequence, a peptide having an amino acid sequence that comprises about 5 to about 20 contiguous amino acids of the known connexin 45 sequence, a peptide having an amino acid sequence that comprises about 8 to about 15 contiguous amino acids of the known connexin 45 sequence, or a peptide having an amino acid sequence that comprises about 11, 12, or 13 contiguous amino acids of the known connexin 45 sequence. Other non-limiting embodiments include an anti-connexin compound that is a peptide having an amino acid sequence that comprises at least about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, or 30 contiguous amino acids of a known connexin 45 sequence. In certain anti-connexin compounds provided herein, mimetic peptides are based on the extracellular domains of connexin 45 corresponding to the amino acids at positions 46-75 and 199-228 of a known connexin 45 sequence. Thus, certain peptide described herein have an amino acid sequence corresponding to the regions at positions 46-75 and 199-228 of a known connexin 45 sequence. The peptides need not have an amino acid sequence identical to those portions of known connexin 45 sequence, and conservative amino acid changes may be made such that the peptides retain binding activity or functional activity in the assays described herein and otherwise known in the art. In other embodiments, mimetic peptides are based on peptide target regions within the connexin protein other than the extracellular domains (e.g. portions of a known connexin 45 sequence not corresponding to positions 46-75 and 199-228). See WO2006 / 134494, disclosing various connexin sequences.E3697-00624 Patent
[0257] Some peptidomimetic connexin modulators useful in methods of the invention include VDCFLSRPTEKT (SEQ ID NO: 107) and SRPTEKTIFII (SEQ ID NO: 104), which bind, for example, to the Cx43 extracellular domain.
[0258] In some embodiments, the connexin 26 peptidomimetic connexin modulator useful in a method of the invention and dosed according to the one or more of the schedules described herein is Gap26. In other embodiments, the anti-connexin peptidomimetic for use in a method of the invention is a connexin32 peptidomimetic (e.g. INCTLQPGCNSV (SEQ ID NO: 103) or32Gap27, i.e., SRPTEKTIFII (SEQ ID NO:104) or a connexin50 peptidomimetic (e.g. TAT-Cx50L2, i.e., GGERAPLAADQGSVKKSSSSSKGTKK (SEQ ID NO:105) or TAT-Cx50CT, i.e., SRARSDDLTV (SEQ ID NO:106)).
[0259] In some embodiments, peptides and peptidomimetics include peptides and peptidomimetics useful for the inhibition of gap junction channels and hemichannels corresponding to specific sequences within extracellular loops E1 and E2 involving the conserved QPG and SHVR motifs of E1 (Gap26 peptide) and the SRPTEK motif in E2 (Gap27 peptide) as well as the cytoplasmic loop (Gap19 peptide). Useful peptidomimetic connexin modulators are described in US Patent No.9,248,141 (“Methods of treatment by administering anti-connexin peptides and mimetics”). Other useful peptide connexin modulators are described in US Patent No. 11,466,069 (“Methods of treatment and novel constructs”), including XG19 and other constructs comprising a targeting carrier peptide derived from the X-protein of the Hepatitis B virus and a peptide capable of interacting with an intracellular domain of a connexin (e.g. connexin 43).
[0260] Other connexin peptide modulators useful in methods of the invention are provided in Table 64 of US Patent No. 10,465,188. Useful peptide modulators of connexin 43 (Cx43) and other connexins that may be dosed in embodiments of the invention are also referenced in Caufriez, A., et al., Expert Opinion on Drug Discovery 15(10):1213-1222 (2020), and in King, DR, et al., Mechanisms of Connexin Regulating Peptides Int. J. Mol. Sci. 22:10186 (Sept 2021) (see, e.g., Figure 1 (“Schematic of the Cx43 protein in the plasma membrane with colored lines indicating the positions of described peptides targeting EL, IL and CT regions”) and Table 1 (“Connexin regulating peptides”).
[0261] In some embodiments the peptides may also be used as promoieties. See, e.g. Vig, BS, et al., Amino acids as promoieties in drug design and Development. Advanced Drug Delivery Reviews 65(10): p 1370-1385 (2013); Dhokchawle, B, et al., Promoieties Used In Prodrug Design: A Review. Indian Journal of Pharmaceutical Education 48(2):35-40 (2013).E3697-00624 Patent
[0262] Connexin hemichannel-blocking or modulating peptides or peptidomimetics may be unmodified, or modified as desired (e.g. to increase stability, to further stabilize peptide conformation, increase bioactivity, increase cell permeability, etc.). See e.g. DeGruyter, JN, et al., Residue-Specific Peptide Modification: A Chemist’s Guide. Biochemistry 56, 30, 3863- 3873 (2017); Boto, A, et al. Site-selective modification of peptide backbones. Org. Chem. Front. 8:6720-6759 (2021) (review article). Thus, for example, peptidomimetics used in methods of the invention may contain one or more modified amino acids, amino acid analogs, or may be otherwise modified to improve bioavailability or to increase penetration across the cell membrane.
[0263] Other peptide sequences known to inhibit the inter-connexin binding that can regulate connexin activity are the cytoplasmic loop of connexin 43 (amino acids 119–144) L2 peptide and subparts of the L2 peptide of connexin 43. In some embodiments, these peptides may include or exclude, for example, the nine amino acid sequence of Gap19, KQIEIKKFK (SEQ ID NO: 108); the native Gap19 sequence, DGVNVEMHLKQIEIKKFKYGIEEHGK (SEQ ID NO: 119); the His144→Glu L2 derivative of Gap19, as reported by Shibayama (Shibayama, J. et al., Biophys. J. 91, 405404063, 2006), DGVNVEMHLKQIEIKKFKYGIEEQGK (SEQ ID NO: 120); the TAT-Gap19 sequence, YGRKKRRQRRRKQIEIKKFK (SEQ ID NO: 121); the SH3 binding domain, CSSPTAPLSPMSPPGYK (SEQ ID NO: 122), or subpart thereof PTAPLSPMSPP (SEQ ID NO: 123); the C-terminal sequence of the CT9 or CT10 peptide, with or without a TAT leader sequence to increase cell penetration, for example, RPRDDEI (CT9; SEQ ID NO: 124), SRPRDDLEI (CT10; SEQ ID NO: 125), YGRKKRRQRRRSRPRDDEI (TAT-CT9; SEQ ID NO: 126), or YGRKKRRQRRRRPRDDEI (TAT-CT10; SEQ ID NO: 127). Other peptidomimetic sequences that can be included or excluded in the compositions, methods, kits or articles of manufacture disclosed herein are those reported by Dhein (Dhein, S., Naunyn- Schmiedeberg’s Arch. Pharm., 350: 174-184, 1994); the AAP10 peptide, H2N-Gly-Ala-Gly- 4Hyp-Pro-Tyr-CONH2(SEQ ID NO: 128), and the ZP123 peptide (rotigapeptide), Ac-D-Tyr- Pro-D-4Hyp-Gly-D-Ala-Gly-NH2 (SEQ ID NO: 129), (Dhein, S., et al. Cell Commun. Adhes. 10, 371-378, 2013). Rotigapeptide is comprised of the D-form of the peptides for enhanced efficacy over the native L-form of the peptide.
[0264] In some embodiments, the therapeutically effective modified or unmodified peptide or peptidomimetic comprises a portion of the E1 extracellular domain of a connexin, such as the connexin 43 E1 (ESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVR; SEQ ID NO:130) or the connexin 45 E1E3697-00624 Patent (GESIYYDEQSKFVCNTEQPGCENVCYDAFAPLSHVR; SEQ ID NO:131). In some embodiments, the therapeutically effective modified or unmodified peptide or peptidomimetic comprises a portion of the E2 extracellular domain of a connexin, such as the connexin 43 E2 (LLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKT; SEQ ID NO:132) or the connexin 45 E2 (LIGQYFLYGFQVHPFYVCSRLPCHPKIDCFISRPTEKT; SEQ ID NO:133).
[0265] In certain embodiments, the connexin 43 modulator peptides of the present invention can be linked at the amino or carboxy terminus to a cellular internalization transporter. The cellular internalization transporter linked to connexin 43 modulator peptides of the present invention may be any internalization sequence known or newly discovered in the art, or conservative variants thereof. Non-limiting examples of cellular internalization transporters and sequences include antennapedia sequences, TAT, HIV-Tat, Penetratin, Antp- 3A (Antp mutant), Buforin II, Transportan, MAP (model amphipathic peptide), K-FGF, Ku70, Prion, pVEC, Pep-1, SynB1, Pep-7, HN-1, BGSC (Bis-Guanidinium-Spermidine-Cholesterol, and BGTC (BisGuanidinium-Tren-Cholesterol). Cellular internalization transporters are useful for peptidomimetics such as Gap19 and the aCT peptides. The sequences of exemplary cellular internalization peptides are known in the art. See, e.g., Table 65 in US Patent No. 10,465,188; US Patent No. 11,466,069.
[0266] In other embodiments, the peptide or peptidomimetic may be modified to increase transfection uptake by conjugating the peptide to a hydrophobic compound, in some embodiments, through a linker moiety. The hydrophobic compound may be, for example, one or more n-alkyl groups, which may be, for example, C6-C14 alkyl groups. In some embodiments, the peptides may be conjugated at the N terminus to one or two dodecyl (C12) groups as described in Chen, YS et al., J.Pharm. Sci., 102: 2322-2331 (2013). In one embodiment, the peptide sequence CFLSRPTEKT (SEQ ID NO:116) or VDCFLSRPTEKT (SEQ ID NO:107) can be conjugated to two dodecyl groups to create a modified peptide which can modulate connexin 43, “C12-C12-Cxn43 MP.” See SEQ ID NO: 326 in US Patent No. 10,465,188.
[0267] In some embodiments, the therapeutically effective modified or unmodified peptide or peptidomimetic comprises a portion of the C-terminal domain of a connexin, such as connexin 43 or connexin 45, preferably connexin 43. Some embodiments of anti-connexin 43 modulators useful in methods of the invention comprise the C-terminus region of connexin 43, or modified versions thereof. See, e.g., O’Quinn, MP, et al., A Peptide Mimetic of the Connexin43 Carboxyl-Terminus Reduces Gap Junction Remodeling and Induced ArrhythmiaE3697-00624 Patent Following Ventricular Injury. Circ Res. 108(6): 704-715 (Mar 2011). C-terminus connexin peptidomimetic modulators, including αCT1 (alpha connexin carboxy terminus 1) peptides (also referred to as aCT1 or ACT1 peptides in publications), are described, for example, in Montgomery et al., Connexin 43-Based Therapeutics for Dermal Wound Healing Int. J. Mol. Sci. 2018, 19, 1778, and US Patent No. 8,815,556 (“Compositions and methods for tissue engineering, tissue regeneration and wound healing”). See also WO2006 / 069181. Preferred connexin carboxy-terminal polypeptides are connexin 43 carboxy-terminal polypeptides. Such compounds are described in US Patent Publication No. 20070042964 (“Compositions and methods for modulating connexin hemichannels”). If a connexin peptide or peptidomimetic modulator comprises a portion of an intracellular domain of a connexin (e.g. an aCT peptide, such as CT9, CT10, αCT1, etc.), the peptide may be conjugated to a cell internalization transporter including those noted or referenced herein. In some embodiments, a connexin peptidomimetic modulator useful in methods of then invention may block zona occludens (ZO- 1) binding to connexin 43 and modulate connexin gap junctions and hemichannels to advantage. See Figure 2 in Caufriez, A, et al. Peptide-based targeting of connexins and pannexins for therapeutic purposes. Expert Opinion on Drug Discovery 15(10):1213-1222 (2020).
