Novel transcription factor combinations for immune cell reprogramming and related methods

Abstract

The present disclosure relates to constructs or vectors encoding novel combinations of transcription factors for direct cell reprogramming into immune cells, compositions, methods, cells comprising thereof, and uses thereof. The present invention in particular provides novel combinations of transcription factors improving reprogramming to dendritic cells, such as cDC1, and / or enabling direct cell reprogramming into specific dendritic cell subsets or states. The present disclosure also provides novel combinations improving reprogramming to other myeloid or lymphoid immune cells such as macrophages or NK cells. Finally, the present disclosure also provides methods for the identification of combinations of transcription factors useful for cell reprogramming, in particular for cDC1 cell reprogramming.

Description

[0001]P6783PC02 Novel transcription factor combinations for immune cell reprogramming and related methods Technical fieldThe present invention relates to compositions of transcription factors forreprogramming or inducing cells into immune cell types, such as subsets of dendritic cells, macrophages, or NK cells, methods and uses thereof. The present invention further relates to methods for the identification of combinations of transcription factorsuseful for cell reprogramming, in particular for cDC1 cell reprogrammingBackground Immunotherapy has redefined cancer treatment, with immune checkpoint blockade andCAR-T cell therapies providing unprecedented long-term responses (Zimmermannovaet al. (2021)). However, only a fraction of the patients benefits, and many cancers,such as cold solid tumors, remain non-responsive (Ribas et al. (2018)). Beyondoncology, the immune system has vast potential to address autoimmunity andinfection. Realizing this potential requires harnessing diverse immune cell types thathave evolved to divide labour and elicit different types of immune responses (i.e., (T-helper 1) Th1, Th2, Th17, regulatory, etc.) (Yin et al. (2021), Cabeza-Cabrerizo et al.(2021)). However, current sources of immune cells remain limited as they are often inaccessibly located in tissues, face manufacturing challenges and may be dysfunctional due todisease, limiting the available immune cell subsets to those derived from peripheralblood or tumors (e.g., tumor-infiltrating lymphocytes) (Zimmermannova et al. (2021)).Although induced pluripotent stem cells (iPSCs) offer a promising alternative, protocolsfor immune cell generation are complex, costly, and often yield immature cellsresembling primitive hematopoiesis (Alsinet et al. (2022)). This shortage of protocolsfor generating rare immune cell subsets hinders immunotherapy advancements.Direct cell fate reprogramming, which bypasses intermediate pluripotency through ectopic transcription factor (TF) expression, has emerged as a promising approach forrapid production of rare immune cells (Wang et al. (2021)). For instance, the TFcombination PU.1, IRF8, and BATF3 (PIB) has successfully reprogrammed fibroblastsand cancer cells into type 1 conventional dendritic cells (cDC1)-like cells (Rosa et al.(2018), Rosa et al. (2022), Zimmermannova et al. (2023)). This approach elicits in vivoreprogramming by delivering the reprogramming combination in situ (within tumors) P6783PC02(Ascic et al. (2024)) and therefore reducing cell manufacturing challenges. Despitepromising results in mouse models of melanoma, leukemia, and glioblastoma(Zimmermannova et al. (2023), Ascic et al. (2024), Linde et al. (2023), Liu et al.(2024)), the exploration of reprogramming of immune cell types lags behind other cellsystems with regenerative medicine applications (e.g., neural, hepatic and cardiac celltypes) (Wang et al. (2021)). To date, TF codes have been identified only for cDC1s andmacrophages, with no reported combinations for other myeloid cells, granulocytes,innate lymphoid cells, or B and T cells and their respective subsets. Collectively, theserepresent over 86 distinct immune cell types (Domínguez Conde et al. (2022)).Identifying TFs that specify target cell fates remains a central challenge in cell reprogramming. Past approaches have used iterative TF screening using pools of TFs and removingone at a time (N-1) (Rosa et al. (2018), Takahashi et al. (2006)), in silico predictionsbased on gene regulatory networks (Kamaraj et al. (2020), The FANTOM Consortiumet al. (2016), Morris et al. (2014), Jung et al. (2021)), or multiplexed pooledexperiments with single-cell readouts (Joung et al. (2023), Parekh et al. (2018),Hersbach et al. (2022), Duan et al. (2019)). Iterative manual screens have enabled theidentification of minimal TF combinations for generation of induced pluripotent stemcells (iPSCs) (Takahashi et al. (2006)), induced hematopoietic stem and progenitorcells (iHSPCs) (Pereira et al. (2013)) and induced cDC1 (iDCs) (Rosa et al. (2018)),among others. However, these methods are labor-intensive and rely on the availability and specificity of genetic mouse reporter systems. In silico approaches offer an alternative for theprediction of core TFs using available transcriptomic and epigenomic data (Kamaraj etal. (2020), The FANTOM Consortium et al. (2016), D’Alessio et al. (2015)), but existingmodels frequently assume uniform detectability of all TFs and linear relationshipsbetween them. More recently, barcoded libraries of human transcription factors havebeen used to elucidate transcription factors and gene regulatory networks able to induce differentiation of embryonic and pluripotent stem cells towards specific cell types including neurons, smooth muscle, intestinal epithelial cells and trophoblast(Joung et al.2023, Ng et al.2021). Additionally, multiplexed screening platformsmerged with single-cell sequencing have emerged to allow for the simultaneousdetection of TFs and gene expression in cells transduced with a library of TFs (Jounget al. (2023), Hersbach et al. (2022), Liu, W., Saelens, W., et al. (2024)). Theseapproaches are versatile platforms in developmental biology as they allow the P6783PC02 identification of transcription factors and gene regulatory networks underlying differentiation of stem cells towards specific cell states and cell types.Yet, these methods do not allow the detection of combinations of multiple TFs, (e.g. 2,3 or a fortiori more than 4) which represent the minimal instructive network essential foreffective cell fate reprogramming (Pereira et al. (2012)). Thus, although direct cellreprogramming holds great potential for immunotherapy, it is still constrained by the lack of immune cell-specific transcription factor (TF) networks enabling high reprogramming efficiency and / or fidelity, and / or enabling reprogramming to specific immune cell types or subtypes of therapeutic interest. SummaryHere, the inventors used REPROcode, a combinatorial screening platform, to identifyTF combinations for immune cell reprogramming at the single-cell level. Using cDC1-enriched TFs, REPROcode enabled the identification of reprogramming fidelityenhancers and regulators of cDC1 states. A diverse set of 48 TFs enriched in cDC1, cDC2, and plasmacytoid dendritic cells (pDC) allowed for simultaneous induction of multiple myeloid and lymphoid cell types and construction of a TF hierarchy map to inform immune cell reprogramming. By expanding to 48 TFs enriched in cDC1, cDC2,and plasmacytoid DCs (pDC)lineages, the inventors identified key TF combinations for these, importantly, includingTF combinations resulting in higher reprogramming efficiency and / or fidelity comparedto known combinations, and novel TF combinations for other immune cell fates, subsets or states, thereby enabling more efficient and fine-tuned reprogramming compared to known combinations and methods, and allowing the generation of reprogrammed immune cells at higher efficiency and / or with significant phenotypic,transcriptional and functional advantages compared to reprogrammed cells generatedwith known combinations.Thus, in a first aspect, the present invention relates to a composition comprising acombination of transcription factors, wherein said combination comprises or consists of: a. PU.1, and one or more transcription factors selected from the groupconsisting of: IRF8, BATF3, KLF4, REL, ID2, MXD1, NR4A1, RBPJ,HHEX, ETS1, IRF7, BCL6, TBX21, ARID3A, IKZF2, RUNX3, NFKBIA, and NFKBIB; P6783PC02 and / or b. IRF8, and one or more transcription factors selected from the group consisting of ETS1, RBPJ, ZBTB46, NR4A1, NFIL3, and RUNX3.A second aspect of the present invention relates to one or more constructs or vectorsencoding a combination of transcription factors wherein said combination comprises or consists of: a. PU.1, and one or more transcription factors selected from the groupconsisting of: IRF8, BATF3, KLF4, REL, ID2, MXD1, NR4A1, RBPJ, HHEX, ETS1, IRF7, BCL6, TBX21, ARID3A, IKZF2, RUNX3, NFKBIA, and NFKBIB; and / or b. IRF8, and one or more transcription factors selected from the groupconsisting of ETS1, RBPJ, ZBTB46, NR4A1, NFIL3, and RUNX3.A third aspect of the present invention relates to a composition comprising the one ormore constructs or vectors as described herein.A fourth aspect of the present invention relates to the composition, or the one or moreconstructs or vectors described herein, for use in inducing or reprogramming a cell intoan immune cell. A fifth aspect of the present invention relates to a host cell comprising the one or more constructs or vectors or the composition described herein. A sixth aspect of the present invention relates to the use of the composition or the oneor more constructs or vectors as described herein to induce or reprogram cells intoimmune cells. A seventh aspect of the present invention relates to a method for reprogramming or inducing a cell into an immune cell, comprising the step of: a. transducing a cell with the one or more constructs or vectors describedherein, or b. contacting a cell with the composition described herein. P6783PC02An eighth aspect of the present invention relates to an immune cell obtained by themethod described herein.A ninth aspect of the present invention relates to a composition comprising an immunecell as described herein.A tenth aspect of the present invention relates to the one or more constructs or vectors,the composition, the host cell, or the immune cell described herein, for use in veterinary or human medicine. An eleventh aspect of the present invention relates to the one or more constructs or vectors, the composition, the host cell, or the immune cell as described herein, for use in the treatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases.A twelfth aspect of the invention relates to a method of treating cancer, such as solidtumor cancers and / or hematological cancers, autoimmune diseases, or infectiousdiseases, said method comprising administering to an individual in need thereof thecomposition, the one or more constructs or vectors, the host cell, and / or the immunecell described herein.A thirteenth aspect of the present invention relates to the use of the composition, theone or more constructs or vectors, the host cell, and / or the immune cell described herein, for the manufacture of a medicament for the treatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases.A fourteenth aspect of the invention relates to the one or more constructs or vectors,the composition, the host cell, or the immune cell as described herein, for use in diagnosis or drug screening.A fifteenth aspect of the present invention provides a method of identifying theexpression of at least one, such as at least two transcription factors (TFs) associated with cell reprogramming in a population of host cells, the method comprising: P6783PC02 a) generating a library of TFs polynucleotides sequences, wherein eachsequence is tagged with a unique nucleic acid barcode, in one or more vector(s) comprising a backbone comprising a sequence encoding a polyA signal, a post-transcriptional response element (PRE) and a 3’ long terminalrepeat sequence (LTR) region, wherein each nucleic acid barcode is located upstream of the sequence encoding the polyA signal and in the region between the PRE and LTR on the vector(s) backbone; b) transducing a population of host cells with said one or more vector(s);c) identifying the barcodes present in said transduced cells by single-celltranscriptomics, thereby identifying the TF(s) acquired by said transduced cells; d) analysing the transcriptional profile of said transduced cells, therebycharacterizing the reprogramming of said transduced cells; e) correlating the transcriptional profile of each cell analysed in step d) with thatof specific natural immune cell types, and with the corresponding TFs acquired by said transduced cells; thereby identifying the expression of the at least one, such as at least two TFs associated with cell reprogramming in the population of host cells.A sixteenth aspect of the present invention provides one or more vectors comprising aconstruct, wherein the construct comprises: -a transcription factor (TF) sequence;- a post- transcriptional response element sequence;- a nucleic acid barcode sequence;- a 3’ long terminal repeat sequence sequence (LTR);- a polyadenylation signal sequence (polyA),wherein the nucleic acid barcode is located between the PRE and LTR sequences, upstream of the polyA. Description of Figures Figure 1: Position of the barcode and barcode detection method impact efficacy of barcode detection in REPROcode platform. (A (i) to (iv)) t-distributed stochasticneighbour embedding (t-SNE) visualization showing the presence (dark, examples areindicated with black arrows) or absence (gray) of selected TF in particular cell using barcoded plasmids of version 1, v1. Total number of cells profiled (1163 cells) and P6783PC02 number of cells overexpressing each transcription factor is highlighted on the top of eachtSNE. (B) Distribution of reads from scRNAseq mapped to the backbone encoding thetranscription factor BATF3. Different functional elements of the plasmid are highlighted,including the zone where the barcode was positioned (version 1, v1). (C) Schematicrepresentation of plasmid structure with optimal barcode placement (version 2, v2). (D(i) to (v)) t-SNE visualization showing the presence (dark) or absence (gray) of selectedTF in particular cell using barcoded plasmids of version 2, v2. Total number of cells profiled (867 cells) and number of cells overexpressing each transcription factor ishighlighted on the top of each tSNE. (E) Pie chart showing the distribution of TF in livecells transduced with 9 TF (upper panel), benchmarked to the distribution of TFs fromJoung et al. 2023. (F) Distribution of distinct barcodes in cells with barcode detectionalgorithm not allowing mismatches in barcode sequence (upper panel) or allowing twomismatches in barcode sequence (bottom panel). SFFV: spleen focus-forming virus, TF: transcription factor, wpre : woodchuck hepatitis virus post- transcriptional responseelement, LTR : long terminal repeat, polyA : polyadenylation tail.Figure 2: REPROcode platform allows the identification of transcription factorcombinations allowing cell fate reprogramming towards cDC1 fate. (A) Upperpanel: experimental strategy to establish and validate a combinatorial screening platform (REPROcode) to identify transcription factor (TF) combinations for direct cell fate reprogramming of unrelated cell types to immune cells. A library of barcoded immune- specific TFs individually cloned in lentiviral vectors downstream the SFFV promoter and coded with 8-base pair DNA barcodes (Brc) in the 3’UTR, 300 base pairs (bp) upstream the poly(A) sequence (pA) are used to transduce human fibroblasts. After 9 days of reprogramming, hematopoietic cells (CD45+) or subpopulations of cells expressing relevant reprogramming markers are FACS sorted and analyzed by single cell mRNA- sequencing (3’scRNA-seq), allowing identification of transcriptomes in individual reprogrammed cells and the instructive TF combination by identification of Brc. Bottom panel: As proof-of-concept for REPROcode, a library composed of a pool of 9 TFs expressed in cDC1s, including the instructors PU.1, IRF8 and BATF3, was used to transduce human embryonic fibroblasts (HEFs). Reprogrammed (day 9 CD45+HLA- DR+), non-reprogrammed (day 9 CD45-HLA-DR-) and cells at day 2 were FACS sorted and profiled by scRNA-seq. Analysis included barcodes analysis of single celltranscriptomes, and identification and normalization of TF codes. (B) Distribution of thepercentage of cells containing one TF, normalized to the total number of cells in each P6783PC02condition. (C) Distribution of number of TFs per single cells, normalized to the totalnumber of cells in each condition. (D) Distribution of the number of cells containing 3, 4and 5 TF combinations across each condition. Combinations are ordered according tothe most frequent TF combination in reprogrammed cells. (E) Classification ofsuccessfully reprogrammed cells using published DC subset data (Villani et al. 2017)using the scPred algorithm. (F) Barplot showing the distribution of exogonous UMI countsfor SPI1 (PU.1), IRF8, BATF3 in cells at day 2 after transduction (D2), CD45-HLA-DR- cells (45-DR-), and CD45+HLA-DR+ reprogrammed cells not affiliated (45+DR+) oraffiliated to DC1s by scPred. (G) Flow cytometry quantification of human embryonicfibroblasts (HEFs) reprogrammed with polycistronic vectors (PIB) alone or together with vectors encoding single PU.1, IRF8 or BATF3. Reprogrammed (CD45+HLA-DR+) and partially reprogrammed populations (CD45+HLA-DR− and CD45−HLA-DR+) are shown.