[0268] In some embodiments, the connexin modulator may be a gap junction closing compound and / or hemichannel closing compound. In some embodiments, the gap junction closing compounds and hemichannel closing compounds are connexin 43 gap junction closing compounds and connexin 43 hemichannel closing compounds (e.g. a Cx43 C-terminus peptidomimetic).
[0269] Various useful peptidomimetic peptides mimic sequences of connexin extracellular regions. The first extracellular loops of Cx37, Cx40 as well Cx43 are mimicked by peptides under the Gap26 code. Gap27 and Peptide5 mimic regions of the second extracellular loop. Gap27 targets Cx32, Cx40 and Cx43, while Peptide5 is used for Cx43 inhibition. JM2, ΔSH3, CT9, CT10, αCT mimic the C-terminal tail of Cx43 and Gap24 reproduces a sequence of the cytoplasmic loop of Cx32. Both L2 and Gap19 also mimic the cytoplasmic loop but of Cx43.
[0270] The extracellular loops of connexin hemichannels are also good targets for peptidomimetic connexin modulators useful in the invention due to their accessibility in contrast to their full channel counterparts. Nevertheless, peptides containing the conserved motives QPG and SHVR of the first extracellular loop and the SRPTEK motif of the secondE3697-00624 Patent extracellular loop interfere with the formation of gap junctions. This led to the development ofpeptide mimetics43Gap26,37,40Gap26,32Gap27,40Gap27,43Gap27 and43Peptide5 (notethat the superscript in the nomenclature of these peptide analogues refers to Cx subtypes they can target).
[0271] The conserved SHVR motif of the first extracellular loop is incorporated in the sequence of useful Gap26 peptide mimetics. The two slightly different sequences are both categorized under the Gap26 code, one targeting Cx37 and Cx40, and the other targeting only Cx43. Cells treated with either of these Gap26 peptides showed Cx hemichannel inhibition within minutes.
[0272] There are three Gap27 peptides, each targeting different Cx types, namely Cx32, Cx40 and Cx43 that are useful in compositions and methods of the invention. These peptides mimic the conserved SRPTEK motif of the second extracellular loop, but have the same time- dependent effect on gap junction activity as Gap26. Like Gap27, Peptide5 contains the SRPTEK motif. However, the mimicked sequence of Peptide5 is shifted in the direction of the N-terminal tail in comparison to that of Gap27. Peptide5 can inhibit Cx43 hemichannels at a concentration of 5–10 μM, but incubation at higher concentration (100 μM or higher) can also leads to inhibition of gap junctions in some circumstances.
[0273] Other peptides useful in compositions and methods of the invention mimic sequences of connexin intracellular regions. The interaction between the cytoplasmic loop and C-terminal tail mediates the gating mechanism of connexin hemichannels and gap junctions. Gap junctions are in an open state when there is no interaction between the C-terminal tail and cytoplasmic loop, while such interaction is critical for connexin hemichannel opening. The CT10 peptidomimetic reproduces the last 10 amino acids of the C-terminal tail of Cx43. Inhibition of connexin 43- (Cx43)-mediated ATP release by a peptide mimetic, called TAT- L2, pinpointed its mimicked L2 region (amino acid 119 to 144) as an essential sequence of the cytoplasmic loop in the interaction with the Cx43 C-terminal tail. To date, 2 peptides mimicking the L2 region are available, namely43Gap19 and32Gap24.43Gap19 inhibits Cx43 hemichannel currents by binding to the C-terminal tail, thereby inhibiting the cytoplasmic loop / C-terminal tail interaction.43Gap19 has the advantage of being a selective inhibitor, as it does not affect gap junction or Panx1 channel activity.32Gap24 is a peptide that mimics a 13 amino acid long stretch of the L2 region of Cx32 and can also be used in methods of the invention. Cx32 is one of the ten human corneal epithelial connexin that can be usefullyE3697-00624 Patent targeted as described herein. In vitro studies showed that Cx32 hemichannel-mediated ATP release is inhibited by32Gap24 at concentrations of 17 μM without affecting gap junctions.
[0274] Peptides targeting intracellular regions of connexin proteins need to access the intracellular environment. Cell-penetrating peptides for this purpose are described herein (e.g. the TAT-peptide, an oligoarginine tag and the Xentry peptide), and can be anchored to connexin-derived peptide sequences in order to enhance the uptake into the cell via endocytosis.43Gap19 can enter the cell on its own due to the KKFK cell-translocation motif of the L2 region. Nonetheless, comparison of the IC50(half maximal inhibitory concentration) of43Gap19 itself (47 μM) and TAT-43Gap19 (7 μM) for the inhibition of ATP release in glioma cells showed that the entry of43Gap19 into the cell can be improved by linking to a TAT-tag. All 5 available peptides mimicking the C-terminal tail are derived from Cx43.
[0275] The αCT1 peptidomimetic mimics the last 9 amino acids of Cx43 and is linked to an antennapedia sequence that facilitates cellular internalization of the peptide mimetic. The interaction between Cx43 and the PDZ-domain of ZO-1, a region that is suggested to be involved in the regulation of Cx trafficking and gap junction assembly, is disrupted by αCT1. This interference reportedly leads to increased gap junction plaque formation and decreased Cx hemichannel activity.
[0276] If a peptide or peptidomimetic modulator comprises a portion of an intracellular domain of a connexin, the peptide may, in some embodiments, be conjugated to a cell internalization transporter and may, in some instances, block zona occludens (ZO-1) binding to connexin 43.
[0277] In some embodiments of this invention, the connexin modulator is a peptide or peptidomimetic shown in Table II below (E2 and T2 refer to the location of a peptide in, for example, the second extracellular domain or the second transmembrane domain). Table IIE3697-00624 PatentE3697-00624 PatentE3697-00624 PatentE3697-00624 Patent
[0278] In some embodiments the connexin 43 modulator may comprise, for example, a peptide or peptidomimetic comprising, for example SEQ ID NO: 101 (SRPTEKT). The peptide or peptidomimetic may also comprise, for example SEQ ID NO: 107 (VDCFLSRPTEKT). The peptide may contain one or more modified amino acids, amino acidE3697-00624 Patent analogs, or may be otherwise modified to improve bioavailability or to increase penetration across the cell membrane. For example, SEQ ID NO: 107 may be modified to obtain SEQ ID NOS:177-191. In some embodiments, the peptide or peptidomimetic comprising, for example SEQ ID NO: 101 (SRPTEKT) or SEQ ID NO: 107 (VDCFLSRPTEKT) comprises from 7 to 40 amino acids or amino acid analogues and does not comprise a C-terminal peptide. In some embodiments the peptides may also be used as promoieties.
[0279] In some embodiments, the Connexin 45 modulators can be peptide or peptidomimetics comprising portions of the Connexin 45 protein that antagonize or inhibit or block connexin-connexin interactions. Exemplary peptide sequences for Connexin 45 peptides and peptidomimetic modulators are provided in Table III. TABLE III. SEQUENCES OF CONNEXIN 45 MODULATOR PEPTIDES OR PEPTIDOMIMETICSE3697-00624 PatentE3697-00624 Patent
[0280] In some embodiments the connexin 45 modulator may comprise, for example, a peptide or peptidomimetic comprising, a portion of the E2 or C terminal domain of connexinE3697-00624 Patent 45, for example, comprising SEQ ID NO: 101 (SRPTEKT). The peptide or peptidomimetic may also comprise, for example SEQ ID NO: 118 (DCFISRPTEKT). In some embodiments the peptides may only be 3 amino acids in length, including SRL, PCH, LCP, CHP, IYY, SKF, QPC, VCY, APL, HVR, or longer.
[0281] When specific proteins are referred to herein, derivatives, variants, and fragments are contemplated and included. Protein derivatives and variants are well understood to those of skill in the art and can involve insertional, substitutional or deletional amino acid sequence variants known in the art.
[0282] The gap junction modulators and anti-connexin hemichannel blocking peptides or peptidomimetics are made chemically, synthetically, or otherwise manufactured. Antisense Connexin Hemichannel Modulators
[0283] A gap junction and / or connexin polynucleotide or oligonucleotide may be selected, for example, from modified or unmodified connexin polynucleotides or oligonucleotides (e.g. modified or unmodified connexin 43 antisense polynucleotides or oligonucleotides). In some embodiments, the modified connexin antisense polynucleotides, or oligonucleotides or polynucleotides comprise mixtures of modified and unmodified nucleotides. In some embodiments, the connexin 43 antisense compound used in the methods herein is an antisense oligonucleotide comprising naturally occurring nucleobases and an unmodified internucleoside linkage.
[0284] In some embodiments, the connexin 43 antisense compound is targeted to at least about 8 nucleobases of a nucleic acid molecule encoding a connexin having a nucleobase sequence selected from SEQ ID NO:17. The polynucleotides and oligonucleotides, for example, connexin 43 antisense compounds, may have from about 8 to about 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, or about 80 nucleotides of SEQ ID NO:17, or a sequence complementary thereto, and / or the antisense polynucleotide or oligonucleotide may contain any range of lengths between any two of the recited lengths. The polynucleotides of this invention include synthesized polynucleotides having a length of less than 80 nucleotides, e.g., from 12-18 to about 50-80 nucleotides, preferably about 30 nucleotides or less, e.g., from 12 to about 30 nucleotides, and more preferably from about 15 to about 30 nucleotides. In one example, the polynucleotide has 30 nucleotides. The methods of this invention features, in some embodiments, the use of connexin 43 antisense compounds up to 40 nucleotides in length, for example, 15 to 40 nucleotides in length, comprising or consisting essentially of a nucleotide sequence selected from SEQ ID NO:1-17. The methods of this invention features, in someE3697-00624 Patent embodiments, the use of connexin 43 antisense compounds up to 40 nucleotides in length, for example, 15 to 40 nucleotides in length, comprising a nucleotide sequence selected from SEQ ID NO:4-17.
[0285] Human Cx 43, α1 (SEQ ID NO: 17) LOCUS NM_000165 3088 bp mRNA linear PRI 26-OCT-2004 DEFINITION Homo sapiens gap junction protein, alpha 1, 43kDa (connexin 43) (GJA1), mRNA. 1 acaaaaaagc ttttacgagg tatcagcact tttctttcat tagggggaag gcgtgaggaa 61 agtaccaaac agcagcggag ttttaaactt taaatagaca ggtctgagtg cctgaacttg 121 ccttttcatt ttacttcatc ctccaaggag ttcaatcact tggcgtgact tcactacttt 181 taagcaaaag agtggtgccc aggcaacatg ggtgactgga gcgccttagg caaactcctt 241 gacaaggttc aagcctactc aactgctgga gggaaggtgt ggctgtcagt acttttcatt 301 ttccgaatcc tgctgctggg gacagcggtt gagtcagcct ggggagatga gcagtctgcc 361 tttcgttgta acactcagca acctggttgt gaaaatgtct gctatgacaa gtctttccca 421 atctctcatg tgcgcttctg ggtcctgcag atcatatttg tgtctgtacc cacactcttg 481 tacctggctc atgtgttcta tgtgatgcga aaggaagaga aactgaacaa gaaagaggaa 541 gaactcaagg ttgcccaaac tgatggtgtc aatgtggaca tgcacttgaa gcagattgag 601 ataaagaagt tcaagtacgg tattgaagag catggtaagg tgaaaatgcg aggggggttg 661 ctgcgaacct acatcatcag tatcctcttc aagtctatct ttgaggtggc cttcttgctg 721 atccagtggt acatctatgg attcagcttg agtgctgttt acacttgcaa aagagatccc 781 tgcccacatc aggtggactg tttcctctct cgccccacgg agaaaaccat cttcatcatc 841 ttcatgctgg tggtgtcctt ggtgtccctg gccttgaata tcattgaact cttctatgtt 901 ttcttcaagg gcgttaagga tcgggttaag ggaaagagcg acccttacca tgcgaccagt 961 ggtgcgctga gccctgccaa agactgtggg tctcaaaaat atgcttattt caatggctgc 1021 tcctcaccaa ccgctcccct ctcgcctatg tctcctcctg ggtacaagct ggttactggc 1081 gacagaaaca attcttcttg ccgcaattac aacaagcaag caagtgagca aaactgggct 1141 aattacagtg cagaacaaaa tcgaatgggg caggcgggaa gcaccatctc taactcccat 1201 gcacagcctt ttgatttccc cgatgataac cagaattcta aaaaactagc tgctggacat 1261 gaattacagc cactagccat tgtggaccag cgaccttcaa gcagagccag cagtcgtgcc 1321 agcagcagac ctcggcctga tgacctggag atctagatac aggcttgaaa gcatcaagat 1381 tccactcaat tgtggagaag aaaaaaggtg ctgtagaaag tgcaccaggt gttaattttg 1441 atccggtgga ggtggtactc aacagcctta ttcatgaggc ttagaaaaca caaagacatt 1501 agaataccta ggttcactgg gggtgtatgg ggtagatggg tggagaggga ggggataaga 1561 gaggtgcatg ttggtattta aagtagtgga ttcaaagaac ttagattata aataagagtt 1621 ccattaggtg atacatagat aagggctttt tctccccgca aacaccccta agaatggttc 1681 tgtgtatgtg aatgagcggg tggtaattgt ggctaaatat ttttgtttta ccaagaaact 1741 gaaataattc tggccaggaa taaatacttc ctgaacatct taggtctttt caacaagaaa 1801 aagacagagg attgtcctta agtccctgct aaaacattcc attgttaaaa tttgcacttt 1861 gaaggtaagc tttctaggcc tgaccctcca ggtgtcaatg gacttgtgct actatatttt 1921 tttattcttg gtatcagttt aaaattcaga caaggcccac agaataagat tttccatgca 1981 tttgcaaata cgtatattct ttttccatcc acttgcacaa tatcattacc atcacttttt 2041 catcattcct cagctactac tcacattcat ttaatggttt ctgtaaacat ttttaagaca 2101 gttgggatgt cacttaacat tttttttttt tgagctaaag tcagggaatc aagccatgct 2161 taatatttaa caatcactta tatgtgtgtc gaagagtttg ttttgtttgt catgtattgg 2221 tacaagcaga tacagtataa actcacaaac acagatttga aaataatgca catatggtgt 2281 tcaaatttga acctttctca tggatttttg tggtgtgggc caatatggtg tttacattat 2341 ataattcctg ctgtggcaag taaagcacac tttttttttc tcctaaaatg tttttccctg 2401 tgtatcctat tatggatact ggttttgtta attatgattc tttattttct ctccttttttE3697-00624 Patent 2461 taggatatag cagtaatgct attactgaaa tgaatttcct ttttctgaaa tgtaatcatt 2521 gatgcttgaa tgatagaatt ttagtactgt aaacaggctt tagtcattaa tgtgagagac 2581 ttagaaaaaa tgcttagagt ggactattaa atgtgcctaa atgaattttg cagtaactgg 2641 tattcttggg ttttcctact taatacacag taattcagaa cttgtattct attatgagtt 2701 tagcagtctt ttggagtgac cagcaacttt gatgtttgca ctaagatttt atttggaatg 2761 caagagaggt tgaaagagga ttcagtagta cacatacaac taatttattt gaactatatg 2821 ttgaagacat ctaccagttt ctccaaatgc cttttttaaa actcatcaca gaagattggt 2881 gaaaatgctg agtatgacac ttttcttctt gcatgcatgt cagctacata aacagttttg 2941 tacaatgaaa attactaatt tgtttgacat tccatgttaa actacggtca tgttcagctt 3001 cattgcatgt aatgtagacc tagtccatca gatcatgtgt tctggagagt gttctttatt 3061 taaagtt ttaatttagt ataaacat
[0286] Modified oligonucleotides may comprise, for example, one or more of the following selected components: a modified internucleoside linkage, for example, a phosphorothioate linkage, and / or a modified sugar moiety, for example, a conformationally- strained sugar, for example, a Linked Nucleic Acid (LNA) or Bridged Nucleic Acid (BNA).
[0287] The chemical modification of the antisense polynucleotides disclosed or referenced herein may enhance their resistance to nucleases and may enhance their ability to enter cells. For example, phosphorothioate oligonucleotides may be used. Other deoxynucleotide analogs include methylphosphonates, phosphoramidates, phosphorodithioates, N3’P5’-phosphoramidates and oligoribonucleotide phosphorothioates and their 2’-O-alkyl analogs and 2’-O-methylribonucleotide methylphosphonates. Alternatively mixed backbone oligonucleotides (MBOs) may be used. MBOs contain segments of phosphothioate oligodeoxynucleotides and appropriately placed segments of modified oligodeoxy-or oligoribonucleotides. MBOs have segments of phosphorothioate linkages and other segments of other modified oligonucleotides, such as methylphosphonate, which is non-ionic, and very resistant to nucleases or 2’-O-alkyloligoribonucleotides. Methods of preparing modified backbone and mixed backbone oligonucleotides are known in the art.
[0288] In some embodiments, an antisense polynucleotide disclosed or referenced herein may include an oligonucleotide sugar moiety that is a modified sugar moiety. In some embodiments, the modified sugar moiety can be a sugar moiety which is a conformationally- strained sugar. In some embodiments, the conformationally-strained sugar can be a locked nucleotide (locked nucleic acid, or LNA). In some embodiments, the locked nucleotide can be selected from one of the following types: 2′-O—CH2-4′ (oxy-LNA), 2′- CH2—CH2-4′ (methylene-LNA), 2′—NH—CH2-4′ (amino-LNA), 2′—N(CH3)— CH2-4′ (methylamino- LNA), 2′-S—CH2-4′ (thio-LNA), and 2′-Se—CH2-4′ (seleno-LNA). In some embodiments, the conformationally-strained sugar can be a bridged nucleic acid (BNA). Some conformationally-E3697-00624 Patent strained sugar can be a locked nucleic acid are shown in Formula III and Formula IV in US Patent No. 10,465,188.
[0289] In some embodiments, antisense compounds comprise antisense polynucleotides comprising from 8 to about 80 nucleotides of an connexin extracellular loop, intracellular region, C-terminus or other region for modulating expression of one or more connexins selected from the group consisting of connexin 26, connexin 30, connexin 30.3, connexin 31, connexin 31.1, connexin 32, connexin 43, connexin 45, connexin 50 and connexin 58 . The polynucleotides include synthesized polynucleotides having a length of less than 80 nucleotides, e.g., from 12-18 to about 50-80 nucleotides, preferably about 30 nucleotides or less, e.g., from 12 to about 30 nucleotides, and more preferably from about 15 to about 30 nucleotides. In one example, the polynucleotide has 30 nucleotides. In some embodiments, antisense compounds comprise modified or unmodified epithelial, endothelial, and / or vascular endothelial connexin antisense polynucleotides.
[0290] In some embodiments of this invention, the connexin 43 or other antisense oligonucleotide or polynucleotide has at least about 80%, 85%, 90%, 95%, 97%, 98% or 99% homology to a polynucleotide having a sequence selected from SEQ ID NOs: 1 to 17. Connexin modulators that are oligonucleotides or polynucleotides may have at least about 80%, 85%, 90%, 95%, 97%, 98%, or 99% homology to an 8 to 80 nucleotide portion of their respective sequences. Table I. List of some connexin 43 antisense oligonucleotide embodimentsE3697-00624 Patent
[0291] Table I lists the polynucleotide sequences of several embodiments of connexin 43 polynucleotide modulators useful in the methods of the invention. When sequences such as SEQ ID NO:1-16 are noted, they and other Cx43 and other connexin antisense compounds represent both modified and unmodified oligonucleotides or polynucleotides. In some embodiments, the linkages between the nucleotides, and the structure of the sugar moiety of the nucleotides may be modified. In some embodiments, the internucleoside linkage between any two nucleotides can be a standard phosphodiester linkage. In some embodiments, the internucleoside linkage between any two nucleotides can be a phosphorothioate linkage. For example, SEQ ID NO:1 can be one of the following selected structures: GsTsAsAsTTGCGGCAAGAAGAATTGTTTCsTsGsTsC, wherein “s” denotes a phosphorothioate linkage between the two nucleotides. As another non-limiting example, SEQ ID NO:1 can be (G)(T)(A)(A)TTGCGGCAAGAAGAATTGTTTC(T)(G)(T)(C), wherein the parenthetical nucleotides have modified sugar moieties, as described below. In some embodiments the Cx43 antisense compounds may be modified by substituting one or more uridine nucleotides residues for one or more thymine nucleotides in SEQ ID NOs:1-17 or in the sequence of another connexin (e.g., Cx26, C32, Cx45, etc.).