(H) UMAP visualisation of two distinct TF combinations in CD45+HLA-DR+ cells. Left:PU1, IRF8, BATF3 combination containing cells coloured black and cells containing other combinations coloured in grey. Right: PU1, IRF8, BATF3 and GATA2 combination containing cells coloured in black and cells containing other combinations coloured ingrey. (I) Flow cytometry quantification of median fluorescence intensity (MFI) of CD40gated in CD45+ cells after transduction with PIB together with empty vector (MCS) orvector encoding individual transcription factors. (J) Pie chart showing the distribution ofTF in day 2 (live) cells transduced with 42 TF. (K) Distribution of number of TFs per singlecells, normalized to the total number of cells for 42 TF using 5, 10, 15, 40 copies per cell.Distribution is shown as a smooth area. (L) The distribution of the cell number with TFcombinations using downsampling towards 3 TF combination after normalization and restricting for DC1 specific population. Upper panel: low input (10X Genomics). Bottom panel: high input (BD Rhapsody). The top combination of 3 TF is highlighted.Figure 3. REPROcode allows the identification of instructive combinations oftranscription factor allows the induction of different cDC1 states. (A) Experimentalstrategy showing the REPROcode combinatorial screening platform allowing theidentification of transcription factor (TF) combinations for immune transdifferentiation (top). A library of barcoded immune-specific TFs was individually cloned in lentiviral vectors downstream of the constitutive splenic focus-forming virus (SFFV) promoter,coded with 8-base pair (bp) DNA barcodes (Brc) at the 3’UTR 300 bp upstream of thepoly(A) sequence (pA). TFs included in the REPROcode library were used to transduce human embryonic fibroblasts (HEFs). After 9 days of reprogramming, hematopoietic cells (CD45+) or subpopulations were FACS-sorted and analyzed by 3’ single-cell mRNA- P6783PC02 sequencing (scRNA-seq), allowing for parallel identification of the transcriptome(depicted as Uniform manifold approximation and projection (UMAP) visualization) andinstructive TF combinations (TF tags or barcodes) in those cells. Transduced cells were FACS-sorted and profiled by scRNA-seq, allowing barcode identification and TFcombination identification. (B) Barplots showing the enriched TFs in the three cell states(in addition to PU.1, IRF8, and BATF3; PIB). Cells expressing only one of the corresponding cDC1-state signatures (for example, expressing immature but not immunostimulatory nor activated migratory) were extracted (102, 72 and 40 cells for immature, immunostimulatory, and activated migratory, respectively). The frequency of TFs was normalized between signature-assigned and non-assigned reprogrammed(CD45+) cells. (C) Flow cytometry quantification of reprogramming efficiency (marked byCD45 and HLADR expression) and fidelity (marked by CD40 expression) after co-transduction of NFKB1A-IRES-mCherry with a polycistronic lentiviral vector encodingPIB-IRES-GFP. Percentage of reprogrammed (CD45+HLA-DR+) and partiallyreprogrammed populations (CD45+HLADR− and CD45−HLA-DR+) withinGFP+mCherry+ cells (upper panel) are shown. Percentage of CD40+ cells withinGFP+mCherry+ cells are shown (bottom panel) (n = 1; mean ± SD). (D-L) Barplotsshowing the expression values of individual genes (FOSB, ITGAE, NR4A2, NRP1, TYK2, IFITM3, SELL, SELPLG, LGALS9, LY86, STAT4, SAMSN1, NUDT17, RGS1, OGFRL1,BCL2A1 and ETV3) in cells expressing PIB plus additional transcription factors. Geneexpression was normalized between signature-assigned and non-assignedreprogrammed (CD45+) cells. Figure 4. REPROcode allows the identification of combinations of transcriptionfactors enabling the generation of diverse immune cells. (A) Experimental strategyto establish a diversity screen for inducing dendritic (DC) cell fates. Human embryonic fibroblasts (HEFs) were transduced with 48 TFs enriched in cDC1s, type 2 conventional DCs (cDC2) or plasmacytoid DCs (pDCs). TFs were selected based on top immune ranked TF for each cell type. Day 9 reprogrammed (CD45+) and non-reprogrammed (CD45-HLA-DR-) cells were FACS-sorted and analyzed by scRNA-seq. 49,902 cellswere profiled using BD Rhapsody. (B) UMAP visualisation for FACS purified non-reprogrammed (light grey) and reprogrammed (dark grey). (C) Cell-types were annotatedusing CellTypist (Domínguez Conde et al. (2022)) with a reference immune model. Cellswere divided into three groups: fraction significantly higher in reprogrammed cells (“Reprogrammed”); fraction significantly lower in reprogrammed cells (“Non- P6783PC02 reprogrammed”); fraction without significantly changes (“Partially Reprogrammed”). Ranked enriched immune cell types are listed. Innate lymphoid cell (ILC), hematopoietic stem cell (HSC) / multipotent progenitor (MPP), monocyte-macrophage (mono-mac), double negative (DN) thymocytes, megakaryocyte (MK). (D) Barplot showing the most frequent TF combinations in cDC1-labelled cells. All cells were downsampled towards combinations of 4 TFs and the top 10 most frequent TFs from these combinations were extracted after normalizing combination frequencies between reprogrammed (CD45+) and non-reprogrammed (CD45-HLA-DR-) cells. New combinations of 4 TFs composed from the top 10 TFs were subsequently assembled and ranked. The top 5 combinationsof 4 TFs in reprogrammed (left) and non-reprogrammed (right) cells are highlighted. (E)Bar plot showing the expression value of cDC1 gene signature in cells overexpressing PIB together with additional TFs. Figure 5. REPROcode reveals key instructive TF combinations across multipleimmune cell lineages. (A) Barplot showing the most frequent TF combinations in DC3(cDC2)-restricted (top) and DC6 (pDC)-restricted (bottom) cells (Villani et al. (2017)). Allcells were downs-sampled towards combinations of 4 TFs and the top 10 most frequent TFs from these combinations were extracted after normalizing combination frequency between reprogrammed (CD45+) and non-reprogrammed (CD45-HLA-DR-) cells. New combinations of 4 TFs composed from the top 10 TFs were subsequently assembled and ranked based on normalized values between DC3 (cDC2)-like cells againstremaining cells and DC6-like cells against remaining cells. The top combinations of 4TFs are highlighted. (B) UMAP visualization of HEFs transduced with a pool of 48 TFs(10 copies per cell) enriched in cDC1, cDC2, or pDC lineages. Cells were profiled using scRNA-seq via BD Rhapsody. In the top left panel, high and low expression of PU.1 is highlighted. Expression levels of PTPRC, HLA-DR and CD7 are overlayed on the UMAPs. (C) TF hierarchy of reprogramming-based cell fate decisions modelled usingDecisionTreeRegressor (Pedregosa et al. (2011)). Branching points were defined usingdifferential expression gene analysis and are illustrated by high (black arrow) and low(grey arrow) TF expression. Exemplative genes are shown at each branching point andinduced cell fates based on gene expression analysis are highlighted in boxes. REL and IKZF2 branching points are highlighted and shown in panels D, E and F. Lymph node (LN) mature dendritic cell (DC), lymphoid natural killer cell (NK), dendritic cells (DC),macrophages (MΦ), type 1 conventional dendritic cell (cDC1). (D) At the PU.1 high, KLF4 P6783PC02 high, REL branching point, or (E) at the PU.1 high, KLF4 high, REL low, IKZF2 branching point, or (F) at the PU.1 high, KLF4 low, RBPJ high, RUNX3 branching point, cells withhigh and low REL or IKZF2 or RUNX3 expression are highlighted compared to non-reprogrammed cells and cells from other branches. Expression levels of exemplificativegenes for low and high REL, IKZF2 and RUNX3 branches including CD52, CD40, LYZ,NCR1, CTSL, ITGB7 are shown.Detailed description Definitions “biologically active variant” refers herein to a biologically active variant of a genetic element such as of a regulatory element, of a transcription factor (TF), or of a reprogramming modulator, which retains at least some of the functional activity of the parent genetic element, TF or reprogramming modulator. The term encompasses variants at the polypeptide level, including protein isoforms, that exhibit a minimum of 90% sequence similarity to the parent sequence. These variants may differ in their efficiency of inducing or inhibiting gene expression compared to the parent TF or modulator. For example, a biologically active variant of Basic Leucine Zipper ATF-Like Transcription Factor 3 (BATF3), Interferon Regulatory Factor 8 (IRF8), and PU.1 can act as said respective TF and induce or inhibit expression of the same genes in a cellas BATF3, IRF8, and PU.1, respectively, although the efficiency of the induction maybe different, e.g. the efficiency of inducing or inhibiting genes is decreased or increased compared to the parent TF. Unless otherwise indicated, the details of the polynucleotide sequences and other characteristics of the transcription factors and genes disclosed herein, can be obtained from the HGNC (HUGO Gene Nomenclature Committee) or NCBI (National Center forBiotechnology Information) using their official aliases used herein.Unless otherwise indicated, the details of the polypeptide sequences and other characteristics of the proteins disclosed herein can be obtained from the UniProt (Universal Protein Resource) database or NCBI's Protein database using the official identifiers or aliases used herein.“Identity” and “homology”, with respect to a polynucleotide or polypeptide, are definedherein as the percentage of nucleic acids or amino acids in the candidate sequence P6783PC02 that are identical or homologous, respectively, to the residues of corresponding native nucleic acids or amino acids, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent identity / similarity / homology, and considering any conservative substitutions according to the NCIUB rules (hftp: / / www.chem.qmul.ac.uk / iubmb / misc / naseq.html; NC-IUB, Eur J Biochem (1985)) as part of the sequence identity. Neither 5' or 3' extensions nor insertions (for nucleic acids) or N’ or C’ extensions nor insertions (for polypeptides) result in a reduction of identity, similarity or homology. Methods and computer programs for the alignments are well known in the art. Generally, a given homology between two sequences implies that the identity between these sequences is at least equal to the homology; for example, if two sequences are 70% homologous to one another, they cannot be less than 70%identical to one another – but could be sharing 80% identity.“Reprogramming" as used herein is used interchangeably with "direct reprogramming" or “transdifferentiation” and refers to the process of converting one cell type directly into another distinct cell type, bypassing intermediate pluripotent states. “Treating,” or “Treatment,” refers herein to any administration or application of a therapeutic for the disclosed diseases, disorders and conditions in subject, and includes inhibiting the progression of the disease, slowing the disease or its progression, arresting its development, partially or fully relieving the disease, or partially or fully relieving one or more symptoms of a disease. “Induction” refers to the first phase(s) of reprogramming, during which specific genetic, epigenetic, or signaling elements are introduced, and / or modulated to initiate the reprogramming process. “cDC1” as used herein refers to type 1 conventional dendritic cells, which play a crucial role in T cell-mediated tumor regression and response to ICB across various cancer types. cDC1s, a rare subset of DCs, express high levels of MHC class I and II, the co-stimulatory molecule CD40, and specific markers like XCR1, CLEC9A and CD226.“Immunostimulatory cDC1s” as used herein refers to potent immunostimulatoryantigen-presenting type 1 conventional dendritic cells specialized in cross-presentingantigens to CD8⁺ T cells, and in initiating cytotoxic T cell responses. P6783PC02“Improved cDC1s” as used herein refers to type 1 conventional dendritic cells withimproved phenotypic (e.g., higher expression of cDC1 surface markers including butnot restricted to CD45, HLA-DR and CD40), transcriptional (e.g., higher expression ofdistinct DC gene signatures including but not restricted to migratory cDC1, migratoryregulatory cDC1, mature cDC1 and immature cDC1 gene signatures) and / or functionalfeatures, including but not restricted to migratory capacity towards chemokine (e.g.,CCL19, CCL21, XCL1) gradients, antigen-presentation, effector T cell activation and / orregulatory T cell activation, compared to cDC1 cells generated, such as induced orreprogrammed, using the combination PU.1, IRF8, and BATF3 alone (PIB).“Migratory cDC1s” as used herein refers to type 1 conventional dendritic cellsspecialized in acquiring antigens from tumor cells in peripheral tissues and transportingthese to tumor-draining lymph nodes for priming of cancer-specific T cells. Migratory cDC1s express the chemokine receptor CCR7 which is critical for migration to lymph nodes.“mRegDCs” as used herein refers to migratory regulatory dendritic cells specialized inmigration to lymph nodes, suppression of immune responses and in promoting tissuerepair or tolerance.“mature cDC1s” as used herein refers to type 1 conventional dendritic cells specializedin activating naïve T cells and orchestrating adaptive immune responses. These cells express high levels of activation markers including but not restricted to co-stimulatorymolecules (e.g., CD40 and CD80), cytokines (e.g., IL-12) and MHC-I and MHC-IImolecules. “immature cDC1s” as used herein refers to type 1 conventional dendritic cellsspecialized in antigen capture and surveillance of peripheral tissues. Immature cDC1sexpress low levels of co-stimulatory molecules (e.g., CD40 and CD80) and MHC-I andMHC-II molecules, and show high capacity for antigen uptake but poor antigen-presentation and T cell activation capacity, being critical to maintain immune tolerance. Compositions comprising combinations of transcription factors P6783PC02In one aspect, the invention relates to a composition comprising a combination oftranscription factors, wherein said combination comprises or consists of: a. PU.1, and one or more transcription factors selected from the groupconsisting of: IRF8, BATF3, KLF4, REL, ID2, MXD1, NR4A1, RBPJ, HHEX, ETS1, IRF7, BCL6, TBX21, ARID3A, IKZF2, RUNX3, NFKBIA,and NFKBIB;and / or b. IRF8, and one or more transcription factors selected from the groupconsisting of ETS1, RBPJ, ZBTB46, NR4A1, NFIL3, and RUNX3.In some embodiments, the combination of transcription factors comprises or consists ofat least 2, such as at least 3, such as at least 4, such as at least 5, of the transcriptionfactors described herein. In some embodiments, the combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;e. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; h. PU.1, KLF4, RBPJ, and TBX21;i. IRF8, and at least one, such as at least 2, such as at least 3, such as atleast 4, of RUNX3, NR4A1, NFIL3, or ETS1; j. IRF8, ETS1, RBPJ and at least one of ZBTB46 or RUNX3and / or k. PU.1 and at least one, such as at least 2, such as at least 3, such as atleast 4, of KLF4, REL, IKZF2, RUNX3, RBPJ, or HHEX. In other embodiments, the combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1; P6783PC02 b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1 and HHEXe. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;f. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;g. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;h. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; i. PU.1, KLF4, RBPJ, and TBX21;j. IRF8, and at least one of: RUNX3, NR4A1, NFIL3, or ETS1;k. IRF8, ETS1, RBPJ, and at least one of ZBTB46 or RUNX3l. PU.1, KLF4, and IKZF2;and / or m. PU.1, RBPJ, and RUNX3.In some preferred embodiments, the combination comprises or consists of: i. PU.1, IRF8, BATF3, and ID2;ii. PU.1, IRF8, BATF3, and MXD1;iii. PU.1, IRF8, BATF3, and NR4A1;iv. PU.1, IRF8, BATF3, and RBPJ;v. PU.1, IRF8, BATF3, and HHEX;vi. PU.1, IRF8, BATF3, and ETS1;vii. PU.1, BATF3, NR4A1, and HHEX;viii. PU.1, BATF3, NR4A1, and RPBJ;ix. PU.1, IRF8, BATF3, ARID3A, and ETS1;x. PU.1, IRF8, BATF3, NR4A1, and ETS1;xi. PU.1, IRF8, BATF3, NR4A1, and HHEX;xii. PU.1 and HHEX;xiii. PU.1, IRF8, BATF3, NR4A1, and RPBJ;xiv. PU.1, IRF8, BATF3, and IRF7;xv. PU.1, IRF8, BATF3, and BCL6;xvi. PU.1, KLF4, and REL;xvii. PU.1, KLF4, and IKZF2;xviii. PU.1, KLF4, and RUNX3; P6783PC02 xix. PU.1, KLF4, REL, and IRF7;xx. PU.1, KLF4, REL, and BCL6;xxi. PU.1, IRF8, BATF3, and NFKBIA;xxii. PU.1, IRF8, BATF3, and NFKBIB;xxiii. PU.1, IRF8, KLF4, and TBX21;xxiv. PU.1, IRF8, KLF4, and RBPJ;xxv. PU.1, IRF8, RBPJ, and TBX21;xxvi. PU.1, KLF4, RBPJ, and TBX21;xxvii. PU.1, ETS1, IRF8, and ARID3A;xxviii. IRF8, RBPJ, ETS1, and ZBTB46;xxix. IRF8, RBPJ, ETS1, and RUNX3;xxx. IRF8, NR4A1, ETS1, and RUNX3;xxxi. IRF8, RBPJ, ETS1, and NFIL3;xxxii. IRF8, NR4A1, ETS1, and ZBTB46;xxxiii. PU.1, IRF8, and ARID3A;xxxiv. PU.1, KLF4, and IKZF2;and / or xxxv. PU.1, RBPJ, and RUNX3.In some embodiments of the composition, the transcription factors individually are at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the polypeptide sequences selected from the group consisting of: a. PU.1 of SEQ ID NO: 1;b. IRF8 of SEQ ID NO: 2;c. BATF3 of SEQ ID NO: 3;d. KLF4 of SEQ ID NO: 4;e. REL of SEQ ID NO: 5,f. ID2 of SEQ ID NO: 6;g. MXD1 of SEQ ID NO: 7;h. NR4A1 of SEQ ID NO: 8;i. RBPJ of SEQ ID NO: 9;j. HHEX of SEQ ID NO: 10;k. ETS1 of SEQ ID NO: 11;l. IRF7 of SEQ ID NO: 12; P6783PC02 m. BCL6 of SEQ ID NO: 13;n. TBX21 of SEQ ID NO: 14;o. ARID3A of SEQ ID NO: 15;p. IKZF2 of SEQ ID NO: 16;q. RUNX3 of SEQ ID NO: 17;r. NFKBIA of SEQ ID NO: 18;and / or s. NFKBIB of SEQ ID NO: 19, or biologically active variants thereof.In further embodiments of the composition, the transcription factors individually are encoded by a polynucleotide sequence at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the sequence selected from the group consisting of: a. PU.1 of SEQ ID NO: 20;b. IRF8 of SEQ ID NO: 21;c. BATF3 of SEQ ID NO: 22;d. KLF4 of SEQ ID NO: 23;e. REL of SEQ ID NO: 24,f. ID2 of SEQ ID NO: 25;g. MXD1 of SEQ ID NO: 26;h. NR4A1 of SEQ ID NO: 27;i. RBPJ of SEQ ID NO: 28;j. HHEX of SEQ ID NO: 29;k. ETS1 of SEQ ID NO: 30;l. IRF7 of SEQ ID NO: 31;m. BCL6 of SEQ ID NO: 32;n. TBX21 of SEQ ID NO: 33;o. ARID3A of SEQ ID NO: 34;p. IKZF2 of SEQ ID NO: 35;q. RUNX3 of SEQ ID NO: 36;r. NFKBIA of SEQ ID NO: 37;and / or s. NFKBIB of SEQ ID NO: 38, or biologically active variants thereof. P6783PC02 Constructs or vectors encoding combinations of transcription factors The combinations of transcription factors described herein may be beneficially encodedby one or more constructs or vectors, for example for more efficient delivery to cells ortissues, such as, but not limited to, in the applications to cell induction orreprogramming described herein.Thus, in another aspect, the present invention relates to one or more constructs orvectors encoding a combination of transcription factors wherein said combination comprises or consists of: a. PU.1, and one or more transcription factors selected from the groupconsisting of: IRF8, BATF3, KLF4, REL, ID2, MXD1, NR4A1, RBPJ, HHEX, ETS1, IRF7, BCL6, TBX21, ARID3A, IKZF2, RUNX3, NFKBIA,and NFKBIB;and / or b. IRF8, and one or more transcription factors selected from the groupconsisting of ETS1, RBPJ, ZBTB46, NR4A1, NFIL3, and RUNX3.In some embodiments, the one or more constructs or vectors encode a combination oftranscription factors comprising or consisting of at least 2, such as at least 3, such as atleast 4, such as at least 5, of the transcription factors described herein. In one embodiment of the one or more constructs or vectors according describedherein, said combination comprises or consists of:a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;e. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; h. PU.1, KLF4, RBPJ, and TBX21;i. IRF8, and at least one, such as at least 2, such as at least 3, such as atleast 4, of RUNX3, NR4A1, NFIL3, or ETS1; P6783PC02 j. IRF8, ETS1, RBPJ and at least one of ZBTB46 or RUNX3and / or k. PU.1 and at least one, such as at least 2, such as at least 3, such as atleast 4, of KLF4, REL, IKZF2, RUNX3, RBPJ, or HHEX. In other embodiments of the one or more constructs or vectors as described herein, said combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1 and HHEXe. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;f. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;g. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;h. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; i. PU.1, KLF4, RBPJ, and TBX21;j. IRF8, and at least one of: RUNX3, NR4A1, NFIL3, or ETS1;k. IRF8, ETS1, RBPJ, and at least one of ZBTB46 or RUNX3l. PU.1, KLF4, and IKZF2;and / or m. PU.1, RBPJ, and RUNX3.In preferred embodiments of the one or more constructs or vectors as describedherein, said combination comprises or consists of:i. PU.1, IRF8, BATF3, and ID2;ii. PU.1, IRF8, BATF3, and MXD1;iii. PU.1, IRF8, BATF3, and NR4A1;iv. PU.1, IRF8, BATF3, and RBPJ;v. PU.1, IRF8, BATF3, and HHEX;vi. PU.1, IRF8, BATF3, and ETS1;vii. PU.1, BATF3, NR4A1, and HHEX;viii. PU.1, BATF3, NR4A1, and RPBJ;ix. PU.1, IRF8, BATF3, ARID3A, and ETS1; P6783PC02 x. PU.1, IRF8, BATF3, NR4A1, and ETS1;xi. PU.1, IRF8, BATF3, NR4A1, and HHEX;xii. PU.1 and HHEX;xiii. PU.1, IRF8, BATF3, NR4A1, and RPBJ;xiv. PU.1, IRF8, BATF3, and IRF7;xv. PU.1, IRF8, BATF3, and BCL6;xvi. PU.1, KLF4, and REL;xvii. PU.1, KLF4, and IKZF2;xviii. PU.1, KLF4, and RUNX3;xix. PU.1, KLF4, REL, and IRF7;xx. PU.1, KLF4, REL, and BCL6;xxi. PU.1, IRF8, BATF3, and NFKBIA;xxii. PU.1, IRF8, BATF3, and NFKBIB;xxiii. PU.1, IRF8, KLF4, and TBX21;xxiv. PU.1, IRF8, KLF4, and RBPJ;xxv. PU.1, IRF8, RBPJ, and TBX21;xxvi. PU.1, KLF4, RBPJ, and TBX21;xxvii. PU.1, ETS1, IRF8, and ARID3A;xxviii. IRF8, RBPJ, ETS1, and ZBTB46;xxix. IRF8, RBPJ, ETS1, and RUNX3;xxx. IRF8, NR4A1, ETS1, and RUNX3;xxxi. IRF8, RBPJ, ETS1, and NFIL3;xxxii. IRF8, NR4A1, ETS1, and ZBTB46;xxxiii. PU.1, IRF8, and ARID3A;xxxiv. PU.1, KLF4, and IKZF2;and / or xxxv. PU.1, RBPJ, and RUNX3.In some embodiments, the transcription factors individually are at least 90%, such as atleast 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the polypeptide sequences selected from the group consisting of: a. PU.1 of SEQ ID NO: 1;b. IRF8 of SEQ ID NO: 2;c. BATF3 of SEQ ID NO: 3; P6783PC02 d. KLF4 of SEQ ID NO: 4;e. REL of SEQ ID NO: 5,f. ID2 of SEQ ID NO: 6;g. MXD1 of SEQ ID NO: 7;h. NR4A1 of SEQ ID NO: 8;i. RBPJ of SEQ ID NO: 9;j. HHEX of SEQ ID NO: 10;k. ETS1 of SEQ ID NO: 11;l. IRF7 of SEQ ID NO: 12;m. BCL6 of SEQ ID NO: 13;n. TBX21 of SEQ ID NO: 14;o. ARID3A of SEQ ID NO: 15;p. IKZF2 of SEQ ID NO: 16;q. RUNX3 of SEQ ID NO: 17;r. NFKBIA of SEQ ID NO: 18;and / or s. NFKBIB of SEQ ID NO: 19, or biologically active variants thereof.In other preferred embodiments, the transcription factors individually are encoded by apolynucleotide sequence at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the sequence selected from the group consisting of: a. PU.1 of SEQ ID NO: 20;b. IRF8 of SEQ ID NO: 21;c. BATF3 of SEQ ID NO: 22;d. KLF4 of SEQ ID NO: 23;e. REL of SEQ ID NO: 24,f. ID2 of SEQ ID NO: 25;g. MXD1 of SEQ ID NO: 26;h. NR4A1 of SEQ ID NO: 27;i. RBPJ of SEQ ID NO: 28;j. HHEX of SEQ ID NO: 29;k. ETS1 of SEQ ID NO: 30;l. IRF7 of SEQ ID NO: 31;m. BCL6 of SEQ ID NO: 32; P6783PC02 n. TBX21 of SEQ ID NO: 33;o. ARID3A of SEQ ID NO: 34;p. IKZF2 of SEQ ID NO: 35;q. RUNX3 of SEQ ID NO: 36;r. NFKBIA of SEQ ID NO: 37;and / or s. NFKBIB of SEQ ID NO: 38, or biologically active variants thereof.The one or more constructs or vectors described herein may encompass any suitable construct or vector capable of delivering the transcription factors (TFs) and / or gene expression downregulatory elements to target cells. These may include, but are not limited to, non-viral and / or viral delivery, such as plasmid DNA, synthetic oligonucleotides, RNA-based vectors, or viral vectors. Viral vectors may include, but not limited to, those derived from adenoviral (Ad), adeno-associated viral (AAV), lentiviral, retroviral, herpes viral, pox viral, paramyxoviral,rabdoviral, alphaviral, or flaviviral systems.Non-viral delivery may include, but not limited to, lipid or polymeric nanoparticlescarrying RNA or DNA encoding TFs, or protein-based carriers with the TFs.Thus, in some embodiments of the one or more constructs or vectors described herein,the vector is a viral vector, such as an adenoviral (Ad), an adeno-associated viralvector (AAV), a lentiviral, retroviral, adenoviral, herpes viral, pox viral, paramyxoviral,rabdoviral, alphaviral, or flaviral vector.In some embodiments, the one or more constructs or vectors comprise the constitutive SFFV promoter.In some embodiments, the one or more constructs or vectors comprise the internalribosome entry site (IRES) for cap-independent translation initiation. In some embodiments, the lentiviral vectors may be derived from pRRL.PPT.sf.hPIB.i2eGFP or pRRL.PPT.sf.hPIB.i2mCherry. P6783PC02Compositions or constructs or vectors further comprising or encoding one or moregene expression downregulatory elements The inventors have identified TF combinations enabling the induction orreprogramming to closely related cell types with overlapping regulatory pathways (suchas DC subtypes, and cDC1 subtypes) as well as more distinct cell types (such as NKcells). In some of these combinations, one or more TFs may be overexpressed, whilethe expression of one or more other TFs may be downregulated. Reference is made forexample, but not limited to, the example pathways disclosed on Fig.3C. Figure 3Cillustrates specific example pathways involving TFs (depicted in circles) and the resulting cell type at the end of each pathway. The figure highlights the outcomes achieved through the selective overexpression (high expression) of certain TFs or the downregulation of others, thus demonstrating the regulatory mechanisms underlying the reprogramming process. The overexpression of TFs can typically be achieved by delivering the TFs themselves,or the genes encoding thereof, into cells. This can be accomplished using thecompositions or the one or more constructs or vectors, as described herein.The downregulation of TFs can typically be achieved by employing nucleic acidelements that suppress their expression. This may include the use of constructs or vectors encoding RNA interference molecules (e.g., siRNA, shRNA) or other gene- silencing technologies, as described herein. Thus, in some aspects, the present invention provides compositions or constructs or vectors modulating gene expression through both transcription factor overexpression and gene expression downregulation. The compositions or the one or more constructs or vectors of the present invention may comprise or encode both overexpression elements (e.g., TFs) and geneexpression downregulatory elements such as gene downregulation or knockdownelements (e.g., siRNAs, shRNAs, antisense oligonucleotides, and other similar molecules). Specifically, the one or more constructs or vectors of the present invention may encode TFs for overexpression as described herein, while also comprising or encoding gene expression downregulatory elements, such as elements for gene downregulation or P6783PC02knockdown, for instance of other TFs, such as the ones described on Fig. 3C forexample.Such compositions or constructs or vectors may be useful for instance in therapeuticapplications, for example therapeutic applications where fine-tuned reprogrammingtowards a specific cell fate is beneficial, such as as described in the section Medicaluses and methods of treatment herein.In preferred embodiments, the composition or the one or more constructs or vectorsfurther comprise or encode one or more nucleic acid elements selected from the groupconsisting of: short hairpin RNA (shRNA), small interfering RNA (siRNA), antisenseoligonucleotides, ribozymes, microRNA (miRNA) mimics, CRISPR-associated systems such as CRISPR interference (CRISPRi).The skilled person will appreciate that other nucleic acid-based modality or moleculartool capable of reducing the expression or activity of one or more target genes, such asother RNA interference (RNAi)-based or DNA-targeting modalities known in the artsuitable for gene downregulation may be used. In certain embodiments, the composition or the one or more constructs or vectors further comprise or encode one or more nucleic acid elements configured to downregulate the expression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4, RBPJ, RUNX3, and HHEX. In other embodiments, the composition or the one or more constructs or vectors further comprise or encode one or more nucleic acid elements configured to downregulate the expression of one or more target genes selected from the group consisting of: REL and IKZF2.In some embodiments, the composition or the one or more constructs or vectors furthercomprise or encode one or more nucleic acid elements configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ. P6783PC02 By configuring the compositions or the constructs or vectors of the present invention to include nucleic acid elements targeting specific genes, the invention allows for fine- tuning of the reprogramming process, enabling the directed induction or reprogramming of cells to immune cells, such as dendritic cell (DC) subtypes, or other related cell types, or natural killer (NK) cells. Compositions of constructs or vectorsA further aspect of the invention relates to a composition comprising the one or moreconstructs or vectors described herein, such as the one or more constructs or vectorsdescribed in the sections Constructs or vectors encoding combinations of transcriptionfactors and Compositions or constructs or vectors further comprising or encoding oneor more gene expression downregulatory elements hereinabove.The TFs and gene expression downregulatory elements, such as the one or more elements described in the section Compositions or constructs or vectors further comprising or encoding one or more gene expression downregulatory elements hereinabove, may also be delivered separately from the composition, or the one or more constructs or vectors encoding the combinations of TFs described herein. Theseelements may be co-delivered to the target cells to be induced or reprogrammed ordelivered independently. For example, gene expression downregulatory elements such as siRNAs may be delivered directly in their functional form (e.g., as synthetic siRNA molecules) without requiring incorporation into a construct or vector. Alternatively, these downregulatory elements may be encoded by separate constructs or vectors, distinct from those used to deliver the TFs. Thus, in some embodiments, the composition further comprises one or more nucleic acid elements selected from the group consisting of: short hairpin RNA (shRNA), small interfering RNA (siRNA), antisense oligonucleotides, ribozymes, microRNA (miRNA) mimics, CRISPR-associated systems such as CRISPR interference (CRISPRi), or one or more constructs or vectors encoding thereof. P6783PC02In some embodiments, the composition further comprises one or more nucleic acidelements configured to downregulate the expression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4, RBPJ, RUNX3, and HHEX.In other embodiments, the composition comprises one or more nucleic acid elementsare configured to downregulate the expression of one or more target genes selected from the group consisting of: REL and IKZF2. In further embodiments, the composition further comprises one or more nucleic acid elements configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ.Compositions and constructs or vectors for use in inducing or reprogramming a cell intoan immune cell.In preferred embodiments, the compositions, or the one or more constructs or vectors,described herein are for use in inducing or reprogramming a cell into an immune cell.In other embodiments, the compositions further comprise one or morepharmaceutically acceptable excipients, carriers, stabilizers, diluents, or adjuvants. In some embodiments, the compositions, or the one or more constructs or vectors,further comprise or encode additional functional molecules, such as selectablemarkers, reporter genes, or resistance genes. In other embodiments, the compositions, or the one or more constructs or vectorsfurther comprise cytokines, such as IL-12, IL-4, IFN-α, IFN-β, IFN-γ, TNF, and / or GM-CSF, or nucleic acids encoding thereof.In preferred embodiments, the compositions described herein are pharmaceuticalcompositions. Host cellsA further aspect of the invention relates to a host cell comprising the composition or theone or more constructs or vectors described herein.Said host cell may be any cell containing the composition or the one or more constructsor vectors described herein, and encompasses cells which are used at any steps of the P6783PC02uses and methods described herein, including cells used as research tools, or cellsused for vector production, such as viral vector production (including but not limited toHEK cells and other cells suitable for vector production known in the art), according tomethods known in the art, for instance of viral vector particles production. Use in reprogramming or inducing a cell into an immune cellA further aspect of the invention relates to the use of the composition or the one ormore constructs or vectors as described herein to induce or reprogram cells intoimmune cells.Methods for reprogramming or inducing a cell into an immune cellAnother aspect of the invention relates to a method for reprogramming or inducing acell into an immune cell, comprising the step of a. transducing a cell with the one or more constructs or vectors asdescribed herein, or b. contacting a cell with the composition as described herein.In some embodiments, the method is an in vitro method.In further embodiments, the method further comprises the step of expressing thecombination of transcription factors and / or the one or more nucleic acid elements encoded by the one or more constructs or vectors, whether following the transduction of step a. or the contact of step b. with the composition comprising said constructs or vectors.In some embodiments, the method further comprises a step of culturing the cells duringat least 2 days, preferably at least 5 days, more preferably at least 8 days, even morepreferably at least 9 days following the step a. of transducing or the step b. ofcontacting the cell with constructs or vectors described herein.In some embodiments, the method further comprises a step of contacting the cells withcytokines, such as immunostimulatory cytokines, or such as IL-12, IL-4, IFN-α, IFN-β, IFN-γ, TNF, and / or GM-CSF, or a step of transducing the cells with nucleic acids encoding thereof. P6783PC02 Cell typesThe combinations of TFs of the compositions or of the constructs and vectors disclosedherein may be used to induce or reprogram any cell to an immune cell. Said cell istypically a “target cell” for the compositions or the constructs or vectors describedherein, or “starting cell”, which will undergo conversion to an immune cell type, subtypeor state as described herein.In some embodiments of the compositions, the one or more constructs or vectors, thehost cell, the use, or the method described herein, the cell is selected from the group consisting of: an endoderm derived cell, a mesoderm derived cell, or an ectoderm derived cell. For example, mesoderm-derived cells may include fibroblasts, such as primary fibroblasts, dermal fibroblasts, lung fibroblasts, cardiac fibroblasts, and synovial fibroblasts. Specific types of fibroblasts may also include human embryonic fibroblasts (HEFs), mouse embryonic fibroblasts (MEFs), fetal fibroblasts, and cancer-associated fibroblasts (CAFs). In other embodiments of the one or more constructs or vectors, the composition, thehost cell, the use, or the method the cell is a stem cell or differentiated cell, such asfibroblasts, or mixtures thereof.In yet other embodiments of the one or more constructs or vectors, the composition,the host cell, the use, or the method of the present disclosure, the stem cell is selectedfrom the group consisting of: pluripotent stem cell and multipotent stem cell such as a mesenchymal stem cell, a hematopoietic stem cell, or an intestinal stem cell.Pluripotent stem cells may include, but not limited to, embryonic stem cells or inducedpluripotent stem cells (iPSCs). In preferred embodiments of the one or more constructs or vectors, the composition,the host cell, the use, or the method described herein, the differentiated cell is a cancercell. Said cancer cell may be, but not limited to, a solid tumor cell, a hematological cancer cell, a cancer cell line, a metastatic cancer cell, a primary tumor-derived cell, a circulating tumor cell, an organoid-derived cancer cell, a genetically modified cancercells, and a cancer stem cell. P6783PC02In further embodiments of the one or more constructs or vectors, the composition, thehost cell, the use, or the method described herein, the cell is a mammalian cell, suchas a human cell, a non-human cell or a mouse cell. Immune cell types, subsets and states. A further aspect of the present invention relates to an immune cell obtained by the method described herein.In preferred embodiments of the one or more constructs or vectors, the composition,the host cell, the use, the method, or the immune cell described herein, the immunecell is a dendritic cell, such as a mature dendritic cell or an immature dendritic cell, and,optionally, the one or more nucleic acid elements are configured to downregulate theexpression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4 and RBPJ, preferably wherein the one or more nucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL and IKZF2.In other preferred embodiments of the one or more constructs or vectors, thecomposition, the host cell, the method, the use, or the immune cell described herein, the immune cell is of the myeloid lineage, such as a dendritic cell, a monocyte or a macrophage, or of the lymphoid lineage, such as a NK cell.In yet other preferred embodiments of the one or more constructs or vectors, thecomposition, the host cell, the method, the use, or the immune cell described herein, the immune cell is a dendritic cell, such as a mature dendritic cell or an immature dendritic cell. In some embodiments, the mature dendritic cell, such as the mature cDC1 expresses CD40, CD80, cytokines such as IL-12, MHC-I and / or MHC-II. In further embodiments, the mature cDC1 is capable of activating naïve T cells. In some embodiments, the immature dendritic cell, such as the immature cDC1, expresses lower levels of CD40, CD80, MHC-I and / or MHC-II compared to mature cDC1. In other embodiments, the immature dendritic cell, such as the immature cDC1 are capable of antigen uptake but have lower antigen presentation capacity and / or T P6783PC02 cell activation capacity than mature cDC1, such as no antigen presentation capacity and / or T cell activation capacity.In some embodiments of the invention, wherein the immune cells are immature cDC1cells, said cells are characterized by: -a downregulation of the expression of the genes Ly86, NUDT17, BCL2A1;and -an upregulation of the expression of the genes FOSB, and NRP1,such as compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1, IRF8, and BATF3. In other embodiments of the invention, wherein the combination of TFs comprises orconsists of PU.1, IRF8, BATF3, and NFKBIA, and wherein the cells are immaturecDC1, said cells are characterized by: -a downregulation of the expression of the genes NR4A2, SELL, Ly86, NUDT17,and BCL2A1;and -an upregulation of the expression of the genes FOSB, ITGAE, NRP1, TYK2,compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1,IRF8, and BATF3.In some embodiments of the invention, wherein the combination of TFs comprises orconsists of PU.1, IRF8, BATF3, and NFKBIB, and wherein the cells are immaturecDC1, said cells are characterized by: -a downregulation of the expression of the genes Ly86, NUDT17, RGS1, andBCL2A1; and -an upregulation of the expression of the FOSB, NRP1, SELPLG, and STAT4compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1, IRF8, and BATF3.In even more preferred embodiments of the one or more constructs or vectors, thecomposition, the host cell, the method, the use, or the immune cell described herein, the immune cell is a type 1 conventional dendritic cell (cDC1) and, optionally, the one P6783PC02 or more elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ. In preferred embodiments, the cDC1 cell expresses MHC class I and II, CD40, XCR1, CLEC9A and / or CD226. In some embodiments of the one or more constructs or vectors, the composition, the host cell, the method, the use, or the immune cell of the present disclosure, the immune cell is an immunostimulatory cDC1 cell. In some embodiments of the invention, wherein the immune cells are immunostimulatory cDC1 cells, said cells are characterized by: -a downregulation of the expression of the genes NR4A2, SAMSN1, NUDT17,and RGS1; and -an upregulation of the expression of the genes FOSB, ITGAE, NRP1, TYK2,BCL2A1, and ETV3, such as compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1, IRF8, and BATF3. In other embodiments of the invention, wherein the combination of TFs comprises orconsists of PU.1, IRF8, BATF3, and ID2, and wherein the cells are immunostimulatorycDC1, said cells are characterized by: -a downregulation of the expression of the genes NR4A2, SAMSN1, NUDT17,and RGS1; and -an upregulation of the expression of the genes FOSB, ITGAE, NRP1, TYK2,IFITM3, SELL, LY86, BCL2A1, and ETV3,compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1,IRF8, and BATF3. In other embodiments of the invention, wherein the combination of TFs comprises orconsists of PU.1, IRF8, BATF3, and MXD1, and wherein the cells areimmunostimulatory cDC1, said cells are characterized by: P6783PC02 -a downregulation of the expression of the genes NR4A2, SAMSN1, NUDT17,RGS1; and -an upregulation of the expression of the genes FOSB, ITGAE, NRP1, TYK2,STAT4, OGFRL1, BCL2A1, ETV3, compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1, IRF8, and BATF3. In other embodiments of the one or more constructs or vectors, the composition, thehost cell, the method, the use, or the immune cell of the present disclosure, theimmune cell is an “improved”cDC1 cell, preferably wherein said cell has improvedphenotypic (e.g., higher expression of cDC1 surface markers including but not restricted to CD45, HLA-DR and CD40), transcriptional (e.g., higher expression of distinct DC gene signatures including but not restricted to migratory cDC1, migratory regulatory cDC1, mature cDC1 and immature cDC1 gene signatures) and / or functional features, including but not restricted to migratory capacity towards chemokine (e.g., CCL19, CCL21, XCL1) gradients, antigen-presentation, effector T cell activation and / or regulatory T cell activation, compared to a cDC1 cell generated, such as induced or reprogrammed, using the combination PU.1, IRF8, and BATF3 alone (PIB). In yet other embodiments of the one or more constructs or vectors, the composition,the host cell, the method, the use, or the immune cell of the present disclosure, theimmune cell is a migratory cDC1 cell. In preferred embodiments, the migratory cDC1 cell expresses the chemokine receptor CCR7.In some embodiments of the invention, wherein the immune cells are migratory cDC1cells, said cells are characterized by: -a downregulation of the expression of the gene FOSB;and -an upregulation of the expression of the genes NUDT17, BCL2A1, ETV3,IFITM3, such as compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1, IRF8, and BATF3. P6783PC02 In other embodiments of the invention, wherein the combination of TFs comprises orconsists of PU.1, IRF8, BATF3, and IRF7, and wherein the cells are migratory cDC1,said cells are characterized by: -a downregulation of the expression of the genes FOSB, ITGAE, NR4A2;and -an upregulation of the expression of the genes NUDT17, SAMSN1, STAT4,RGS1, BCL2A1, ETV3, compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1, IRF8, and BATF3. In other embodiments of the invention, wherein the combination of TFs comprises orconsists of PU.1, IRF8, BATF3, and BCL6, and wherein the cells are migratory cDC1,said cells are characterized by: -a downregulation of the expression of the genes FOSB, TYK2, SELPLG, RGS1,LY86, STAT4; and -an upregulation of the expression of the genes NUDT17, BCL2A1, ETV3,IFITM3,compared to cDC1 cells induced or reprogrammed using the combination of TFs PU.1,IRF8, and BATF3. In some embodiments of the one or more constructs or vectors, the composition, the host cell, the method, the use, or the immune cell of the present disclosure, the immune cell is a migratory regulatory dendritic cell (mRegDC).In certain embodiments of the one or more constructs or vectors, the composition, thehost cell, the method, the use, or the immune cell of the present disclosure, the immune cell is a type 2 conventional dendritic cell (cDC2). In some embodiments of the one or more constructs or vectors, the composition, the host cell, the method, the use, or the immune cell of the present disclosure, the immune cell is a plasmacytoid dendritic cell (pDC). P6783PC02 In other embodiments of the one or more constructs or vectors, the composition, the host cell, the method, the use, or the immune cell described herein, the immune cell is a natural killer cell (NK cell).Compositions comprising immune cells.Another aspect of the present invention relates to a composition comprising an immunecell as described herein, preferably in a therapeutically effective amount, more preferably further comprising a pharmaceutically acceptable excipient, even more preferably wherein said excipient is an analgesic, an anti-inflammatory agent, a chemotherapy agent, a radiotherapy agent, an antibiotic, a diuretic, a filler, a binder, a disintegrant, or a lubricant, or mixtures thereof. Medical uses and methods of treatmentThe combinations of transcription factors described herein allow induction orreprogramming of cells into immune cell fates, such but not limited to specific cDC1subsets or states which find applications in human or veterinary medicine.Further, different combinations described herein may induce a similar cell fate (forexample, but not limited to, migratory cDC1 cells) but resulting in a further degree offine tuning of the gene expression profile of the cells within that fate. This is forexample but not limited to the case for the combinations (PU.1, IRF8, BATF3, andBCL6) and (PU.1, IRF8, BATF3, and IRF7), both inducing or reprogramming intomigratory cDC1, although the former combination results in cells displayingdownregulation of STAT4 and the latter combination upregulation of STAT4. Thesedifferences may highlight different functional properties which reinforce their interest inmedical applications, and could be used for a broad range of diseases whereinmodulation, such as activation of these cells are beneficial, for example including cancer, but also autoimmunity, or infectious diseases.A further aspect of the present invention relates to the one or more constructs orvectors, the composition, the host cell, or the immune cell as described herein, for use in veterinary or human medicine. Another aspect of the present invention relates to the one or more constructs or vectors, the composition, the host cell, or the immune cell as described herein, for use P6783PC02 in the treatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases. In some embodiments, the one or more constructs or vectors, the composition, thehost cell, or the immune cell as described herein are for use in the treatment of acancer selected from the group consisting of: colorectal cancer, head and neck cancer, melanoma, breast cancer, basal cell carcinoma, cervical dysplasia, soft tissue sarcoma, a germ cell tumor, a retinoblastoma, an age-related macular degeneration, glioblastoma, lymphoma, Hodgkin's lymphoma, blood cancer, prostate cancer, ovarian cancer, cervix cancer, oesophageal cancer, uterus cancer, vaginal cancer, gastric cancer, naso-pharynx cancer, trachea cancer, larynx cancer, bronchi cancer, bronchioles cancer, lung cancer, bladder and urothelial cancer, hollow organs cancer, esophagus cancer, stomach cancer, bile duct cancer, intestine cancer, colon cancer, rectum cancer, bladder cancer, ureter cancer, kidney cancer, liver cancer, gall bladder cancer, spleen cancer, brain cancer, lymphatic system cancer, bone cancer, pancreatic cancer, leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, acute myeloid leukemia, skin cancer, and myeloma. In other embodiments, the one or more constructs or vectors, the composition, thehost cell, or the immune cell as described herein are for use in the treatment of acancer selected from the group consisting of: melanoma, breast cancer, head and neck cancer, such as head and neck squamous cell carcinoma (HNSCC), such as head and neck squamous cell carcinoma (HNSCC) with combined positive score of PD-L1 less than 1, sarcoma, colorectal cancer, such as metastatic microsatellite stable colorectal cancer.In further embodiments, the one or more constructs or vectors, the composition, thehost cell, or the immune cell as described herein are for use in the treatment of acancer as a monotherapy or in combination with other anti-cancer therapeutic(s), such as immunotherapy, such as immune checkpoint blockade inhibitor(s), preferably anti- PD1, anti-PD-L1, or anti-CTLA4 therapeutic(s). In some embodiments, the one or more constructs or vectors, the composition, the hostcell, or the immune cell according described herein are for use in the treatment of acancer and the one or more constructs or vectors, the composition, or the host cell P6783PC02described herein and the other anti-cancer therapeutic(s) are administeredsimultaneously, sequentially or separately. In further embodiments, the one or more constructs or vectors, the composition, thehost cell, or the immune cell according described herein are for use in the treatment ofa cancer and the cancer is resistant to immune checkpoint blockade inhibition therapy.In preferred embodiments, the one or more constructs or vectors, the composition, orthe host cell are administered intratumorally or systemically, such as intravenously, intraperitoneally, or subcutaneously.In another aspect, the present invention provides a method of treating cancer, such assolid tumor cancers and / or hematological cancers, autoimmune diseases, or infectiousdiseases, said method comprising administering to an individual in need thereof thecomposition as described herein, the one or more constructs or vectors as describedherein, the host cell as described herein, and / or the immune cell as described herein.Said method may comprise further steps according to the medical uses as described herein.A further aspect of the present invention relates to the use of the composition asdescribed herein, the one or more constructs or vectors as described herein, the hostcell as described herein, and / or the immune cell, for the manufacture of a medicament for the treatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases. Yet another aspect of the present invention relates to the one or more constructs or vectors, the composition, the host cell, or the immune cell according to the presentinvention for use in diagnosis or drug screening.REPROcode methodBarcoded libraries of human transcription factors have been used to elucidate transcription factors and gene regulatory networks able to induce differentiation of embryonic and pluripotent stem cells towards specific cell types. However, theseplatforms do not allow the screening of combinations of transcription factors, which P6783PC02 limits their applicability for developing and optimizing direct cell fate reprogramming protocols. Current methods behind the identification of TFs combinations instructing direct lineage conversion involve labour-intensive multi-step protocols and result in sub-optimal sensitivity, complex mixtures of transduced cell profiles to analyse and result in lowsuccess rate. In particular, despite the advances, e.g in the field of single-celltranscriptomics, sensitive analysis of the transcriptional profile of the complex mixture of cells obtained after transduction still remains a challenge. The inventors provide herein solutions to this challenge, such as the method for identifying the expression of at least one, such as at least two transcription factor(s) (TFs) associated with cell reprogramming in a population of host cells described herein, and also referred to as REPROcode.Thus, in a fifteenth aspect, the present invention provides a method of identifying theexpression of at least one, such as at least two transcription factors (TFs) associated with cell reprogramming in a population of host cells, the method comprising: a) generating a library of TFs polynucleotides sequences, wherein each sequenceis tagged with a unique nucleic acid barcode, in one or more vector(s) comprising a backbone comprising a sequence encoding a polyA signal, a post- transcriptional response element (PRE) and a 3’ long terminal repeat sequence (LTR) region, wherein each nucleic acid barcode is located upstream of the sequence encoding the polyA signal and in the region between the PRE and LTR on the vector(s) backbone; b) transducing a population of host cells with said one or more vector(s);c) identifying the barcodes present in said transduced cells by single-celltranscriptomics, thereby identifying the TF(s) acquired by said transduced cells; d) analyzing the transcriptional profile of said transduced cells, therebycharacterizing the reprogramming of said transduced cells; e) correlating the transcriptional profile of each cell analysed in step d) with that ofspecific natural immune cell types, and with the corresponding TFs acquired by said transduced cells; thereby identifying the expression of the at least one, such as at least two TFs associated with cell reprogramming in the population of host cells. P6783PC02The steps of the method of the fifteenth aspect of the invention are exemplified inExample 4. In particular, the library of nucleic acid-barcoded TF(s) sequence(s) may be generated as described in the section Identification of transcription factors enriched in immune cells of Example 4. The unique nucleic acid barcode enables to associate the detection of said unique barcode with the acquisition, such as the internalization of the specific TF sequence tagged by said barcode in the host cell.In some embodiments of the method of the fifteenth aspect of the invention, the post-transcriptional response element is selecting from the group consisting of : awoodchuck hepatitis virus post- transcriptional response element (WPRE), aWPREmut6 sequence, a Mason Pfizer monkey transport element (CTE) and the mouse RNA transport element (RTE).In further embodiments of the method of the fifteenth aspect of the invention, thevector(s) comprise(s) a