[0292] Certain connexin modulators, including for example connexin 43 modulators, provide downregulation of connexin expression (for example, by downregulation of mRNA transcription or translation) or otherwise decrease or inhibit the activity of the connexin protein, connexin hemichannels or gap junctions. In the case of downregulation, this will have theE3697-00624 Patent effect of reducing direct cell-cell communication by gap junctions, or exposure of cell cytoplasm to the extracellular space by hemichannels, at the site at which connexin expression is downregulated.
[0293] In some embodiments, an anti-connexin antisense compound prevents, decreases or alters the activity or function of a hemichannel or a gap junction. As described herein, modulation of the gap junction activity or function by anti-connexin antisense compounds can lead to the closing of gap junctions, closing of hemichannels, and / or passage of molecules or ions through gap junctions and / or hemichannels.
[0294] Connexin modulators may also comprise one or polynucleotides selected, for example, from the group consisting of morpholino oligonucleotides, RNAi molecules, siRNA molecules, PNA molecules, DNAzymes, and 5’-end–mutated U1 small nuclear RNAs, and analogs of the preceding. These and other compounds may be used alone or in combination with one more connexin modulators.
[0295] Synthesis of antisense polynucleotides and other anti-connexin polynucleotides such as RNAi, siRNA, and ribozyme polynucleotides as well as polynucleotides having modified and mixed backbones can be performed. See e.g. Stein C.A. and Krieg A.M. (eds), Applied Antisense Oligonucleotide Technology, 1998 (Wiley-Liss).
[0296] The antisense polynucleotide may inhibit transcription and / or translation of a connexin protein (e.g. connexin 43). The antisense polynucleotide is generally antisense to connexin protein mRNA, for example, connexin 43. Such a polynucleotide may be capable of hybridizing to connexin protein mRNA and may thus inhibit the expression of connexin by interfering with one or more embodiments of connexin protein mRNA metabolism including transcription, mRNA processing, mRNA transport from the nucleus, translation or mRNA degradation. The antisense polynucleotide typically hybridizes to the connexin mRNA to form a duplex which can cause direct inhibition of translation and / or destabilization of the mRNA. Such a duplex may be susceptible to degradation by nucleases. Preferably the polynucleotide is a specific inhibitor of transcription and / or translation from the connexin 43 gene or mRNA, and does not inhibit transcription and / or translation from other genes or mRNAs.
[0297] The connexin modulator product may bind to the connexin 43 gene or mRNA either (i) 5’ to the coding sequence, and / or (ii) to the coding sequence, and / or (iii) 3’ to the coding sequence. The antisense polynucleotide may hybridize to part of the connexin protein mRNA, such as connexin 43 mRNA. Typically, the antisense polynucleotide hybridizes to the ribosome binding region or the coding region of the connexin protein mRNA. The polynucleotide may be complementary to a region of the connexin mRNA. For example, theE3697-00624 Patent polynucleotide may be the exact complement of a part of connexin mRNA. However, absolute complementarity is not required and polynucleotides which have sufficient complementarity to form a duplex having a melting temperature of greater than about 20ºC, 30ºC or 40ºC under physiological conditions are particularly suitable for use in the present invention. Thus, the polynucleotide is typically a homologue of a sequence complementary to the mRNA. The polynucleotide may be a polynucleotide which hybridizes to the connexin protein mRNA under conditions of medium to high stringency such as 0.03M sodium chloride and 0.03M sodium citrate at from about 50ºC to about 60ºC.
[0298] Antisense polynucleotides may be part of compositions which may comprise polynucleotides to more than one connexin protein. Preferably, one connexin protein to which polynucleotides are directed is connexin 43. Others include connexins found in the ocular and / or corneal epithelium. Some embodiments of the invention are described with reference to oligodeoxynucleotides. However, other suitable polynucleotides (such as RNA polynucleotides) may be used. Other Connexin Modulators
[0299] In addition to connexin antisense (e.g. SEQ ID NO:1), connexin peptidomimetics (e.g., Peptide5, XG19, etc.) and connexin hemichannel antagonists (e.g. tonabersat), connexin binding proteins, including antibodies, antigen-binding antibody fragments, and the like, are also suitable connexin modulators for use in methods of the invention and dosed with a therapeutically effective amount according to the one or more of the dosing schedules described herein. Binding proteins include, for example, monoclonal antibodies, polyclonal antibodies, antibody fragments (including, for example, Fab, F(ab’)2 and Fv fragments; single chain antibodies; single chain Fvs; and single chain binding molecules such as those comprising, for example, a binding domain, hinge, CH2 and CH3 domains, recombinant antibodies, and antibody fragments which are capable of binding an antigenic determinant (i.e., that portion of a molecule, generally referred to as an epitope) that makes contact with a particular antibody or other binding molecule. These binding proteins, including antibodies, anti-binding antibody fragments, and so on, may be chimeric or humanized or otherwise made to be less immunogenic in the subject to whom they are to be administered, and may be synthesized, produced recombinantly, or produced in expression libraries. Any binding molecule known in the art or later discovered is envisioned, such as those referenced herein and / or described in greater detail in the art. For example, binding proteins include not only antibodies, and the like, but also ligands, receptors, peptidomimetics, or other binding fragments or molecules (for example, produced by phage display) that bind to a target (e.g., aE3697-00624 Patent connexin protein or connexin hemichannel epitope). Methods of synthesizing antibodies and binding fragments as well as peptides and polypeptides, including peptidomimetics and peptide analogs can also be performed using suitable methods. See e.g. Lihu Yang et al., Proc. Natl. Acad. Sci. U.S.A., 1; 95(18): 10836-10841 (Sept 1 1998); Harlow and Lane (1988) “Antibodies: A Laboratory Manuel” Cold Spring Harbor Publications, New York; Harlow and Lane (1999) “Using Antibodies” A Laboratory Manuel, Cold Spring Harbor Publications, New York.
[0300] Connexin modulators also include antibodies and binding fragments (e.g. scFvs, human VH or VL domains, humanized camelid VHH domains, IgNAR single domains, etc.) thereof that bind connexin protein, and connexin peptides and polypeptides, including peptidomimetics and peptide analogs of connexin that modulate hemichannel or gap junction activity or function, and other gap junction blocking agents and gap junction protein phosphorylating agents. Connexin protein peptides and polypeptides may, for example, bind to connexin protein to inhibit its function, or may inhibit connexin function by mimicking regions of connexin protein to inhibit or disrupt its binding to other gap junction proteins. Strategies known in the art may be used to improve the naturally short half-life of antibody fragments, including PEGylation, the use of repeating peptide sequences, polysialylation, albumin or IgG binding or fusions, and other approaches.
[0301] Binding molecules will generally have a desired specificity, including but not limited to binding specificity, and desired affinity. Affinity, for example, may be a Kaof greater than or equal to about 104M-1, greater than or equal to about 106M-1, greater than or equal to about 107M-1, greater than or equal to about 108M-1. Affinities of even greater than about 108M-1are suitable, such as affinities equal to or greater than about 109M-1, about 1010M-1, about 1011M-1, and about 1012M-1. Affinities of binding proteins useful to treat subjects according to the present invention can be readily determined using conventional techniques, for example those described by Scatchard, et al., 1949 Ann. N.Y. Acad. Sci. 51: 660.
[0302] Other compounds that may be used for modulating, blocking or closing gap junctions (e.g. phosphorylating connexin 43 tyrosine and / or serine residue) are known and have been reported in U.S. Pat. No. 7,153,822 and U.S. Pat. No. 7,250,397, for example. Pannexin Modulators
[0303] Any modulator that is capable of eliciting a desired inhibition of the passage (e.g., transport) of molecules through a pannexin channel (e.g., ATP), including a pannexin 1 channel, for example, may be used in embodiments of the invention and dosed according to the one or more of the schedules described herein. Such compounds include, for example, bindingE3697-00624 Patent proteins (e.g. scFvs, antibodies, etc.), polypeptides (e.g. peptidomimetics), polynucleotides (e.g., antisense compounds) and organic compounds (e.g. probenecid and compounds of Formula III) and / or prodrugs thereof that can, for example, block the function or activity of a pannexin channel in whole or in part (e.g. by modulating release of ATP from a pannexin channel). See, e.g., Caufriez, A, et al. Determination of Structural Features That Underpin the Pannexin1 Channel Inhibitory Activity of the Peptide (10)Panx1. Bioorg. Chem. 2023, 138:106612. See also Van Campenhout, R, et al. Nanobody-based pannexin1 channel inhibitors reduce inflammation in acute liver injury. J Nanobiotechnol 21, 371 (2023); Lissoni, A, et al. Cx43 Hemichannel and Panx1 Channel Modulation by Gap19 and10Panx1 Peptides. Int. J. Mol. Sci. 2023, 24, 11612; Lamouroux, A, et al. Structure-Based Design and Synthesis of Stapled10Panx1 Analogues for Use in Cardiovascular Inflammatory Diseases J. Med. Chem. 202366:13086-13102.
[0304] Compounds for pannexin modulation can be any compound of Formula III:wherein Z1 and Z2 are independently selected from: (C1-C4)alkyl, halo(C1-C4)alkyl, (C1-C4)alkoxy, halo(C1-C4), (C1-C4)cycloalkyl, (C1-C4)alkyl-S—, (C1-C4)alkylamino, (C1- C4)cycloalkylamino, di(C1-C4)alkylamino, and amino(C1-C4)alkyl; Y is selected from: hydrogen, halo, cyano, hydroxy, (C1-C4)alkyl, halo(C1-C4)alkyl, (C1- C4)alkoxy, halo(C1-C4)alkoxy, cyano(C1-C4)alkyl, amino, (C1-C4)alkylamino, di(C1- C4)alkylamino, amino(C1-C4)alkyl, (C1-C4)alkylamino(C1-C4)alkyl, di[(C1- C4)alkyl]amino(C1-C4)alkyl, trifluoromethylthio, hydroxy(C1-C4)alkyl, (C1- C4)alkoxy(C1-C4)alkyl, —C(O)R1, C(O)OR1, —OC(O)R1, —C(O)—N(R1)2, —CH2— C(O)R1, —CH2—C(O)OR1, —CH2—OC(O)R1, —CH2—C(O)—N(R1)2, S(O)2R1, S(O)2N(R1)2, (C3-C5)cycloalkyl, (C3-C8)cycloalkyl(C1-C4)alkyl, SO3H, and SO4H; R1 is selected from: hydrogen, NH2, NR2R3, OH, —CH2OH, and —CH2CH2OH; R2 and R3 are independently selected from: hydrogen, (C1-C4)alkyl, (C1-C4)alkoxy, and (C1-C4)cycloalkyl; and, halo is chlorine, bromine, iodine, or fluorine.E3697-00624 Patent
[0305] One Formula III compound for pannexin modulation is probenecid, shown below:
[0306] Probenecid may be known by the IUPAC name p-[Dipropylsulfamoyl]benzoic acid and has the structure shown above.
[0307] In certain embodiments, probenecid and / or an analogue thereof are nonionic, are in the form of a free base, a free acid, or a pharmaceutically acceptable salt. By way of example, a pharmaceutically acceptable salt includes a hydrochloride salt and salts derived from acid including, but not limited to, hydrobromic acid, phosphoric acid, acetic acid, fumaric acid, maleic acid, salicylic acid, citric acid, oxalic acid, lactic acid, malic acid, methanesulphonic acid and p-toluene sulphonic acid, a salt of itself. In one embodiment, the salt is a hydrochloride salt. In other embodiments, one or more polymorph, one or more isomer, and / or one or more solvate of probenecid and / or an analogue thereof may be used.
[0308] In some embodiments, the pannexin modulators can include or exclude pannexin peptidomimetics. Pannexin peptide sequences can comprise about 8 to about 40 (e.g., 40-80) consecutive amino acids of an extracellular domain, an intracellular domain, a carboxy terminus part, or an amino terminus part, of the polypeptides Panx1, Panx2 or Panx3. Pannexin modulators may comprise, in some embodiments, a portion of an extracellular loop of Panx 1, 2 or 3. In some embodiments, a pannexin peptidomimetic can comprise about 8 to about 40 consecutive amino acids of an extracellular domain, an intracellular domain, a carboxy terminus part, or an amino terminus part, of pannexin 1. In some embodiments, for example, the pannexin modulator may comprise, for example, the Panx1 mimetic blocking peptide is10Panx1 (WRQAAFVDSY (SEQ ID NO: 21)). In some embodiments, the Panx1 mimetic peptide is a stapled10Panx1 analogue (see, e.g., Lamouroux, A, et al. (2023), supra.
[0309] In some embodiments, the mimetic peptide Gap19 may be used to modulate pannexin 1 channels. In some embodiments,10Panx1 may be used to modulate connexin 43 hemichannels. See Lissoni, A, et al. (2023) supra.
[0310] In some embodiments, pannexin mimetic modulators can comprise, for example, about 40 to about 80 (including from 8-40) consecutive amino acids. They mayE3697-00624 Patent comprise part of an extracellular domain, an intracellular domain, a carboxy terminus, or an amino terminus of the Panx1 peptide, the Panx2 peptide and / or the Panx3 peptide, or variants thereof. The sequence of the Panx1 polypeptide is known and can be found, for example, at U.S. Patent No.10,465,188 (also published as WO2016029191) as SEQ ID NO: 122 therein (also identified as NCBI RefSeq: NP_056183.2) at Col. 42, lines 35-50 therein, The sequence of the Panx2 polypeptide is known and can be found, for example, at U.S. Patent No. 10,465,188 as SEQ ID NO: 123 therein (Panx2 peptide, also identified as RefSeq NP_443071.2) at Col. 42 line 51 to Col. 43, line 9 therein. The sequence of the Panx3 polypeptide is known and can be found, for example, at U.S. Patent No.10,465,188 as SEQ ID NO: 124 therein (Panx3 peptide, also identified as RefSeq NP_443191.1) at Col. 43, line 10 to Col. 44, line 12 therein. IN some embodiments, the pannexin peptidomimetic is a pannexin 1 peptidomimetic.
[0311] In some embodiments the pannexin modulators that are oligonucleotides or polynucleotides may have at least about 80%, 85%, 90%, 95%, 97%, 98%, or 99% homology to an 8 to 80 nucleotide portion of Panx1 nRNA (Panx1 polynucleotide RefSeq ID NM_015368.3), Panx2 mRNA (Panx2 polynucleotide RefSeq ID NM_052839.3 for variant 1; RefSeq ID NM_001160300.1 for Panx2 polynucleotide variant 2; RefSeq ID NR_027691.1 for Panx2 polynucleotide variant 3), or Panx3 mRNA (Panx3 polynucleotide RefSeq ID NM_052959.2). The sequence of the Panx1 mRNA is known and can be found, for example, at U.S. Patent No.10,465,188 (also published as WO2016029191) as SEQ ID NO: 117 therein at Col. 44, line 15 to Col. 45, line 34. The sequence of the Panx2, variant 1 mRNA is known and can be found, for example, at U.S. Patent No. 10,465,188 as SEQ ID NO: 118 therein at Col.45, line 36 to Col.47, line 58. The sequence of the Panx2, variant 2 mRNA is known and can be found, for example, at U.S. Patent No. 10,465,188 as SEQ ID NO: 119 therein at Col. 47, line 60 to Col. 49. The sequence of the Panx2, variant 3 mRNA is known and can be found, for example, at U.S. Patent No. 10,465,188 as SEQ ID NO: 120 therein at Col. 51, line 1 to Col. 53, line 22. The sequence of the Panx3 mRNA is known and can be found, for example, at U.S. Patent No. 10,465,188 as SEQ ID NO: 121 therein at Col. 53, line 24 to Col. 53, end of page. Some useful pannexin 1 antisense sequences include 5′- TATGCAGCCACAGTGGGAGG-3′ (685–704) (SEQ ID NO: 247) and 5′- TCAGATACCTCCCACAAACT-3′ (929–948) (SEQ ID NO: 248), 5′- TAGCACCTGCCAGTCCAGAAT-3′ (SEQ ID NO: 249), and 5′- GGTCCAGGTCCATCTCTCAGG-3′ (SEQ ID NO: 250), and may be made, for example, using unmodified nucleotides or produced as phosphorothioate ODNs.E3697-00624 Patent Inflammasome Modulators
[0312] The NLRP3 inflammasome is currently the best characterized. It comprises NLRP3, ASC (PYCARD) and procaspase-1 (and CARD8 (Cardinal) may also be a component). It is activated by a number of pathogens and bacterial toxins as well as diverse PAMPs, danger-associated molecular patterns (DAMPS). Multiple studies have shown that activation of the NLRP3 inflammasome by particulate activators (e.g. Hornung V, et al. Silica crystals and aluminum salts activate the NALP3 inflammasome through phagosomal destabilization. Nat Immunol.20089(8):847-56) requires phagocytosis, but this is not required for the response to ATP, which is mediated by the P2X7 receptor (Kahlenberg JM, Dubyak GR. Mechanisms of caspase-1 activation by P2X7 receptor-mediated K+ release. Am J Physiol Cell Physiol. 2004286(5):C1100-8) and appears to involve the pannexin membrane channel (Pelegrin P, Surprenant A. Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor. EMBO J. 200625(21):5071-82).
[0313] Any modulator that is capable of eliciting a desired inhibition of an inflammasome (e.g., the NLRP3 inflammasome), either directly or indirectly, may be used in compositions and methods of the invention. Such compounds include, for example, binding proteins (e.g. scFvs, antibodies, etc.), polypeptide modulators (e.g. peptidomimetics), polynucleotide modulators (e.g., antisense compounds) and organic compounds useful to modulate an inflammasome, whether now known or later developed, including those described herein. In some embodiments, inflammasome modulators (e.g., NLRP3 inflammasome modulators) useful in methods, compositions and kits of the invention, including to reverse or alleviate one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.) may be referred to as “direct” or “indirect” inflammasome modulators. Useful inflammasome modulators that may be referred to as direct inflammasome modulators include, for example, oridonin, MCC950, tranilast and analogues thereof which directly binds to the NACHT domain of NLRP3 and change its conformation,; OLT1177 and parthenolide which suppress the ATPase activity of NLRP3; CY-09 which binds to the NACHT domain and inhibits ATPase of NLRP3; BAY11- 7082 and VI-16 which block the binding between TXNIP and NLRP3; NIC7 (NLRP3- inhibitory compound), and its derivatives which inhibit NLRP3-mediated activation of caspase 1 along with the secretion of interleukin (IL)-1β, IL-18 and lactate dehydrogenase. Useful inflammasome modulators that may be referred to as indirect inflammasome modulators include, for example, glyburide, 1673-34-0, FC11A-2, β-hydroxybutyrate, etc., and modulators of ATP-induced inflammasome activation such as tonabersat and other small moleculeE3697-00624 Patent connexin hemichannel modulators, connexin peptidomimetics including for example, Peptide5, XG19, etc. In some embodiments, the inflammasome modulators are NLRP3 inflammasome modulators. In some embodiments, the inflammasome modulators are direct NLRP3 inflammasome modulators. In some embodiments, the inflammasome modulators are indirect NLRP3 inflammasome modulators. In some embodiments, the inflammasome modulators (e.g., NLRP3 inflammasome modulators) are used in and useful for methods, compositions and kits of the invention relating to reversing or alleviating one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post- treatment Lyme disease syndrome, etc.). Connexin, Pannexin and Inflammasome Modulator Combinations and Combined Administrations
[0314] In some embodiments, methods, uses and compositions of the invention may comprise the use of a combination of one or more connexin hemichannel (e.g., connexin 32 hemichannel) modulators (e.g., tonabersat), for example, one or more connexin antisense modulators (e.g. SEQ ID NO:1), and / or one or more connexin peptidomimetics (e.g. Peptide5, Gap19, XG19), and / or small molecule connexin hemichannel modulators (e.g. compounds of Formula I, such as tonabersat and / or prodrugs thereof, including compounds of Formula II). Two or more connexin hemichannel modulators may be administered alone or together. In some embodiments, two or more separate pharmaceutical compositions that each contain one or more connexin hemichannel modulators are provided for administration. Pharmaceutical compositions are also provided for co-administration in the form of a combined preparation, for example, as an admixture of two or more connexin hemichannel modulators, which may be modified or unmodified, or in the form of prodrugs, as the case may be, for example one or more small molecule hemichannel blockers or inhibitors, one or more connexin hemichannel modulator polynucleotides, and optionally one or more connexin hemichannel modulator peptidomimetics, that can reduce hemichannel opening, activity, function, etc. In some embodiments, the two or more connexin hemichannel modulators are directed to different connexins (e.g., connexin 26 and connexin 43, connexin 43 and connexin 45, and so on). In some embodiments, the two or more connexin hemichannel modulators are directed to the same connexin (e.g., connexin 26 or connexin 37 or connexin 43 or connexin 45, etc.).