backbone comprising in sequential order a transcription factorsequence, a woodchuck hepatitis virus post- transcriptional response element (wpre), anucleic acid barcode sequence, a 3’ long terminal.repeat sequence (LTR) and a polyadenylation signal sequence (polyA).In other embodiments of the method of the fifteenth aspect of the invention, the nucleicacid barcode comprises an 8bp variable motif flanked by one 6bp motif upstream of the variable motif and one 6bp motif downstream of the variable motif.In some embodiments of the method of the fifteenth aspect of the invention, the 6bpmotif upstream consists of SEQ ID NO: 46 (TGTACA).In other embodiments of the method of the fifteenth aspect of the invention, the 6bpmotif downstream consists of SEQ ID NO: 47 (AGCGCT). The inventors have optimized the location of the barcode and identified a specific location which did not disrupt any functional elements and surprisingly allowed the P6783PC02 detection of a large number of reads. The inventors thus designed and placed their barcodes in said region between WPRE and LTR (plasmid vector design v2).Thus, in preferred embodiments of the method of the fifteenth aspect of the invention,the nucleic acid barcode is located at least 230 bp upstream of the polyA, such as at least 235 bp upstream, for instance at least 240 bp upstream, such as at least 245 bp upstream, for instance at least 250 bp upstream, such as at least 255 bp upstream, for instance 260 bp upstream, such as at least 265 bp upstream, for instance 270 bp upstream, such as at least 275 bp upstream, for instance 280 bp upstream, such as at least 285 bp upstream, for instance 290 bp upstream, such as at least 295 bp upstream, for instance 300 bp upstream, such as at least 305 bp upstream, for instance 310 bp upstream, such as at least 315 bp upstream, for instance 320 bp upstream, such as at least 325 bp upstream, for instance 330 bp upstream, such as at least 335 bp upstream, for instance 340 bp upstream, such as at least 345 bp upstream, for instance 350 bp upstream, such as at least 355 bp upstream, for instance 360 bp upstream, such as at least 365 bp upstream, for instance 370 bp upstream, such as at least 375 bp upstream, for instance 380 bp upstream, such as at least 385 bp upstream, for instance 390 bp upstream, such as at least 395 bp upstream, for instance 400 bp upstream, such as at least 405 bp upstream, for instance 410 bp upstream, such as at least 415 bp upstream, for instance 420 bp upstream, such as at least 425 bp upstream, for instance 430 bp upstream, such as at least 435 bp upstream, for instance 440 bp upstream, such as at least 445 bp upstream, for instance 450 bp upstream, such as at least 455 bp upstream, for instance 460 bp upstream, such as at least 465 bp upstream, for instance 470 bp upstream of the polyA. In even more preferred embodiments, the nucleic acid barcode is located 350bp upstream of the polyA. In yet even more preferred embodiments, the nucleic acid barcode is located 300bp upstream of the polyA.In some embodiments of the method of the fifteenth aspect of the present invention,the cells of the population of host cells step b) are selected from the group consisting of: stem cells, differentiated cells and mixtures thereof. P6783PC02In preferred embodiments of the method of the fifteenth aspect of the present invention,the cells of the population of host cells of step b) are selected from the group consisting of: pluripotent stem cells, multipotent stem cells, differentiated cells, tumor cell, cancer cell and mixtures thereof.In preferred embodiments of the method of the fifteenth aspect of the present invention,the reprogramming of the transduced cells of step d) is to cells selected from the group consisting of : stem cells, differentiated cells and mixtures thereof.In some embodiments of the method of the fifteenth aspect of the present invention,the cell reprogramming is to cells selected from the group consisting of : pluripotent stem cells, multipotent stem cells, differentiated cells, tumor cell, cancer cell and mixtures thereof.In preferred embodiments of the method of the fifteenth aspect of the present invention,the cell reprogramming is to dendritic cells (DCs).In some embodiments of the method of the fifteenth aspect of the present invention,the DCs are selected from the group consisting of: Type 1 conventional dendritic cells (cDC1), Type 2 conventional dendritic cells (cDC2) and plasmacytoid DCs (pDCs), preferably cDC1.In other embodiments of the method of the fifteenth aspect of the present invention,step b) is performed at a multiplicity of infection (MOI) of at least 200, for instance an MOI of 250, such as an MOI of at least 300, for instance an MOI of at least 350. The inventors have identified that using a lower multiplicity of infection (5-15 viral genomic copies per cell) allowed better multiplexity of barcodes than highermultiplicities of infection (e.g.40 viral genomic copies per cell).Thus, in preferred embodiments of the method of the fifteenth aspect of the presentinvention, the transduction of step b) is performed at a multiplicity of infection of at the most 40 viral genomic copies per cell, such as at the most 20 viral genomic copies percell, such as at the most 15 viral genomic copies per cell, preferably in the range of 5-15 viral genomic copies per cell. P6783PC02 Methods for determining the MOI needed to result in a target number of viral genomic copies per cell are known in the art, and typically include infecting / transducing cells with different dilutions of the viral vectors of interest corresponding to different MOIs (e.g.100, 200 viral particles / cell), incubating the cells and quantifying genomic copies(cp) (e.g by qPCR) and determining the MOI corresponding to obtain the desirednumber of viral genomic copies per cell.In preferred embodiments of the method of the fifteenth aspect of the present invention,step b) further comprises a step of sorting said transduced cells to enrich the population of host cells in cells displaying successful cell reprogramming.In further embodiments of the method of the fifteenth aspect of the present inventionthe cell sorting is performed at least 1 day after transduction, such as at least 2 days after transduction, for instance at least 3 days after transduction, such as at least 4 days after transduction, for instance at least 5 days after transduction, such as at least 6 days after transduction, for instance at least 7 days after transduction, such as at least 8 days after transduction, for instance at least 9 days after transduction, such as at least 10 days after transduction, for instance at least 15 days after transduction. For some applications, such as for comparison purposes or for baseline measurements, it may be beneficial to sort cells at day 2 after transduction, for instance sorting live cells, and at day 9 after transduction, for example sorting reprogrammed cells, such as reprogrammed cDC1 cells and non-reprogrammed cells, such as non- reprogrammed cDC1 cells. Cells at day 9 may thus be compared to live cells at day 2, for example in terms of gene expression profile.In some embodiments of the method of the fifteenth aspect of the present invention,the step of sorting the transduced cells is performed by FACS.In other embodiments of the method of the fifteenth aspect of the present invention, thestep of sorting the transduced cells is performed on cell surface markers expressed by the cells displaying successful cell reprogramming.In preferred embodiments of the method of the fifteenth aspect of the present invention,the cells displaying successful cell reprogramming are dendritic cells and the surface P6783PC02 markers are selected from the group consisting of: Clec9a, CD45, HLA-DR, and CD226. The inventors have demonstrated that allowing mismatches in the barcode sequence detection to identify TFs combination improved the detection of the barcodes / TFs.Thus, in other preferred embodiments of the method of the fifteenth aspect of thepresent invention, step c) of identification is performed by allowing one or more mismatch(es) between the particular TF(s) barcode sequence(s) and the sequence(s) detected by the single-cell transcriptomics method, such as 1 mismatch, such as 2 mismatches.In some preferred embodiments of the method of the fifteenth aspect of the presentinvention, the single-cell transcriptomics method of step c) is scRNA-seq such as low input scRNA-seq or high input scRNA-seq. Low input scRNA-seq may be performedusing for example, but not limited to, up to 20.000 cells as starting material, such as inthe range of 5.000 to 15.000 cells. High input scRNA-seq may be performed using for example, but not limited to, up to 100.000 cells as starting material, such as in the range of 30.000 to 50.000 cells.In preferred embodiments of the method of the fifteenth aspect of the present inventionthe single-cell transcriptomics method of step c) is 3’ scRNA-seq .In some embodiments of the method of the fifteenth aspect of the present inventionstep d) further comprises a step of analyzing the combinatorial enrichment of TFs.In other embodiments of the method of the fifteenth aspect of the present invention, thestep of analyzing the combinatorial enrichment of TFs further comprises a step of analyzing the global transcriptional program of the cells displaying successful cell reprogramming. The present disclosure also enables and comprises the identification of the optimal TF stoichiometry of the transduced TFs associated with cell reprogramming, such as successful cDC1 reprogramming.Thus in preferred embodiments, step e) of the method of the fifteenth aspect furthercomprises a step of identifying the optimal stoichiometry of the TFs associated with P6783PC02 reprogramming, said step comprising comparing the levels of the transduced TFs in successfully reprogrammed cells compared to non-successfully reprogrammed cells, such as cDC1-affiliated and non-affiliated cells, and determining the relative levels(stoichiometry) of the TFs in the successfully reprogrammed cells compared to non-successfully reprogrammed cells, wherein the stoichiometry of the TFs in successfullyreprogrammed cells is associated with improved cell reprogramming, such as improved cDC1 reprogramming, thereby identifying the optimal TFs stoichiometry of TFs associated with cell reprogramming.In embodiments of the method of the fifteenth aspect of the present invention, eachvector comprises a single TF polynucleotide sequence tagged with a unique nucleic acid barcode.In some embodiments of the method of the fifteenth aspect of the present invention,the host cells are transduced with at least 1, for example at least 2, such as at least 3, for example at least 4, such as at least 5, for example at least 6, such as at least 7, for example at least 8, such as at least 9, such as at least 22, such as at least 42 distinct vectors, preferably wherein each vector comprises a single TF polynucleotide sequence tagged with a unique nucleic acid barcode.In preferred embodiments of the method of the fifteenth aspect of the present invention,in the range of 1 to 42 barcodes or TFs are identified per cell in step c), such as in the range of 1 to 22 barcodes or TFs, such as in the range of 1 to 9 barcodes or TFs, such as in the range of 1 to 8 barcodes or TFs, such as in the range of 1 to 7 barcodes or TFs, such as in the range of 1 to 6 barcodes or TFs, such as in the range of 1 to 5 barcodes or TFs, preferably in the range of 2 to 5 barcodes or TFs, such as 3 barcodes or TFs, such as 4 barcodes or TFs.REPROcode constructsIn a sixteenth aspect, the present invention provides one or more vectors comprising aconstruct, wherein the construct comprises: -a transcription factor (TF) sequence;- a post- transcriptional response element sequence;- a nucleic acid barcode sequence;- a 3’ long terminal repeat sequence sequence (LTR); P6783PC02 -a polyadenylation signal sequence (polyA),wherein the nucleic acid barcode is located between the PRE and LTR sequences, upstream of the polyA.In some embodiments of the one or more vectors of the sixteenth aspect of the presentinvention, the nucleic acid barcode comprises an 8bp variable motif flanked by one 6bp motif upstream of the variable motif and one 6bp motif downstream of the variable motif.In preferred embodiments of the one or more vectors of the sixteenth aspect of thepresent invention, the 6bp motif upstream consists of SEQ ID No: 46.In some embodiments of the one or more vectors of the sixteenth aspect of the presentinvention, the 6bp motif downstream consists of SEQ ID No: 47.In preferred embodiments of the one or more vectors of the sixteenth aspect of thepresent invention, the nucleic acid barcode is located at least 230 bp upstream of the polyA, such as at least 235 bp upstream, for instance at least 240 bp upstream, such as at least 245 bp upstream, for instance at least 250 bp upstream, such as at least 255 bp upstream, for instance 260 bp upstream, such as at least 265 bp upstream, for instance 270 bp upstream, such as at least 275 bp upstream, for instance 280 bp upstream, such as at least 285 bp upstream, for instance 290 bp upstream, such as at least 295 bp upstream, for instance 300 bp upstream, such as at least 305 bp upstream, for instance 310 bp upstream, such as at least 315 bp upstream, for instance 320 bp upstream, such as at least 325 bp upstream, for instance 330 bp upstream, such as at least 335 bp upstream, for instance 340 bp upstream, such as at least 345 bp upstream, for instance 350 bp upstream, such as at least 355 bp upstream, for instance 360 bp upstream, such as at least 365 bp upstream, for instance 370 bp upstream, such as at least 375 bp upstream, for instance 380 bp upstream, such as at least 385 bp upstream, for instance 390 bp upstream, such as at least 395 bp upstream, for instance 400 bp upstream, such as at least 405 bp upstream, for instance 410 bp upstream, such as at least 415 bp upstream, for instance 420 bp upstream, such as at least 425 bp upstream, for instance 430 bp upstream, such as at least 435 bp upstream, for instance 440 bp upstream, such as at least 445 bp upstream, for instance 450 bp upstream, such as at least 455 bp P6783PC02 upstream, for instance 460 bp upstream, such as at least 465 bp upstream, for instance 470 bp upstream of the polyA.In some preferred embodiments of the one or more vectors of the sixteenth aspect ofthe present invention, the nucleic acid barcode is located 350bp upstream of the polyA. In other embodiments, the nucleic acid barcode is located 300bp upstream of the polyA.In some embodiments of the one or more vectors of the sixteenth aspect of the presentinvention, said one or more vectors encode together at least 1, for example at least 2, such as at least 3, for example at least 4, such as at least 5, for example at least 6, such as at least 7, for example at least 8, such as at least 9, such as at least 22, such as at least 42 distinct TFs.In some embodiments of the one or more vectors of the sixteenth aspect of the presentinvention, the vector is a viral vector; in particular a lentiviral, retroviral, adenoviral, herpes viral, pox viral, paramyxoviral, rabdoviral, alphaviral, plaviral or adeno- associated viral vector.In other embodiments of the one or more vectors of the sixteenth aspect of the presentinvention, the vector is a self-inactivating lentiviral vector(s).In other embodiments of the method of the fifteenth aspect of the invention, or the oneor more vectors of the sixteenth aspect of the invention, the post- transcriptionalresponse element is selecting from the group consisting of : a woodchuck hepatitisvirus post- transcriptional response element (WPRE), a WPREmut6 sequence, aMason Pfizer monkey transport element (CTE) and the mouse RNA transport element (RTE).In some embodiments of the method of the fifteenth aspect of the invention, the vectorsfurther comprise a promoter region, such as a viral promoter region, capable of controlling the transcription of the TF(s). P6783PC02 The inventors have shown that some promoters, such as the SFFV promoter, were associated with higher reprogramming efficiency, and found that such promoters werealso optimal for the method of the fifteenth aspect of the invention.Thus, in preferred embodiments of the method of the fifteenth aspect of the invention,the promoter region comprises or consists of the SFFV promoter or promoter region exhibiting essentially the same effect.In yet other embodiments of the method of the fifteenth aspect of the invention whereinthe SFFV promoter comprises or consists of a polynucleotide sequence at least 70%identical to SEQ ID NO: 39, such as at least 75%, such as at least 80%, such as atleast 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99%, such as 100%identical to SEQ ID NO: 39.In preferred embodiments of the method of the fifteenth aspect of the invention, theTFs encoded upon expression comprise at least 2, such as 3 TFs selected from: PU.1(SEQ ID NO: 40), IRF8 (SEQ ID NO: 41) and BATF3 (SEQ ID NO: 42).In yet other embodiments of the method of the fifteenth aspect of the invention, the cellreprogramming is to cDC1 cells. Items 1. A composition comprising a combination of transcription factors, wherein saidcombination comprises or consists of: a. PU.1, and one or more transcription factors selected from the groupconsisting of: IRF8, BATF3, KLF4, REL, ID2, MXD1, NR4A1, RBPJ, HHEX, ETS1, IRF7, BCL6, TBX21, ARID3A, IKZF2, RUNX3, NFKBIA,and NFKBIB;and / or P6783PC02 b. IRF8, and one or more transcription factors selected from the groupconsisting of ETS1, RBPJ, ZBTB46, NR4A1, NFIL3, and RUNX3.2. The composition according to item 1 wherein said combination comprises orconsists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;e. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; h. PU.1, KLF4, RBPJ, and TBX21;i. IRF8, and at least one, such as at least 2, such as at least 3, such as atleast 4, of RUNX3, NR4A1, NFIL3, or ETS1; j. IRF8, ETS1, RBPJ and at least one of ZBTB46 or RUNX3and / or k. PU.1 and at least one, such as at least 2, such as at least 3, such as atleast 4, of KLF4, REL, IKZF2, RUNX3, RBPJ, or HHEX.3. The composition according to any one of the preceding items, wherein saidcombination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1 and HHEXe. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;f. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;g. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;h. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; i. PU.1, KLF4, RBPJ, and TBX21; P6783PC02 j. IRF8, and at least one of: RUNX3, NR4A1, NFIL3, or ETS1;k. IRF8, ETS1, RBPJ, and at least one of ZBTB46 or RUNX3l. PU.1, KLF4, and IKZF2;and / or m. PU.1, RBPJ, and RUNX3.4. The composition according to any one of the preceding items, wherein saidcombination comprises or consists of: i. PU.1, IRF8, BATF3, and ID2;ii. PU.1, IRF8, BATF3, and MXD1;iii. PU.1, IRF8, BATF3, and NR4A1;iv. PU.1, IRF8, BATF3, and RBPJ;v. PU.1, IRF8, BATF3, and HHEX;vi. PU.1, IRF8, BATF3, and ETS1;vii. PU.1, BATF3, NR4A1, and HHEX;viii. PU.1, BATF3, NR4A1, and RPBJ;ix. PU.1, IRF8, BATF3, ARID3A, and ETS1;x. PU.1, IRF8, BATF3, NR4A1, and ETS1;xi. PU.1, IRF8, BATF3, NR4A1, and HHEX;xii. PU.1 and HHEX;xiii. PU.1, IRF8, BATF3, NR4A1, and RPBJ;xiv. PU.1, IRF8, BATF3, and IRF7;xv. PU.1, IRF8, BATF3, and BCL6;xvi. PU.1, KLF4, and REL;xvii. PU.1, KLF4, and IKZF2;xviii. PU.1, KLF4, and RUNX3;xix. PU.1, KLF4, REL, and IRF7;xx. PU.1, KLF4, REL, and BCL6;xxi. PU.1, IRF8, BATF3, and NFKBIA;xxii. PU.1, IRF8, BATF3, and NFKBIB;xxiii. PU.1, IRF8, KLF4, and TBX21;xxiv. PU.1, IRF8, KLF4, and RBPJ;xxv. PU.1, IRF8, RBPJ, and TBX21;xxvi. PU.1, KLF4, RBPJ, and TBX21;xxvii. PU.1, ETS1, IRF8, and ARID3A; P6783PC02 xxviii. IRF8, RBPJ, ETS1, and ZBTB46;xxix. IRF8, RBPJ, ETS1, and RUNX3;xxx. IRF8, NR4A1, ETS1, and RUNX3;xxxi. IRF8, RBPJ, ETS1, and NFIL3;xxxii. IRF8, NR4A1, ETS1, and ZBTB46;xxxiii. PU.1, IRF8, and ARID3A;xxxiv. PU.1, KLF4, and IKZF2;and / or xxxv. PU.1, RBPJ, and RUNX3.5. The composition according to any one of the preceding items, wherein thetranscription factors individually are at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the polypeptide sequences selected from the group consisting of: a. PU.1 of SEQ ID NO: 1;b. IRF8 of SEQ ID NO: 2;c. BATF3 of SEQ ID NO: 3;d. KLF4 of SEQ ID NO: 4;e. REL of SEQ ID NO: 5,f. ID2 of SEQ ID NO: 6;g. MXD1 of SEQ ID NO: 7;h. NR4A1 of SEQ ID NO: 8;i. RBPJ of SEQ ID NO: 9;j. HHEX of SEQ ID NO: 10;k. ETS1 of SEQ ID NO: 11;l. IRF7 of SEQ ID NO: 12;m. BCL6 of SEQ ID NO: 13;n. TBX21 of SEQ ID NO: 14;o. ARID3A of SEQ ID NO: 15;p. IKZF2 of SEQ ID NO: 16;q. RUNX3 of SEQ ID NO: 17;r. NFKBIA of SEQ ID NO: 18;and / or s. NFKBIB of SEQ ID NO: 19, or biologically active variants thereof. P6783PC026. The composition according to any one of the preceding items, wherein thetranscription factors individually are encoded by a polynucleotide sequence at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the sequence selectedfrom the group consisting of: a. PU.1 of SEQ ID NO: 20;b. IRF8 of SEQ ID NO: 21;c. BATF3 of SEQ ID NO: 22;d. KLF4 of SEQ ID NO: 23;e. REL of SEQ ID NO: 24,f. ID2 of SEQ ID NO: 25;g. MXD1 of SEQ ID NO: 26;h. NR4A1 of SEQ ID NO: 27;i. RBPJ of SEQ ID NO: 28;j. HHEX of SEQ ID NO: 29;k. ETS1 of SEQ ID NO: 30;l. IRF7 of SEQ ID NO: 31;m. BCL6 of SEQ ID NO: 32;n. TBX21 of SEQ ID NO: 33;o. ARID3A of SEQ ID NO: 34;p. IKZF2 of SEQ ID NO: 35;q. RUNX3 of SEQ ID NO: 36;r. NFKBIA of SEQ ID NO: 37;and / or s. NFKBIB of SEQ ID NO: 38, or biologically active variants thereof.7. One or more constructs or vectors encoding a combination of transcriptionfactors wherein said combination comprises or consists of: a. PU.1, and one or more transcription factors selected from the groupconsisting of: IRF8, BATF3, KLF4, REL, ID2, MXD1, NR4A1, RBPJ,HHEX, ETS1, IRF7, BCL6, TBX21, ARID3A, IKZF2, RUNX3, NFKBIA,and NFKBIB;and / or b. IRF8, and one or more transcription factors selected from the groupconsisting of ETS1, RBPJ, ZBTB46, NR4A1, NFIL3, and RUNX3. P6783PC028. The one or more constructs or vectors according to any one of the precedingitems, wherein said combination comprises or consists of:a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;e. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; h. PU.1, KLF4, RBPJ, and TBX21;i. IRF8, and at least one, such as at least 2, such as at least 3, such as atleast 4, of RUNX3, NR4A1, NFIL3, or ETS1;j. IRF8, ETS1, RBPJ and at least one of ZBTB46 or RUNX3and / or k. PU.1 and at least one, such as at least 2, such as at least 3, such as atleast 4, of KLF4, REL, IKZF2, RUNX3, RBPJ, or HHEX.9. The one or more constructs or vectors according to any one of the precedingitems, wherein said combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1 and HHEXe. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;f. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;g. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;h. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; i. PU.1, KLF4, RBPJ, and TBX21;j. IRF8, and at least one of: RUNX3, NR4A1, NFIL3, or ETS1;k. IRF8, ETS1, RBPJ, and at least one of ZBTB46 or RUNX3 P6783PC02 l. PU.1, KLF4, and IKZF2;and / or m. PU.1, RBPJ, and RUNX3.10. The one or more constructs or vectors according to any one of the precedingitems, wherein said combination comprises or consists of:i. PU.1, IRF8, BATF3, and ID2;ii. PU.1, IRF8, BATF3, and MXD1;iii. PU.1, IRF8, BATF3, and NR4A1;iv. PU.1, IRF8, BATF3, and RBPJ;v. PU.1, IRF8, BATF3, and HHEX;vi. PU.1, IRF8, BATF3, and ETS1;vii. PU.1, BATF3, NR4A1, and HHEX;viii. PU.1, BATF3, NR4A1, and RPBJ;ix. PU.1, IRF8, BATF3, ARID3A, and ETS1;x. PU.1, IRF8, BATF3, NR4A1, and ETS1;xi. PU.1, IRF8, BATF3, NR4A1, and HHEX;xii. PU.1 and HHEX;xiii. PU.1, IRF8, BATF3, NR4A1, and RPBJ;xiv. PU.1, IRF8, BATF3, and IRF7;xv. PU.1, IRF8, BATF3, and BCL6;xvi. PU.1, KLF4, and REL;xvii. PU.1, KLF4, and IKZF2;xviii. PU.1, KLF4, and RUNX3;xix. PU.1, KLF4, REL, and IRF7;xx. PU.1, KLF4, REL, and BCL6;xxi. PU.1, IRF8, BATF3, and NFKBIA;xxii. PU.1, IRF8, BATF3, and NFKBIB;xxiii. PU.1, IRF8, KLF4, and TBX21;xxiv. PU.1, IRF8, KLF4, and RBPJ;xxv. PU.1, IRF8, RBPJ, and TBX21;xxvi. PU.1, KLF4, RBPJ, and TBX21;xxvii. PU.1, ETS1, IRF8, and ARID3A;xxviii. IRF8, RBPJ, ETS1, and ZBTB46;xxix. IRF8, RBPJ, ETS1, and RUNX3; P6783PC02 xxx. IRF8, NR4A1, ETS1, and RUNX3;xxxi. IRF8, RBPJ, ETS1, and NFIL3;xxxii. IRF8, NR4A1, ETS1, and ZBTB46;xxxiii. PU.1, IRF8, and ARID3A;xxxiv. PU.1, KLF4, and IKZF2;and / or xxxv. PU.1, RBPJ, and RUNX3.11. The one or more constructs or vectors according to any one of the precedingitems, wherein the transcription factors individually are at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the polypeptide sequences selected from the group consisting of: a. PU.1 of SEQ ID NO: 1;b. IRF8 of SEQ ID NO: 2;c. BATF3 of SEQ ID NO: 3;d. KLF4 of SEQ ID NO: 4;e. REL of SEQ ID NO: 5,f. ID2 of SEQ ID NO: 6;g. MXD1 of SEQ ID NO: 7;h. NR4A1 of SEQ ID NO: 8;i. RBPJ of SEQ ID NO: 9;j. HHEX of SEQ ID NO: 10;k. ETS1 of SEQ ID NO: 11;l. IRF7 of SEQ ID NO: 12;m. BCL6 of SEQ ID NO: 13;n. TBX21 of SEQ ID NO: 14;o. ARID3A of SEQ ID NO: 15;p. IKZF2 of SEQ ID NO: 16;q. RUNX3 of SEQ ID NO: 17;r. NFKBIA of SEQ ID NO: 18;and / or s. NFKBIB of SEQ ID NO: 19, or biologically active variants thereof. P6783PC0212. The one or more constructs or vectors according to any one of the precedingitems, wherein the transcription factors individually are encoded by a polynucleotide sequence at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the sequence selected from the group consisting of:a. PU.1 of SEQ ID NO: 20;b. IRF8 of SEQ ID NO: 21;c. BATF3 of SEQ ID NO: 22;d. KLF4 of SEQ ID NO: 23;e. REL of SEQ ID NO: 24,f. ID2 of SEQ ID NO: 25;g. MXD1 of SEQ ID NO: 26;h. NR4A1 of SEQ ID NO: 27;i. RBPJ of SEQ ID NO: 28;j. HHEX of SEQ ID NO: 29;k. ETS1 of SEQ ID NO: 30;l. IRF7 of SEQ ID NO: 31;m. BCL6 of SEQ ID NO: 32;n. TBX21 of SEQ ID NO: 33;o. ARID3A of SEQ ID NO: 34;p. IKZF2 of SEQ ID NO: 35;q. RUNX3 of SEQ ID NO: 36;r. NFKBIA of SEQ ID NO: 37;and / or s. NFKBIB of SEQ ID NO: 38, or biologically active variants thereof.13. The one or more constructs or vectors according to any one of the precedingitems, wherein the vector is a viral vector, such as an adenoviral, an adeno- associated viral vector, a lentiviral, retroviral, adenoviral, herpes viral, pox viral,paramyxoviral, rabdoviral, alphaviral, or flaviral vector.14. The composition, or the one or more constructs or vectors according to any oneof the preceding items, further comprising or encoding one or more nucleic acidelements selected from the group consisting of: short hairpin RNA (shRNA),small interfering RNA (siRNA), antisense oligonucleotides, ribozymes, P6783PC02 microRNA (miRNA) mimics, CRISPR-associated systems such as CRISPR interference (CRISPRi).15. The composition or the one or more constructs or vectors according to any oneof the preceding items, wherein the one or more nucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4, RBPJ, RUNX3, and HHEX.16. The composition or the one or more constructs or vectors according to any oneof the preceding items, wherein the one or more nucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL and IKZF2.17. The composition, or the one or more constructs or vectors according to any oneof the preceding items, wherein the one or more nucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ.18. A composition comprising the one or more constructs or vectors according toany one of the preceding items.19. The composition according to any one of the preceding items, furthercomprising one or more nucleic acid elements selected from the groupconsisting of: short hairpin RNA (shRNA), small interfering RNA (siRNA),antisense oligonucleotides, ribozymes, microRNA (miRNA) mimics, CRISPR- associated systems such as CRISPR interference (CRISPRi), or one or more constructs or vectors encoding thereof.20. The composition according to any one of the preceding items, wherein the oneor more nucleic acid elements are configured to downregulate the expression ofone or more target genes selected from the group consisting of: REL and IKZF2. P6783PC0221. The composition according to any one of the preceding items, wherein the oneor more nucleic acid elements are configured to downregulate the expression ofone or more target genes selected from the group consisting of: KLF4 and RBPJ.22. The composition, or the one or more constructs or vectors according to any oneof the preceding items, for use in inducing or reprogramming a cell into animmune cell.23. The composition, or the one or more constructs or vectors encoding acombination of transcription factors according to any one of the precedingitems, wherein said combination comprises or consists of:a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1, wherein theimmune cell is an immunostimulatory cDC1; b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1, wherein the immune cell is an “improved” cDC1;c. PU.1, BATF3, NR4A1, and at least one of HHEX or RBPJ, wherein theimmune cell is an “improved” cDC1; d. PU.1, RBPJ, and HHEX;e. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6, wherein theimmune cell is a migratory cDC1; f. PU.1, KLF4, REL, optionally with at least one of IRF7 or BCL6, whereinthe immune cell is a migratory regulatory dendritic cell; g. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB, wherein theimmune cell is an immature cDC1; h. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A, wherein the immune cell is a cDC2 or a myeloid cell such as a macrophage; i. PU.1, KLF4, RBPJ, and TBX21, wherein the immune cell is a cDC2;j. IRF8, ETS1, and optionally at least one, such as at least 2, of RBPJ,ZBTB46, NR4A1, NFIL3 or RUNX3, wherein the immune cell is a pDC; k. PU.1, KLF4, and IKZF2, wherein the immune cell is a lymphoid cell suchas a NK cell; and / or P6783PC02 l. PU.1, RBPJ, and RUNX3 wherein the immune cell is a lymphoid cellsuch as a NK cell.24. The composition, or the one or more constructs or vectors encoding acombination of transcription factors according to any one of the preceding items, wherein said combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1, wherein theimmune cell is an immunostimulatory cDC1; b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1, wherein the immune cell is an “improved” cDC1,and, optionally, wherein the one or more elements are configured todownregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RBPJ, wherein theimmune cell is an “improved” cDC1, and, optionally, wherein the one ormore elements are configured to downregulate the expression of one ormore target genes selected from the group consisting of: KLF4 and RBPJ; d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6, wherein theimmune cell is a migratory cDC1; e. PU.1, KLF4, REL, optionally with at least one of IRF7 or BCL6, whereinthe immune cell is a migratory regulatory dendritic cell; f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB, wherein theimmune cell is an immature cDC1; g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A, wherein the immune cell is a cDC2 or a myeloid cell such as a macrophage; h. PU.1, KLF4, RBPJ, and TBX21, wherein the immune cell is a cDC2;i. IRF8, ETS1, and optionally at least one, such as at least 2, of RBPJ,ZBTB46, NR4A1, NFIL3 or RUNX3, wherein the immune cell is a pDC; j. PU.1, KLF4, and IKZF2, wherein the immune cell is a lymphoid cell suchas a NK cell; and / or k. PU.1, RBPJ, and RUNX3 wherein the immune cell is a lymphoid cellsuch as a NK cell. P6783PC0225. The composition according to any one of the preceding items, wherein saidcomposition further comprises one or more pharmaceutically acceptableexcipients, carriers, stabilizers, diluents, or adjuvants.26. The composition, or the one or more constructs or vectors according to any oneof the preceding items, further comprising or encoding additional functional molecules, such as selectable markers, reporter genes, or resistance genes.27. The composition, or the one or more constructs or vectors according to any oneof the preceding items further comprising cytokines, such as IL-12, IL-4, IFN-α,IFN-β, IFN-γ, TNF, and / or GM-CSF, or nucleic acids encoding thereof.28. The composition according to any one of the preceding items, wherein saidcomposition is a pharmaceutical composition.29. A host cell comprising the one or more constructs or vectors or the compositionaccording to any one of the preceding items.30. Use of the composition or the one or more constructs or vectors according toany one of the preceding items to induce or reprogram cells into immune cells.31. A method for reprogramming or inducing a cell into an immune cell, comprisingthe step of:a. transducing a cell with the one or more constructs or vectors accordingto any one of the preceding items, or b. contacting a cell with the composition according to any one of thepreceding items.32. The method according to any one of the preceding items, wherein said methodis an in vitro method.33. The method according to any one of the preceding items, further comprising thestep of expressing the combination of transcription factors and / or the one or P6783PC02 more nucleic acid elements encoded by the one or more constructs or vectors,whether following the transduction of step a. or the contact of step b. with thecomposition comprising said constructs or vectors.34. The method according to any one of the preceding items, further comprising astep of culturing the cell during at least 2 days, preferably at least 5 days, morepreferably at least 8 days, even more preferably at least 9 days following thestep a. of transducing or the step b. of contacting the cell with constructs orvectors described herein.35. The method according to any one of the preceding items, further comprising astep of contacting the cells with cytokines, such as immunostimulatory cytokines, or such as IL-12, IL-4, IFN-α, IFN-β, IFN-γ, TNF, and / or GM-CSF,or a step of transducing the cells with nucleic acids encoding thereof.36. The composition, the one or more constructs or vectors, the host cell, themethod, or the use according to any one of the preceding items, wherein thecell is selected from the group consisting of: an endoderm derived cell, amesoderm derived cell, or an ectoderm derived cell.37. The one or more constructs or vectors, the composition, the host cell, themethod, or the use according to any one of the preceding items, wherein thecell is a stem cell or differentiated cell, or mixtures thereof.38. The one or more constructs or vectors, the composition, the host cell, themethod, or the use according to any one the preceding items, wherein the stemcell is selected from the group consisting of: pluripotent stem cell and multipotent stem cell such as a mesenchymal stem cell, a hematopoietic stemcell, or an intestinal stem cell.39. The one or more constructs or vectors, the composition, the host cell, themethod, or the use according to any one the preceding items, wherein thedifferentiated cell is a cancer cell. P6783PC0240. The one or more constructs or vectors, the composition, the host cell, themethod, or the use according to any one of the preceding items, wherein thecell is a mammalian cell, such as a human cell, a non-human cell or a mousecell.41. An immune cell obtained by the method according to any one of the precedingitems.42. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the precedingitems, wherein the immune cell is a dendritic cell, such as a mature dendritic cell or an immature dendritic cell, and, optionally, wherein the one or morenucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4 and RBPJ, preferably wherein the one or more nucleic acid elements areconfigured to downregulate the expression of one or more target genes selected from the group consisting of: REL and IKZF2.43. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the precedingitems, wherein the immune cell is of the myeloid lineage, such as a dendritic cell, a monocyte or a macrophage, or of the lymphoid lineage, such as a NK cell.44. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the precedingitems, wherein the immune cell is a type 1 conventional dendritic cell (cDC1) and, optionally, wherein the one or more elements are configured todownregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ.45. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding items, wherein the immune cell is an immunostimulatory cDC1 cell. P6783PC0246. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding items, wherein the immune cell is an “improved” cDC1 cell, preferably whereinsaid cell has improved phenotypic (e.g., higher expression of cDC1 surfacemarkers including but not restricted to CD45, HLA-DR and CD40), transcriptional (e.g., higher expression of distinct DC gene signatures including but not restricted to migratory cDC1, migratory regulatory cDC1, mature cDC1 and immature cDC1 gene signatures) and / or functional features, including but not restricted to migratory capacity towards chemokine (e.g., CCL19, CCL21, XCL1) gradients, antigen-presentation, effector T cell activation and / or regulatory T cell activation, compared to cDC1 cells generated, such as induced or reprogrammed, using the combination PU.1, IRF8, and BATF3 alone (PIB).47. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding items, wherein the immune cell is a migratory cDC1 cell.48. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the precedingitems, wherein the immune cell is a migratory regulatory dendritic cell (mRegDC).49. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding items, wherein the immune cell is a type 2 conventional dendritic cell (cDC2).50. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding items, wherein the immune cell is a plasmacytoid dendritic cell (pDC).51. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding items, wherein the immune cell is a natural killer cell (NK cell). P6783PC0252. A composition comprising an immune cell according to any one of thepreceding items, preferably in a therapeutically effective amount, morepreferably further comprising a pharmaceutically acceptable excipient, evenmore preferably wherein said excipient is an analgesic, an anti-inflammatory agent, a chemotherapy agent, a radiotherapy agent, an antibiotic, a diuretic, a filler, a binder, a disintegrant, or a lubricant, or mixtures thereof.53. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in veterinaryor human medicine.54. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in thetreatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases.55. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in thetreatment of a cancer selected from the group consisting of: colorectal cancer,head and neck cancer, melanoma, breast cancer, basal cell carcinoma, cervicaldysplasia, soft tissue sarcoma, a germ cell tumor, a retinoblastoma, an age- related macular degeneration, glioblastoma, lymphoma, Hodgkin's lymphoma, blood cancer, prostate cancer, ovarian cancer, cervix cancer, oesophageal cancer, uterus cancer, vaginal cancer, gastric cancer, naso-pharynx cancer,trachea cancer, larynx cancer, bronchi cancer, bronchioles cancer, lung cancer, bladder and urothelial cancer, hollow organs cancer, esophagus cancer,stomach cancer, bile duct cancer, intestine cancer, colon cancer, rectum cancer, bladder cancer, ureter cancer, kidney cancer, liver cancer, gall bladder cancer, spleen cancer, brain cancer, lymphatic system cancer, bone cancer, pancreatic cancer, leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, acute myeloid leukemia, skin cancer, and myeloma.56. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in thetreatment of a cancer selected from the group consisting of: melanoma, breastcancer, head and neck cancer, such as head and neck squamous cell P6783PC02 carcinoma (HNSCC), such as head and neck squamous cell carcinoma (HNSCC) with combined positive score of PD-L1 less than 1, sarcoma, colorectal cancer, such as metastatic microsatellite stable colorectal cancer.57. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in thetreatment of a cancer as a monotherapy or in combination with other anti-cancer therapeutic(s), such as immunotherapy, such as immune checkpoint blockade inhibitor(s), preferably anti-PD1, anti-PD-L1, or anti-CTLA4 therapeutic(s).58. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in thetreatment of a cancer wherein the one or more constructs or vectors, thecomposition, or the host cell according to any one of the preceding items and the other anti-cancer therapeutic(s) are administered simultaneously, sequentially or separately.59. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in thetreatment of a cancer wherein the cancer is resistant to immune checkpointblockade inhibition therapy.60. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, wherein the one ormore constructs or vectors, the composition, or the host cell are administered intratumorally or systemically, such as intravenously, intraperitoneally, or subcutaneously.61. A method of treating cancer, such as solid tumor cancers and / or hematologicalcancers, autoimmune diseases, or infectious diseases, said method comprisingadministering to an individual in need thereof the composition, the one or more constructs or vectors, the host cell, and / or the immune cell according to any oneof the preceding items. P6783PC0262. Use of the composition, the one or more constructs or vectors, the host cell,and / or the immune cell according to any one of the preceding items, for themanufacture of a medicament for the treatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases.63. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding items, for use in diagnosis ordrug screening.64. A method of identifying the expression of at least one, such as at least twotranscription factors (TF) associated with cell reprogramming in a population of host cells, the method comprising: a) generating a library of TFs polynucleotides sequences, wherein eachsequence is tagged with a unique nucleic acid barcode, in one or more vector(s) comprising a backbone comprising a sequence encoding a polyA signal, a post-transcriptional response element (PRE) and a 3’ long terminal repeat sequence (LTR) region, wherein each nucleic acidbarcode is located upstream of the sequence encoding the polyA signal and in the region between the PRE and LTR on the vector(s) backbone;b) transducing a population of host cells with said one or more vector(s);c) identifying the barcodes present in said transduced cells by single-celltranscriptomics, thereby identifying the TFs acquired by said transduced cells; d) analyzing the transcriptional profile of said transduced cells, therebycharacterizing the reprogramming state of said transduced cells; e) correlating the transcriptional profile of each cell analysed in step d) withthat of specific natural immune cell types, and with the corresponding TFs acquired by said transduced cells; thereby identifying the expression of the at least one, such as at least two TFs associated with cell reprogramming in the population of host cells.65. The method according to item 64 wherein the post- transcriptional responseelement is selected from the group consisting of: a woodchuck hepatitis virus post- transcriptional response element (WPRE), a WPREmut6 sequence, a P6783PC02 Mason Pfizer monkey transport element (CTE) and the mouse RNA transport element (RTE).66. The method according to any one of items 64 to 65, wherein the vector(s)comprise(s) a backbone comprising in sequential order a transcription factor sequence, a woodchuck hepatitis virus post- transcriptional response element(wpre), a nucleic acid barcode sequence, a 3’ long terminal repeat sequence (LTR) and a polyadenylation signal sequence (polyA).67. The method according to any one of items 64 to 66, wherein the nucleic acidbarcode comprises an 8bp variable motif flanked by one 6bp motif upstream of the variable motif and one 6bp motif downstream of the variable motif.68. The method according to item 67 wherein the 6bp motif upstream consists ofSEQ ID NO 46.69. The method according to any one of items 67 to 68 wherein the 6bp motifdownstream consists of SEQ ID NO 47.70. The method according to any one of items 64 to 69, wherein the nucleic acidbarcode is located at least 230 bp upstream of the polyA, such as at least 235 bp upstream, for instance at least 240 bp upstream, such as at least 245 bp upstream, for instance at least 250 bp upstream, such as at least 255 bp upstream, for instance 260 bp upstream, such as at least 265 bp upstream, for instance 270 bp upstream, such as at least 275 bp upstream, for instance 280 bp upstream, such as at least 285 bp upstream, for instance 290 bp upstream, such as at least 295 bp upstream, for instance 300 bp upstream, such as at least 305 bp upstream, for instance 310 bp upstream, such as at least 315 bp upstream, for instance 320 bp upstream, such as at least 325 bp upstream, forinstance 330 bp upstream, such as at least 335 bp upstream, for instance 340 bp upstream, such as at least 345 bp upstream, for instance 350 bp upstream, such as at least 355 bp upstream, for instance 360 bp upstream, such as at least 365 bp upstream, for instance 370 bp upstream, such as at least 375 bp upstream, for instance 380 bp upstream, such as at least 385 bp upstream, for instance 390 bp upstream, such as at least 395 bp upstream, for instance 400 P6783PC02 bp upstream, such as at least 405 bp upstream, for instance 410 bp upstream, such as at least 415 bp upstream, for instance 420 bp upstream, such as at least 425 bp upstream, for instance 430 bp upstream, such as at least 435 bp upstream, for instance 440 bp upstream, such as at least 445 bp upstream, for instance 450 bp upstream, such as at least 455 bp upstream, for instance 460 bp upstream, such as at least 465 bp upstream, for instance 470 bp upstream of the polyA.71. The method according to any one of items 64 to 70, wherein the nucleic acidbarcode is located 300bp upstream of the polyA.72. The method according to any one of items 64 to 71, wherein the nucleic acidbarcode is located 350bp upstream of the polyA.73. The method according to any one of items 64 to 72, wherein the cells of thepopulation of host cells of step b) are selected from the group consisting of: stem cells, differentiated cells and mixtures thereof.74. The method according to any one of items 64 to 73, wherein the cells of thepopulation of host cells of step b) are selected from the group consisting of: pluripotent stem cells, multipotent stem cells, differentiated cells, tumor cell, cancer cell and mixtures thereof.75. The method according to any one of items 64 to 74, wherein the cellreprogramming is to cells selected from the group consisting of: stem cells, differentiated cells and mixtures thereof.76. The method according to any one of items 64 to 75, wherein the cellreprogramming is to cells selected from the group consisting of: pluripotent stem cells, multipotent stem cells, differentiated cells, tumor cell, cancer cell and mixtures thereof.77. The method according to any one of items 64 to 76, wherein the cellreprogramming is to dendritic cells (DCs). P6783PC0278. The method according to item 77, wherein the DCs are selected from the groupconsisting of: Type 1 conventional dendritic cells (cDC1), Type 2 conventionaldendritic cells (cDC2) and plasmacytoid DCs (pDCs), preferably cDC1.79. The method according to any one of items 64 to 78, wherein the transduction ofstep b) is performed at a multiplicity of infection (MOI) of at least 200, for instance an MOI of 250, such as an MOI of at least 300, for instance an MOI of at least 350 viral genomic copies per cell.80. The method according to any one of items 64 to 79, wherein the transduction ofstep b) is performed at a multiplicity of infection of at the most 40, such as at themost 20, such as at the most 15 viral genomic copies per cell, preferably in the range of 5-15 viral genomic copies per cell81. The method according to any one of items 64 to 80, wherein step b) furthercomprises a step of sorting said transduced cells to enrich the population of host cells in cells displaying successful cell reprogramming.82. The method according to item 81 wherein the cell sorting is performed at least 1day after transduction, such as at least 2 days after transduction, for instance at least 3 days after transduction, such as at least 4 days after transduction, for instance at least 5 days after transduction, such as at least 6 days after transduction, for instance at least 7 days after transduction, such as at least 8 days after transduction, for instance at least 9 days after transduction, such as at least 10 days after transduction, for instance at least 15 days after transduction.83. The method according to any one of items 64 to 82, wherein the step of sortingthe transduced cells is performed by FACS.84. The method according to any one of items 64 to 83, wherein the step of sortingthe transduced cells is performed on cell surface markers expressed by the cells displaying successful cell reprogramming. P6783PC0285. The method according to any one of items 64 to 84, wherein the cells displayingsuccessful cell reprogramming are dendritic cells and the surface markers are selected from the group consisting of : Clec9a, CD45, HLA-DR, and CD226, preferably wherein the surface markers are CD45 and HLA-DR, even more preferably Clec9a, CD45, and HLA-DR, yet even more preferably Clec9a, CD45, HLA-DR, and CD226.86. The method according to any one of items 64 to 85, wherein step c) ofidentification is performed by allowing one or more mismatch(es) between the particular TF(s) barcode sequence(s) and the sequence(s) detected by the single-cell transcriptomics method, such as 1 mismatch, such as 2 mismatches.87. The method according to any one of items 64 to 86, wherein the single-celltranscriptomics method of step c) is scRNA-seq, such as low input scRNA-seq or high input scRNA-seq.88. The method according to item 87, wherein the single-cell transcriptomicsmethod of step c) is 3’ scRNA-seq.89. The method according to any one of items 64 to 88, wherein step d) furthercomprises a step of analyzing the combinatorial enrichment of TFs.90. The method according to item 89, wherein the step of analyzing thecombinatorial enrichment of TFs further comprises analyzing the global transcriptional program of the cells displaying successful cell reprogramming.91. The method according to any one of items 64 to 90, wherein step e) furthercomprises a step of identifying the optimal stoichiometry of the TFs associated with reprogramming, said step comprising: -comparing the levels of the transduced TFs in successfullyreprogrammed cells compared to non-successfully reprogrammed cells, such as cDC1-affiliated and non-affiliated cells; and - determining the relative levels (stoichiometry) of the TFs in the successfully reprogrammed cells compared to non-successfully reprogrammed cells, P6783PC02 wherein the stoichiometry of the TFs in successfully reprogrammed cells is associated with improved cell reprogramming, such as improved cDC1 reprogramming, thereby identifying the optimal TFs stoichiometry of TFs associated with cell reprogramming.92. The method according to any one of items 64 to 91, wherein each vectorcomprises a single TF polynucleotide sequence tagged with a unique nucleic acid barcode.93. The method according to any one of items 64 to 92, wherein the host cells aretransduced with at least 2, such as at least 3, for example at least 4, such as at least 5, for example at least 6, such as at least 7, for example at least 8, such as at least 9, such as at least 22, such as at least 42 distinct vectors, preferably wherein each vector comprises a single TF polynucleotide sequence tagged with a unique nucleic acid barcode.94. The method according to any one of items 64 to 93, wherein in the range of 1 to42 barcodes or TFs are identified per cell in step c), such as in the range of 1 to 22 barcodes or TFs, such as in the range of 1 to 9 barcodes or TFs, such as in the range of 1 to 8 barcodes or TFs, such as in the range of 1 to 7 barcodes orTFs, such as in the range of 1 to 6 barcodes or TFs, such as in the range of 1 to 5 barcodes or TFs, preferably in the range of 2 to 5 barcodes or TFs, such as 3 barcodes or TFs, such as 4 barcodes or TFs.95. One or more vectors each comprising a construct, wherein the constructcomprises: -a transcription factor (TF) sequence;- a post- transcriptional response element (PRE) sequence;- a nucleic acid barcode sequence;- a 3’ long terminal repeat sequence sequence (LTR);- a polyadenylation signal sequence (polyA),wherein the nucleic acid barcode is located between the PRE and LTR sequences, upstream of the polyA. P6783PC0296. The one or more vectors according to item 95, wherein the nucleic acid barcodecomprises an 8bp variable motif flanked by one 6bp motif upstream of the variable motif and one 6bp motif downstream of the variable motif.97. The one or more vectors according to item 96 wherein the 6bp motif upstreamconsists of SEQ ID NO: 46.98. The one or more vectors according to any one of items 96 to 97 wherein the6bp motif downstream consists of SEQ ID NO: 47.99. The one or more vectors according to any one of items 95 to 98, wherein thenucleic acid barcode is located at least 230 bp upstream of the polyA, such as at least 235 bp upstream, for instance at least 240 bp upstream, such as at least 245 bp upstream, for instance at least 250 bp upstream, such as at least 255 bp upstream, for instance 260 bp upstream, such as at least 265 bp upstream, for instance 270 bp upstream, such as at least 275 bp upstream, for instance 280 bp upstream, such as at least 285 bp upstream, for instance 290 bp upstream, such as at least 295 bp upstream, for instance 300 bp upstream, such as at least 305 bp upstream, for instance 310 bp upstream, such as at least 315 bp upstream, for instance 320 bp upstream, such as at least 325 bp upstream, for instance 330 bp upstream, such as at least 335 bp upstream, for instance 340 bp upstream, such as at least 345 bp upstream, for instance 350 bp upstream, such as at least 355 bp upstream, for instance 360 bp upstream, such as at least 365 bp upstream, for instance 370 bp upstream, such as at least 375 bp upstream, for instance 380 bp upstream, such as at least 385 bp upstream, for instance 390 bp upstream, such as at least 395 bp upstream, for instance 400 bp upstream, such as at least 405 bp upstream, for instance 