[0315] In some embodiments, methods, uses and compositions of the invention may comprise the use of a combination of two or more inflammasome modulators, for example, a direct inflammasome modulator (e.g., an organic compound, antisense and / or peptidomimetic inflammasome modulator), an indirect inflammasome connexin modulators (e.g. a connexinE3697-00624 Patent hemichannel modulator, for example, compounds of Formula I, such as tonabersat and / or prodrugs thereof, including compounds of Formula II), or a pannexin channel modulator (e.g., an organic compound, antisense and / or peptidomimetic pannexin modulator). Two or more inflammasome modulators may be administered alone or together. In some embodiments, two or more separate pharmaceutical compositions that each contain one or more inflammasome modulators are provided for administration. Pharmaceutical compositions are also provided for co-administration in the form of a combined preparation, for example, as an admixture of two or more different inflammasome modulators, which may be modified or unmodified, or in the form of prodrugs, as the case may be, for example one or more small molecule inflammasome modulators or inhibitors, one or more inflammasome modulator polynucleotides, and optionally one or more inflammasome modulator peptidomimetics. In some embodiments, the two or more inflammasome modulators are directed to the same inflammasome (e.g., NLRP3, etc.). In some embodiments, the two or more inflammasome modulators are directed to the different parts of the same inflammasome (e.g., different parts of the NLRP3 inflammasome).
[0316] In some embodiments, methods, uses and compositions of the invention may comprise the use of a combination of two or more pannexin modulators, for example, an organic compound, peptidomimetic and / or antisense pannexin modulator (e.g., pannexin 1 modulators, or any combination of pannexin 1, 2 and / or 3 modulators),. Two or more inflammasome modulators may be administered alone or together. In some embodiments, two or more separate pharmaceutical compositions that each contain one or more pannexin (e.g., pannexin 1) modulators are provided for administration. Pharmaceutical compositions are also provided for co-administration in the form of a combined preparation, for example, as an admixture of two or more different pannexin modulators, which may be modified or unmodified, or in the form of prodrugs, as the case may be, for example one or more small molecule pannexin modulators or inhibitors, one or more pannexin modulator polynucleotides, and optionally one or more pannexin modulator peptidomimetics.
[0317] In some embodiments, one or more connexin hemichannel, pannexin and / or inflammasome modulators may be administered alone or together. In some embodiments, two or more separate pharmaceutical compositions that each contain one or more connexin hemichannel, pannexin and / or inflammasome modulators are provided for administration. Pharmaceutical compositions are also provided for co-administration in the form of a combined preparation, for example, as an admixture of two or more connexin hemichannel, pannexin and / or inflammasome modulators.E3697-00624 Patent
[0318] Treatment of a subject or a patient, including e.g., for one or more of the diseases, disorders, defects or conditions described or referenced herein, with one or more pharmaceutical compositions of the invention, e.g., a connexin hemichannel modulator, or a first connexin hemichannel modulator agent and a second, different connexin hemichannel modulator agent (which may be directed to the same or different connexins), may comprise their simultaneous, separate, sequential or sustained administration. Likewise, treatment of a subject or a patient, including e.g., for one or more of the diseases, disorders, defects or conditions described or referenced herein, with one or more pharmaceutical compositions of the invention, e.g., an inflammasome modulator, or a first inflammasome modulator agent and a second, different inflammasome modulator agent (which may be directed to the same or different inflammasomes), may comprise their simultaneous, separate, sequential or sustained administration. Similarly, treatment of a subject or a patient, including e.g., for one or more of the diseases, disorders, defects or conditions described or referenced herein, with one or more pharmaceutical compositions of the invention, e.g., a pannexin channel modulator, or a first pannexin channel modulator agent and a second, different pannexin channel modulator agent (which may be directed to the same or different pannexin channels), may comprise their simultaneous, separate, sequential or sustained administration.
[0319] The term “a combined preparation” includes a “kit of parts” or “article of manufacture” in the sense that the combination partners as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners (a) and (b), i.e. simultaneously, separately or sequentially, whether in pharmaceutical form (e.g. topical or oral) or dressing / matrix form (e.g. modulator- impregnated) or both in accordance with the methods of the invention. The parts of the kit can then, for example, be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
[0320] In some embodiments, a combined preparation is administered, wherein two or more separate modulator compositions are administered to a subject in accordance with the methods invention. In some embodiments, the first composition comprises a therapeutically effective amount of modulator, such as a connexin hemichannel modulator, e.g., an anti- connexin 43 polynucleotide, peptide, or peptidomimetic, or a hemichannel modulating compound, and the second composition comprises a therapeutically effective amount of a second modulator, such as a connexin hemichannel modulator, e.g., an anti-connexin 26, 37, 43 or 45 polynucleotide, peptide, or peptidomimetic, a hemichannel closing compound and / or an ocular treatment agent. In another embodiment a third composition is administeredE3697-00624 Patent comprising one or more connexin hemichannel modulators or another therapeutic agent (e.g., for treating one or more signs and / or symptoms of a post-acute infection syndrome (e.g., long COVID, long flu, post-treatment Lyme disease syndrome, etc.). In some embodiments, the first composition comprises a therapeutically effective amount of modulator, such as an inflammasome modulator, e.g., an NLRP3 modulator, and the second composition comprises a therapeutically effective amount of a second inflammasome modulator. In another embodiment, a third composition is administered comprising one or more modulators and / or another treatment agent. In some embodiments, the first composition comprises a therapeutically effective amount of modulator, such as a pannexin channel modulator, e.g., a pannexin 1 channel modulator, and the second composition comprises a therapeutically effective amount of a second pannexin channel modulator. In another embodiment, a third composition is administered comprising one or more pannexin channel modulators and / or another treatment agent. In some embodiments, the compositions comprise one or more connexin hemichannel modulators, one or more inflammasome modulators, one or more pannexin channel modulators, or combinations of one or more modulators of one or more connexin hemichannels (including, e.g., connexin 43 hemichannels), inflammasomes (including, e.g., NLRP3 inflammasomes) and / or pannexin channels (including, e.g., pannexin 1 channels). The compositions may also contain another agent for treatment or prophylaxis.
[0321] The modulators and modulators compositions can be dosed, administered, or formulated in methods of the invention as described herein. Doses and Dose Regimens
[0322] Examples of effective doses that may be used for the treatment of a post-acute infection syndrome and / or one or more signs and / or symptoms thereof, including those described or referenced herein, are described. They include, for example, doses and dose regimens that are useful for the application or administration of connexin hemichannel modulators (e.g., connexin 43 hemichannel modulators), pannexin channel modulators (e.g. pannexin 1 channel modulators), direct inflammasome modulators and indirect inflammasome modulators (e.g., direct or indirect NLRP3 inflammasome modulators).
[0323] In some embodiments, a therapeutically or prophylactically effective amount of a modulator effective in methods of the invention comprises a composition that includes certain doses of connexin hemichannel modulator (for example a connexin 43 hemichannel modulator), an inflammasome modulator (for example an NLRP3 inflammasome modulator) and / or a pannexin channel modulator (for example a pannexin 1 channel modulator).E3697-00624 Patent
[0324] In some embodiments, the connexin hemichannel modulator dose or dose in a composition comprises a small molecule, organic or chemical connexin hemichannel modulator (e.g., tonabersat, carabersat, or another compound according to Formula I or a compound according to Formula II) dose. In some embodiments, the connexin hemichannel modulator dose or dose included in a composition comprises a connexin peptidomimetic (e.g., Peptide5, Gap19, XG19, Gap26, Gap27, aCT1, etc.) dose. In some embodiments, the connexin hemichannel modulator dose or dose comprising a composition comprises a connexin antisense molecule (e.g. SEQ ID NO:1) dose. In some embodiments, the connexin modulator is a connexin 43 hemichannel modulator.
[0325] In some embodiments, the inflammasome modulator dose or dose in a composition comprises a small molecule, organic or chemical pannexin channel modulator dose. In some embodiments, the inflammasome modulator dose or dose included in a composition comprises an inflammasome peptidomimetic dose. In some embodiments, the inflammasome modulator dose or dose comprising a composition comprises an inflammasome antisense molecule dose. In some embodiments, the inflammasome modulator is an NLPR3 inflammasome modulator.
[0326] In some embodiments, the pannexin channel modulator dose or dose in a composition comprises a small molecule, organic or chemical pannexin channel modulator (e.g., a compound according to Formula III) dose. In some embodiments, the pannexin channel modulator dose or dose included in a composition comprises a pannexin channel peptidomimetic (e.g., 10Panx1) dose. In some embodiments, the pannexin channel modulator dose or dose comprising a composition comprises a pannexin channel antisense molecule dose. In some embodiments, the pannexin channel modulator is a pannexin 1 channel modulator.
[0327] In some embodiments, the dose of a connexin hemichannel modulator, inflammasome modulator and / or a pannexin channel modulator is measured in milligrams (mg). In some embodiments, the dose of a connexin hemichannel modulator, inflammasome modulator and / or a pannexin channel modulator is measured in milligrams per kilogram (mg / kg) of a subject or patient. In some embodiments, the dose is measured in milligrams per kilogram per day (mg / kg / day). In some embodiments, the dose of a connexin hemichannel modulator, inflammasome modulator and / or a pannexin channel modulator is measured in milligrams per milliliter (mg / mL) or micrograms per milliliter (µg / mL). In some embodiments, the dose of a connexin hemichannel modulator, inflammasome modulator and / or a pannexin channel modulator is measured in micromolar (µM) or millimolar (mM) amounts of theE3697-00624 Patent modulator in in a composition to be administered, or as local, site-of-action or circulating concentration, including as described herein.
[0328] In some embodiments, the connexin hemichannel modulator being dosed comprises or consists essentially of a small molecule, organic or chemical connexin hemichannel modulator (e.g., tonabersat, carabersat, or another compound of Formula I or Formula II). In some embodiments, the connexin hemichannel modulator being dosed comprises or consists essentially of a peptidomimetic connexin hemichannel modulator (e.g., XG19). In some embodiments, the connexin hemichannel modulator being dosed comprises or consists essentially of an antisense connexin hemichannel modulator (e.g., SEQ ID NO:1). In some embodiments, the inflammasome modulator being dosed comprises or consists essentially of a small molecule, organic or chemical inflammasome modulator. In some embodiments, the inflammasome modulator being dosed comprises or consists essentially of a peptidomimetic inflammasome modulator. In some embodiments, the inflammasome modulator being dosed comprises or consists essentially of an antisense inflammasome modulator. In some embodiments, the pannexin channel modulator being dosed comprises or consists essentially of a small molecule, organic or chemical inflammasome modulator (e.g., probenecid or another compound according to Formula III). In some embodiments, the pannexin channel modulator being dosed comprises or consists essentially of a peptidomimetic pannexin channel modulator (e.g.,10Panx). In some embodiments, the pannexin channel modulator being dosed comprises or consists essentially of an antisense pannexin channel modulator.
[0329] In some embodiments, the doses may be administered to provide a therapeutically or prophylactically effective amount of a connexin hemichannel modulator, an inflammasome modulator and / or a pannexin channel modulator for treating or preventing one or more signs and / or symptoms of a post-acute infection syndrome, including those noted, described or referenced herein.
[0330] In some embodiments, the doses referenced herein are administered orally. In some embodiments, the doses referenced herein are administered by injection (e.g. intravenous (IV), subcutaneous (SC / SQ), intraperitoneal (IP), intradermal (ID), or intramuscular (IM)). In some embodiments, the doses are administered topically to a subject or a patient (e.g., to the skin or the eye). In some embodiments, the doses referenced herein are administered by other routes known in the art. Compounds disclosed herein or used as described herein may also be administered via implant, tissue or organ implant (e.g., hepatic, renal, cerebral, ocular, heart, CNS, etc.) or local administration including via a matrix, by inhalation or spray, sublingually,E3697-00624 Patent transdermally, via buccal administration, rectally, as an ophthalmic solution, ocular injection, , intra-aortal, intracranial, subdermal, intraperitoneal, subcutaneous, transnasal, sublingual, intrathecal, or rectal or by other means, in dosage unit formulations containing conventional or other pharmaceutically acceptable carriers now known or later developed.
[0331] In some embodiments, a dose of a modulator or a composition or compositions containing one or more modulators is / are administered to a cell, a group of cells, a subject or a patient in a single dose, or in two or more divided doses, e.g., for one or more daily or weekly or other timed administrations. In some embodiments, modulator doses are administered at least once every day. In some embodiments, modulator doses are administered BID, TID or QID. In some embodiments, modulator doses are administered daily AC, every other day or every other evening. Reference to “administration” refers to administration of a modulator in a single dose or in divided doses. Wherever a dose of a particular modulator (e.g., a connexin hemichannel modulator or modulator composition, an inflammasome modulator or modulator composition and / or a pannexin channel modulator or composition) is not specified in a dose regimen or method of the invention for the treatment of a disease, disorder, defect or condition, dosing with a therapeutically effective amount of a modulator(s) or modulator composition(s) is intended.
[0332] The modulator dosages may be varied or may vary within one or more of the dose ranges or regimens provided depending upon the dosage form employed and the route of administration utilized.
[0333] For any modulators used in the method of the invention, the therapeutically effective dose can be evaluated, estimated and / or quantified using cell culture assays (e.g., ARPE-19 cells). Therapeutically effective doses of modulators can also be evaluated, estimated and / or quantified using tissue and / or assays with tissue (e.g., brain). Therapeutically effective doses of modulators can also be evaluated, estimated and / or quantified using animals (e.g., mice). Data obtained from cell culture assays, tissue assays, tissue experiments, and animal studies – as well as one or more of the methods for quantifying modulator activity can be used in identifying, evaluating or confirming a range of dosages for use in humans.
[0334] In some embodiments, a modulator dose may be formulated from cell cultures, tissue assays or experiments, and / or animal models to achieve a concentration or range of a modulator that includes the IC50. IC50is a quantitative measure that indicates how much of a particular substance (e.g. a modulator drug, compound or composition) is needed to inhibit a given biological process or response or biological component by 50%. The biological component may be a protein, cell, cell receptor, etc. The biological process may beE3697-00624 Patent inflammasome activation, connexin hemichannel opening, or pannexin channel opening. In some embodiments, connexin hemichannel opening or pannexin channel opening may be measured by release of ATP. The IC50 is the concentration of a substance where ATP release (e.g., from a connexin hemichannel or a pannexin channel) is reduced by half. In some embodiments, a modulator dose may be formulated from cell cultures, tissue assays or experiments, and / or animal models to achieve a concentration or range of a modulator that includes the EC50. EC50is the concentration of a particular substance (e.g. a modulator drug, compound or composition) that gives half-maximal response. Half maximal effective concentration is a measure of the concentration of a modulator that induces a biological response halfway between the baseline and maximum after a specified exposure time. Such information can be used to accurately determine, confirm or refine doses useful in a subject or patient in a method or a use described or referenced herein. The dosage, IC50 and EC50 can be determined from the concentration of the amount administered, expected mass of the animal model tested (200-300 g per rat for adult Wistar rats), to determine the dose in units of mg / kg from concentration (micromolar) administered or amount (mg) administered. In humans and animals, the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient’s condition (see, e.g., Fingl et al., 1975, In: The Pharmacological Basis of Therapeutics, Ch.1, p.1.) but will be initially set by the FDA and / or other regulatory agencies following clinical trials.
[0335] It will be appreciated that the dose of modulator administered (e.g. a connexin hemichannel modulator, such as a compound of Formula I, for example tonabersat, or a compound according to Formula II, an inflammasome modulator, and a pannexin channel modulator, such as a compound of Formula III, e.g., probenecid,10Panx1, etc.), the period of administration, and the general administration regime may differ between subjects depending on such variables as the target site to which it is to be delivered, the severity of any symptoms of a subject to be treated, the type of disorder to be treated, size of unit dosage, the mode of administration chosen, and the age, sex and / or general health of a subject and other factors known to those of ordinary skill in the art.
[0336] Modulator administration may include a single daily dose, administration of a number of discrete divided doses, or continuous administration, as may be appropriate. By way of example, unit doses may be administered once or more than once per day, for example 1, 2, 3, 4, 5 or 6 times a day to achieve a desired total daily dose. By way of example, a unit dose of a connexin hemichannel modulator, an inflammasome modulator, and / or a pannexin channel modulator may be administered in a single daily dose or a number of discrete doses, orE3697-00624 Patent continuously to achieve a daily dose of approximately about 10 to about 100 mg, about 100 to about 400 or 500 mg, about 40 to 80 or 100 mg, or any range between any two recited dosages or any dose between any two recited dosages.
[0337] In some embodiments, a connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) is provided in an amount to achieve and / or to maintain a steady state amount over a desired period of time, including some or part of a dosing regimen for use in addressing one or more signs or symptom of a post-acute infection syndrome, disorder, disease or condition. In some embodiments, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) is a compound according to Formula I. In some embodiments, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator) is a compound according to Formula II. In some embodiments, the connexin hemichannel modulator (e.g., a connexin 43 hemichannel modulator according to Formula I is tonabersat. Following single and repeat oral dosing, tonabersat was generally quantifiable in the plasma up to at least 96 hours post-dose. Maximal plasma concentrations generally occurred between 1 and 3 hours after dosing. Thereafter, plasma concentrations declined in an approximately bi-exponential manner. The terminal elimination phase T½ was approximately 24 to 33 hours. There was no evidence of time- or dose-related changes in systemic exposure of tonabersat. For a drug to show no change in its pharmacokinetic behavior on chronic dosing, the steady-state accumulation ratio (Rs) should equal unity. This was found to be the case for tonabersat, since the point estimates for Rs in each dose group (40 and 80 mg) were very close to unity, with the 95% CIs approximately (0.9, 1.1) for both dose groups. Although the terminal elimination half- life of tonabersat was slightly longer following repeated administration, the mean increase of approximately 3 hours is numerically small compared to the mean half-life of approximately 25 hours. The observed accumulation ratio (Ro) of tonabersat was also as predicted for a drug with an elimination half-life of about 1 to 1.5 days, dosed once daily for 7 days, with values indicative of average increases in systemic exposure of 2.24- and 2.71-fold for the 40 mg and 80 mg dose groups, respectively. A similar pattern was observed (in Cmax) with average increases of 1.71- and 2.43-:fold for the 40 mg and 80 mg dose groups, respectively. In accordance with its half-life of 1 to 1.5 days, steady state was achieved in most subjects, between 4 to 5 once daily doses of tonabersat as shown by the plateau in the plasma tonabersat concentrations taken immediately pre-dose (Cpre) on days 10 to 12. Systemic exposure of a single 40 mg of tonabersat, as judged by Cmax and AUC, were similar to results from a study where healthy subjects were administered a single oral dose of 40 mg tonabersat as a direct compression tablet. The pharmacokinetics of tonabersat were approximately dose proportionalE3697-00624 Patent between 40 and 80 mg once daily, since there was no apparent trend in the dose-normalized (to 40 mg) Cmax and AUC(O-t) values for tonabersat following either single or multiple doses of tonabersat. This observation fully supported the linearity of the pharmacokinetics of tonabersat up to doses of 80 mg once daily, for example. Additionally, after single dosing with 240 mg and 320 mg tonabersat under fasted conditions, median tmaxwas 16 h and 10.5 h, respectively, whereas after single or multiple dosing with 240 mg to 400 mg under fed conditions (light, medium or fed), median tmaxoccurred several hours earlier at 3 to 4 h post-dose. After both single and multiple dosing, Cmaxand AUC increased with increasing dose in a dose- proportional manner across the dose range studied. At a single-dose dose of 320 mg, Cmaxvalues increased from 1.4 to 1.7-fold when tonabersat was administered under fed conditions (medium or high-fat) compared to fasted, whereas AUCinfwas similar under fasted and fed conditions (285000 and 296000 h.ng / mL for 320 mg fasted and 320 mg fed, respectively). Therefore, total exposure (extent of absorption) was not affected by food administration, whereas the rate of drug absorption was increased in the presence of food. After single dosing with tonabersat, the geometric mean t1 / 2was between 28.9 h and 37.8 h. The t1 / 2was slightly prolonged after multiple dosing to a geometric mean t1 / 2between 37.5 h and 41.6 h on Day 14. The half-life was not affected by fed conditions. After multiple dosing for 13 (DDI part) to 14 (MAD part) consecutive days, Cmaxand AUC for tonabersat accumulated approximately 3-fold (mean accumulation ratio AUC0-24ranged between 2.69 and 3.45 across the dose range tested), on Days 13 or 14 compared to Day 1 consistent with linear PK. Time to steady state following multiple dosing did not significantly differ between the ranges of doses tested. After multiple dosing with 240 mg, 320 mg or 400 mg tonabersat, steady state appeared to be reached after 7 to 9 days for all doses. These data may be used to determine dose and dose regimens to use in maintaining a steady state or the presence of other desired amounts of connexin hemichannel modulator (e.g., tonabersat) over a desired period of time.
[0338] In some embodiments, about 80 mg of a modulator is administered at least once per day, or BID, TID, or QID. In some embodiments, about 50 to about 80 mg of a modulator is administered at least once per day, or BID, TID, or QID. In some embodiments, about 75 to about 100 mg of a modulator is administered at least once per day, or BID, TID, or QID. In some embodiments, about 85 mg to about 125 mg of a modulator is administered at least once per day, or BID, TID, or QID. In some embodiments, about 125 mg to about 200 mg of a modulator is administered at least once per day, or BID, TID, or QID. In one embodiment,E3697-00624 Patent tonabersat, or another compound according to Formula I or Formula II, may be administered orally once or more per day at a dose of approximately 20 mg to approximately 40 mg. In one embodiment, tonabersat, or another compound according to Formula I or Formula II, may be administered orally once or more per day at a dose of approximately 40 mg to approximately 80, 100, 120, or 160 mg. In one embodiment, tonabersat, or another compound according to Formula I or Formula II, may be administered orally once or more per day at a dose of approximately 80 mg to approximately 100 mg. In one embodiment, tonabersat, or another compound according to Formula I or Formula II, may be administered orally once or more per day at a dose of approximately 100 mg to approximately 200 mg, including 120 and 160 mg. In one embodiment, tonabersat, or another compound according to Formula I or Formula II, may be administered orally once or more per day at a dose of approximately 200 mg to approximately 300 mg. In one embodiment, tonabersat, or another compound according to Formula I or Formula II, may be administered orally once or more per day at a dose of approximately 300 mg to approximately 400 or 500 mg. In some embodiments, the doses described herein, including milligram doses, are used for the oral administration of bioavailable modulator compounds. In some embodiments, these doses may be reduced for administration by injection (e.g., by 10-50% or more) or increased for topical administration (e.g., 50% to 100%). In any of these embodiments the modulating agent may be an organic compound modulator, a peptidomimetic modulator, or an antisense oligonucleotide modulator, for example. The above-noted dose concentrations may be decreased or increased as appropriate based on potency and specificity of the modulator, for example, and the nature or amount of a desired effect.
[0339] In some embodiments, the modulator may be administered in doses measured in milligrams per kilogram (i.e., at a specified number of milligrams per kilogram of weight of a subject (mg / kg) to which a modulator is being administered). In some embodiments, the average kg weight for a woman is from about 50 to about 80 kg. In some embodiments, the average kg weight for a man is from about 70 to about 90 kg. In some embodiments, the modulator may be administered at a dose between about 1.0 to about 3, 4 or 5 mg / kg, or any range between any two recited dosages or any dose between any two recited dosages. In some embodiments, these modulator doses may be administered in single dose per day, or in divided doses. In some embodiments, these modulator doses may be administered more than once per day (e.g., BID, TID, QID, etc.).
[0340] In some embodiments, a unit dose of a modulator, may be administered once or more than once a day in single or divided doses (for example 1, 2, 3, 4, 5 or 6, typically 1 to 4E3697-00624 Patent times a day), such that the total daily dose is in the range (calculated for a 70 kg adult, with other amounts for subjects of different kg weights being adjusted as appropriate) of about 25 to about 400 mg, for example approximately 40 to approximately 80 mg, or about 80 mg to about 100 mg, about 100 to about 160 or 200 mg, or about 160 or 200 mg to about 300, 400 or 500 mg, or any amount or range between any two recited dosages. For example, a connexin hemichannel modulator, inflammasome modulator or pannexin channel modulator, may be administered to a subject at a dose range, for example, of approximately 0.5 to approximately 2, 3, 4 or 5 mg / kg / day, approximately 5 to approximately 10 mg / kg / day, , or any range between any two recited dosages or any dose between any two recited dosages. In one embodiment, tonabersat may be administered orally once a day at a dose of approximately 1 mg to approximately 4 mg / kg / day.
[0341] Examples of effective doses that may be used as described herein may also be described in microgram per milliliter (µg / mL) amounts, or milligram per milliliter (mg / ml) amounts. In some embodiments, for the treatment of disease, disorders, defects or conditions described or referenced herein, a concentration of about 0.1 to about 10.0 microgram / ml, or from about 0.5 mg / mL to about 100 mg / mL, or more, or any range between any two of the recited dosages or any dose between any two recited numbers. The dose can be 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10.0, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 mg / ml or any range between any two of the recited dosages or any dose between any two recited numbers. In some embodiments, the therapeutically effective amount of the modulator, e.g. connexin and / or pannexin channel modulating agent protein modulating agent is present at a concentration ranging from about 0.5 to about 50 mg / mL. In some embodiments, the modulating agent is present at a concentration ranging from about 0.3 to about 30 mg / mL. In some embodiments, the modulating agent is present at a concentration ranging from about 0.1 or 1.0 to about 10 mg / mL. In some embodiments, the modulating agent is present at a concentration ranging from about 0.1 or 1.0 to about 0.3 or 3.0 mg / mL. In some embodiments,E3697-00624 Patent the modulating agent is present at a concentration of about 3.0 mg / mL. In any of these embodiments the modulating agent may be an organic compound modulator, a peptidomimetic modulator, or an antisense oligonucleotide modulator, for example. The above-noted dose concentrations may be decreased or increased as appropriate based on potency and specificity of the modulator, for example, and the nature or amount of a desired effect.
[0342] In one embodiment, the dose of compounds of formula I, for example tonabersat, and analogs of any of the foregoing compounds is approximately 0.1 micromolar and up to approximately 200 micromolar at or around a site of action, or higher, within the circulation to achieve those concentrations at the site of action. By way of example, the dose may be (but not limited to) a final circulating concentration or a concentration at or around a site of action of about 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7....
Claims
E3697-00624 Patent CLAIMS WE CLAIM:
1. A method for treating one or more signs or symptoms of a post-acute infection disorder in a subject comprising administering to the subject an effective amount of a connexin 43 hemichannel modulator.
2. A method according to claim 1, wherein the connexin hemichannel modulator inhibits release of ATP from connexin 43 hemichannels.
3. A method according to claim 1, wherein that connexin hemichannel modulator inhibits NLRP3 inflammasome activity.
4. The method of claim 1, wherein the subject has or has been diagnosed with long COVID.
5. The method of claim 1, wherein one or more signs or symptoms of a post- acute infection disorder are relieved or improved.
6. The method of claim 5, wherein the post-acute infection disorder is long COVID and one or more signs or symptoms of long-COVID are relieved or improved.
7. The method of claim 6, wherein the signs or symptoms of long-COVID that are relieved or improved are one or more of fatigue, brain fog, trouble concentrating, peripheral neuropathy, muscle pain and / or joint pain.
8. The method of claim 5 or 6, wherein the one or more one or more signs or symptoms of a post-acute infection disorder comprises a brain or neurological sign or symptom.
9. The method of claim 8, wherein the brain or neurological sign or symptom is selected from the group consisting of brain fog, peripheral neuropathies (pins & needles / numbness any body part), dizziness, confusion, hallucinations, loss of smell and / or taste, phantom smells and / or taste, tinnitus (ringing in ears), internal vibrations / tremors, speech issues / stutter, stroke, seizures, and headaches.
10. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises an ocular sign or symptom.
11. The method of claim 10, wherein the ocular sign or symptom is selected from the group consisting of eye pain, burning eye pain, feeling of sand / glass in eyes, eye redness, vision changes, visual disturbances / floaters.
12. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises a breathing or respiratory sign or symptom.E3697-00624 Patent 13. The method of claim 12, wherein the breathing or respiratory sign or symptom is selected from the group consisting of shortness of breath, cough, post exertional malaise (tired after minor exertion), and fatigue or extreme fatigue / exhaustion without exertion.
14. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID is a digestive or gastrointestinal sign or symptom.
15. The method of claim 14, wherein the digestive or gastrointestinal sign or symptom is selected from the group consisting of nausea, vomiting, diarrhea, bloating, and early satiety (feeling full after eating small amounts of food).
16. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises a cardiovascular sign or symptom.
17. The method of claim 16, wherein the cardiovascular sign or symptom is selected from the group consisting of heart arrythmias, tachycardia, bradycardia and chest pain.
18. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises a musculoskeletal sign or symptom.
19. The method of claim 18, wherein the musculoskeletal sign or symptom is selected from the group consisting of joint pain, muscle pain and bone pain.
20. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises a dermatological sign or symptom.
21. The method of claim 20, wherein the dermatological sign or symptom is selected from the group consisting of skin rashes and hair loss.
22. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises a mental health sign or symptom.
23. The method of claim 22, wherein the mental health sign or symptom is selected from the group consisting of anxiety and depression.
24. The method of claim 6, wherein the one or more one or more signs or symptoms of long-COVID comprises a sign or symptom selected from the group consisting of flushing of the face, facial paralysis, ptosis, bruising, cold hands and / or feet, heat and / or cold intolerance, feeling of fever without having one, and mottling of hands and / or feet.
25. The method of claim 1, wherein the connexin hemichannel modulator is a compound according to Formula I.
26. The method of claim 25, wherein the connexin hemichannel modulator is a compound according to Formula I is tonabersat.E3697-00624 Patent 27. The method of claim 26, wherein tonabersat is administered orally and the subject is a human.
28. The method of claim 1, wherein the connexin hemichannel modulator is a compound is a tonabersat prodrug.
29. The method of claim 27, wherein the tonabersat prodrug is a compound according to Formula II.
30. The method of claim 1, wherein the connexin hemichannel modulator is administered at least once per day.
31. The method of claim 1, wherein the connexin hemichannel modulator is administered orally, topically, or parenterally.
32. The method of claim 1, wherein the connexin hemichannel modulator is tonabersat and it is administered in an amount ranging from about 40 mg to 80 mg per dose.
33. The method of claim 32, wherein the connexin hemichannel modulator is administered once per day, twice per day, every other day, twice a week, or once a week.
34. The method of claim 1, where the subject is a human.
35. A method for treating one or more signs or symptoms of a post-acute infection disorder in a subject comprising administering to the subject a loading dose of a connexin 43 hemichannel modulator followed by the administration of a maintenance dose.
36. The method of claim 35 wherein, the post-acute infection disorder is long COVID.
37. The method of claim 36 wherein, the post-acute infection disorder is long COVID and one or more signs or symptoms of long-COVID are relieved or improved.
38. The method of claim 37, wherein the signs or symptoms of long-COVID that are relieved or improved are one or more of fatigue, brain fog, trouble concentrating, peripheral neuropathy, muscle pain and / or joint pain.
39. A method for preventing or ameliorating one or more signs or symptoms of a post-acute infection disorder in a subject comprising administering to the subject an effective amount of a connexin 43 hemichannel modulator.
40. A method according to claim 39, wherein the connexin hemichannel modulator inhibits release of ATP from connexin 43 hemichannels.
41. A method according to claim 39, wherein that connexin hemichannel modulator inhibits NLRP3 inflammasome activity.
42. The method of claim 39, wherein the subject has or has been diagnosed with long COVID, long flu, or post-Lyme disease treatment syndrome.
Citation Information
Patent Citations
Channel modulators
US20200239889A1
DSG2 compositions and methods for the treatment of covid-19
US20240043495A1
Compositions and methods for treatment of subjects suffering from a SARS-COV-2 infection
WO2024016019A1