410 bp upstream, such as at least 415 bp upstream, for instance 420 bp upstream, such as at least 425 bp upstream, for instance 430 bp upstream, such as at least 435 bp upstream, for instance 440 bp upstream, such as at least 445 bp upstream, for instance 450 bp upstream, such as at least 455 bp upstream, for instance 460 bp upstream, such as at least 465 bp upstream, for instance 470 bp upstream of the polyA. P6783PC02100. The one or more vectors according to any one of items 95 to 99, whereinthe nucleic acid barcode is located 300bp upstream of the polyA.101. The one or more vectors according to any one of items 95 to 100,wherein the nucleic acid barcode is located 350bp upstream of the polyA.102. The one or more vectors according to any one of items 95 to 101,encoding together at least 1, for example at least 2, such as at least 3, for example at least 4, such as at least 5, for example at least 6, such as at least 7, for example at least 8, such as at least 9, such as at least 22, such as at least 42 distinct TFs.103. The method or the one or more vectors according to any one of items 95to 102, wherein the vector is a viral vector; in particular a lentiviral, retroviral,adenoviral, herpes viral, pox viral, paramyxoviral, rabdoviral, alphaviral, plaviral or adeno-associated viral vector.104. The method or the one or more vectors according to any one of items 95to 103, wherein the vector is a self-inactivating lentiviral vector(s).105. The method according to any one of items 64 to 94, or the one or morevectors according to any one of items 95 to 104, wherein the post-transcriptional response element is selected from the group consisting of: a woodchuck hepatitis virus post- transcriptional response element (WPRE), aWPREmut6 sequence, a Mason Pfizer monkey transport element (CTE) and the mouse RNA transport element (RTE).106. The method or the one or more vectors according to any one of items 95to 105, wherein the vectors further comprise a promoter region, such as a viralpromoter region, capable of controlling the transcription of the TF(s).107. The method or the one or more vectors according to item 106, whereinthe promoter region comprises or consists of the SFFV promoter or promoter region exhibiting essentially the same effect. P6783PC02 108. The method according to item 107, wherein the SFFV promotercomprises or consists of a polynucleotide sequence at least 70% identical to SEQ ID NO: 39, such as at least 75%, such as at least 80%, such as at least81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99%, such as 100% identical to SEQ ID NO: 39109. The method or the one or more vectors according to any one of items 95to 108, wherein the TFs encoded upon expression comprise at least 2, such as3 TFs selected from: PU.1 (SEQ ID NO: 40), IRF8 (SEQ ID NO: 41) and BATF3(SEQ ID NO: 42)110. The method according to item 109 wherein the cell reprogramming is tocDC1 cells. Examples Example 1. General methods and materials. Cell lines and primary cell cultures Human embryonic fibroblasts (HEFs, passages 6 to 10) derived from 6-weeks old human embryos and human embryonic kidney (HEK) 293T cells were maintained in growth media (Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% (v / v) heat- inactivated fetal bovine serum, antibiotics (10 μg / ml penicillin and streptomycin), and 2 mM L-glutamine (complete DMEM). HEFs were grown on 0.1% porcine gelatine-coated dishes. Media was changed every 2-3 days and cells were maintained at 37°C and 5%(v / v) CO2. Cell dissociation from tissue culture plates was performed with TrypLEExpress for 5-8 min at 37ºC. All cells were maintained at 37°C and 5% (v / v) CO2. All tissue culture reagents were from Thermo Fisher Scientific unless stated otherwise.To induce cDC1 reprogramming, the inventors used the lentiviral vectorpRRL.PPT.sf.hPIB.i2eGFP or pRRL.PPT.sf.hPIB.i2mCherry (Rosa et al. (2022)) P6783PC02 expressing human PU.1, IRF8, and BATF3. Empty MCS pRRL.PPT.sf.MCS.i2eGFP or pRRL.PPT.sf.hPIB.i2mCherry served as a control throughout reprogramming experiments. For validation experiments, the coding sequence of TF candidates was cloned into the MCS of lentiviral vectors containing the constitutive SFFV promoter, an internal ribosomal entry site and eGFP or mCherry (pRRL.PPT.sf.MCS.i2eGFP or pRRL.PPT.sf.MCS.i2mCherry). Identification of transcription factors enriched in immune cells For the selection of TFs for immune reprogramming, the inventors utilized publiclyavailable scRNA-seq datasets, including Tabula Sapiens (Jones et al. 2022). Theinventors used pre-defined annotations such as cell_ontology_class, based on the Cell Ontology, and free_annotation based on free text, to categorize cell types as either immune / hematopoietic or non-immune. To normalize the data, the inventors divided the counts of each gene by the total counts in that cell and multiplied by 10,000 to obtain unlogged normalized counts. Subsequently, the inventors applied natural-log transformation using log1p to obtain normalized counts for each gene in each cell. Next, the inventors compiled a curated list of human TF by combining the HumanTranscription Factors (Lambert et al.2018) and Human TFome (Ng et al.2021)databases was compiled, resulting in 1,829 TFs. The inventors then used this list to filter immune-restricted TFs. The inventors devised four scoring methods for each TF, which aimed at evaluating their potential impact on reprogramming within each immune cell type: (1) Fold-change expression score method, which calculates the fold-change in TF expression between immune and non-immune cell types by comparing the averaged expression values. The fold-change expression score is calculated by subtracting the TF expression level of the non-immune cell type from the TF expression level of the immune cell type. (2) Fold-change unlogged expression score method, which is similar to the first scoring approach but uses unlogged normalized counts for calculation of expression values. The fold-change unlogged expression score is calculated by subtracting the log1p of the expression level of non-immune cell transcription factors from the log1p of the expression of transcription factors enriched in immune cell types. (3) Fraction of cells with expression score method, which determines the fraction of cells expressing each TF within the immune and non-immune cell types. The fraction of cells with expression score is obtained by subtracting the fraction of non-immune cells expressing the immune transcription factor from the fraction of immune cells expressing the immune transcription factor, and (4) Jensen-Shannon divergence score method that measures P6783PC02 the divergence of TF expression patterns between immune and non-immune cell types using a vector-based approach. The score is calculated as the Jensen-Shannon divergence between two vectors representing TF expression in immune and non- immune cell types. The TFs were ranked separately for each immune cell type based on their scores in the respective cell type. The inventors then calculated for each scoring method and each TF: (1) the best rank across all immune cell type, (2) a rank product across all immune cell types (the geometric mean of the ranks across all immune cell types), (3) a p-value and a percentage of false positive predictions (pfp) for the rank product, as estimated using the R package RankProd, and (4) the rank of the rank products across all immune cell types. For the fold-change expression score method and the fraction of cells with expression score method, the number of TFs selected as immune restricted TFs was determined as the median number across immune cell types of TFs with scores larger than zero. For the Jensen-Shannon divergence score, the number of TFs selected was based on the TFs with rank product p-values smaller than 0.01. Molecular cloning The coding regions of each candidate TF were individually cloned into the lentiviral vector containing the constitutive promotor pRRL.PPT-SFFV-MCS (SFFV) (Rosa et al. 2022). Cellular barcodes were designed consisting of a 20-bp sequence, comprising 6- bp constant flanking sequences and an 8-bp variable sequence in the middle. This design accommodates potential sequencing errors by allowing for mismatches. The barcodes were inserted in the region between woodchuck hepatitis regulatory element (WPRE) and long terminal repeat (LTR), as this location was found not to disrupt any functional elements and allows for efficient detection. Lentiviral production and titration To produce individual lentivirus for each barcoded TF, 5 million HEK293T cells were seeded per 15 cm plate 48 hours prior to transfection. For transfection, a mixture of 7.5 μg of the lentiviral packaging vector psPAX2.G, 2.5 μg of envelope vector pMD2, and 10 μg of lentiviral vector with 60 μl of PEI (1 mg / ml, linear 25 kDa, Polysciences) in Opti- MEM was prepared and incubated for 15 minutes at room temperature. Following incubation, the mixture was added dropwise to HEK293Ts cells in DMEM without FBS or Pen-Strep. The transfection media was replaced with DMEM complete after 6 hours. P6783PC02 Supernatants containing viral particles were collected 48, 60, and 72 hours after transfection. The supernatants from the three collections were combined, passed through a 0.45 µm low protein binding filter, and concentrated with the Lenti-X Concentrator (Takara) according to manufacturer’s instructions. Lentiviral titers were determined using the Lenti-X qRT-PCR titration kit (Takara) according to manufacturer’s instructions. Viral transduction and reprogramming To induce reprogramming, HEFs were counted and seeded (500,000 per 10-cm plate) on 0.1% gelatin-coated plates 6 hours prior to transduction. Concentrated virus was functionally titrated, and an appropriate volume of each lentivirus was added accordingly. The next day, after 12-16 hours, the transduction media was replaced with DMEM complete supplemented, marking the beginning of day 0 of reprogramming. Media was changed every 2-3 days for the remainder of reprogramming. For experiments aimed at assessing the impact of additional TFs on PIB-mediated cDC1 reprogramming, HEFs were seeded at a density of 250,000 cells per gelatin-coated 6-well plate and were co-transduced with lentiviral particles containing the PIB-IRES-eGFPand increasing amounts of an additional TF-IRES-mCherry. Flow cytometry analysis Analysis of surface marker expression was performed in dissociated cell suspensions. To prepare cells for flow cytometry analysis, cells were detached using TrypLE Expressand resuspended at a concentration of 106 cells per 100 μl DPBS containing 5% FBS.Cells were then incubated with appropriate concentrations of antibody at 4°C for 30 min, with the addition of mouse serum (1 / 100; GeneTex). Following the staining, cells werewashed, resuspended in DPBS containing 5% FBS, and kept at 4°C until analysis. Toexclude dead cells, 7-Aminoactinomycin D (7AAD, Thermo Fisher Scientific) or 4´,6- diamidino-2-phenylindole (DAPI) were added shortly before analysis. Flow cytometry analysis was performed with LSR Fortessa and LSR Fortessa X20 (BD Biosciences). Flow cytometry data were analyzed using FlowJo v.10.0.7 (FlowJo LLC). Gates were determined according to fluorescence minus one (FMO) controls. All flow cytometry analysis were performed in live-single gates, unless otherwise specified. Fluorescence-activated cell sorting (FACS) P6783PC02 After 2 or 9 days of reprogramming, HEFs were dissociated using TrypLE Express, centrifuged, and resuspended in PBS with 0.04% bovine serum albumin (BSA). Cells were incubated with mouse-serum (1:100, GeneTex), mouse anti-human fluorescently labelled anti-CD45 and anti-HLA-DR antibodies for 30 minutes at 4ºC. DAPI was added shortly before analysis to allow for the exclusion of dead cells. Single live double negative (DN; CD45-HLA-DR-), single positive (SP; CD45+), or double positive (DP; CD45+HLA- DR+) were then purified on a BD FACSAria III (BD Biosciences) using a 100 µm nozzle. Transduced cells at day 2 were also FACS sorted for single live. Cells were sorted directly into 1.5 mL Eppendorf tubes with PBS with 0.04% BSA. All cells were sorted ona BD FACSAriaIII (BD Bioscience).cDC1 reprogramming with additional regulatorsTo validate the impact of additional TF on cDC1 reprogramming, the inventors performedco-transductions of hPIB-eGFP with lentiviral particles encoding individual transcriptionfactors (NFKBIA) upstream IRES-mCherry. The inventors seeded 600K HEFs per 12-well cell culture plates pre-treated with 0.1% porcine gelatine, and co-transduced them with hPIB-eGFP lentiviral particles to induce reprogramming and with TF-mCherry lentiviral particles to elicit the expression of candidate gene. Transduction with TF- mCherry was performed at 3 different timepoints: 48 hours before the reprogramming initiation (day-2), simultaneously with reprogramming induction (day 0), or 72 hours after (day +3). Empty eGFP and mCherry lentiviral vectors (MCS) were used as experimentalcontrols. To evaluate reprogramming efficiency, the inventors analyzed the percentageof fully reprogrammed (CD45+HLA-DR+) and partially reprogrammed (CD45+HLA-DR- / CD45-HLA-DR+) cells within single, live, eGFP+mCherry+populations. To evaluatereprogramming fidelity, the inventors further analyzed the expression of CD40 gated inCD45+. Single-cell RNA sequencing (scRNA-seq) For low-input sequencing, single-cell suspensions containing between 5,000 and15,000 cells for each condition day 2, day 9 CD45- and HLA-DR- - double negative(DN), day 9 CD45+– single positive (SP), day 9 CD45+ and HLA-DR+ - double positive(DP) were prepared in PBS with 0.04% BSA and loaded on a 10X Chromium (10X Genomics), following the manufacturer’s protocol. Chromium Single Cell 3’ v2 Reagent Kits were used to prepare the scRNA-seq libaries according to the manufacturer’s instructions. Library quantification and quality assessment were performed using an P6783PC02 Agilent Bioanalyzer with a High Sensitivity DNA analysis kit (Agilent). Equimolar indexed libraries were pooled and subjected to paired-end 26 x 98 bp sequencing on an Illumina NovaSeq 6000. The resulting coverage was approximately 18,000 reads per cell. For high-input sequencing approximately 30,000 to 50,000 cells were sorted for each condition day 9 DN and day 9 SP, for each pool of 9 TF, 22 TF, or 42 TFs. The sorted cells were then labelled with BD AbSeq Ab-Oligos using the BD Human Single-Cell Multiplexing Kit according to the manufacturer’s instructions. Following washing, oligo- tagged cells pooled in even ratios (between 10,000 and 12,500 cells per condition), and approximately 80,000 cells were loaded onto the BD Rhapsody Cartridge. For higher multiplexed barcoded pools, approximately 55,000 sorted cells were loaded per lane onto the BD Rhapsody 8-Lane Cartridge. Subsequent steps were performed using the BD Rhapsody Cartridge Reagent Kit or the BD Rhapsody Enhanced Cartridge Reagent Kit, as specified in the manufacturer’s protocol. Following cell capture bead retrieval, cDNA synthesis was immediately initiated using the BD Rhapsody cDNA Kit as described by the manufacturer’s protocol. The BD Rhapsody WTA Amplification Kit was used according to the manufacturer’s protocol to prepare the scRNA-seq libaries. Library quantification, quality, and pooling were performed as described above. Libraries were sequenced on an Illumina NovaSeq 6000 using paired-end 100bp sequencing mode. Resulting covered was approximately 44,000 reads per cell Single-cell RNA sequencing (scRNA-seq) data processing For the 10x Genomics platform, paired-end sequencing reads of scRNA-seq were processed using publicly available software Cell Ranger v6.1.2. Firstly, the inventors used cellranger mkfastq to convert binary base call files to FASTQ files and to decode multiplexed samples simultaneously. Next, cellranger count was applied to FASTQ files and performed alignment to human (hg38) genome assemblies using STAR v2.7.6a.Then, the inventors combined output files from each run to produce one single matrixusing cellranger aggr. For the BD Rhapsody platform, paired-end sequencing reads of scRNA-seq wereprocessed using publicly available software BD Rhapsody™ Sequence AnalysisPipeline v2.0. Firstly, the inventors used bcl2fastq v2.20 to convert binary base call files to FASTQ files and to decode multiplexed samples simultaneously. Next, the inventors P6783PC02applied BD Rhapsody™ Sequence Analysis Pipeline to FASTQ files and performedalignment to human (hg38) genome assemblies using STAR.The sparse expression matrix generated by cellranger analysis pipeline was used asinputs to the Seurat library v4.3.0. Cells and genes were included based on quality control thresholds, following these criteria: (1) total number of unique molecular identifiers detected per sample greater than 3 lower median absolute deviations (MADs); (2) number of genes detected in each single cell greater than 3 lower MADs; (3) percentage of counts in mitochondrial genes less than 10% (10X Genomics) or 20% (BD Rhapsody). For the 10X Genomics, data normalization was performed using SCTransform, and 3000 variable features were identified. The inventors used the first 30 principal components for subsequent UMAP and clustering analyses. For the BD Rhapsody, data normalization was performed using "LogNormalize" with a scale factor of 10,000, and 5000 variable features were identified. The inventors used the first 30 principal components for subsequent UMAP and clustering analyses. Transcription factor barcode demultiplexing Reads containing the TF barcode sequence were extracted from the processed BAM files produced by the 10X Genomics and BD Rhapsody pipelines. Reads that contained the transcription factor barcode motif were identified by searching for 20-bp barcode (6-bp constant flanking sequences and 8-bp variable sequence in the middle). The inventors developed a custom python script that allows extracting of reads from the unmapped read fraction of BAM file, searching for constant 6bp flanking regions, and reporting the sequence between them. Those sequences were further annotatedusing a user supply list of correspondence between transcription factor and 8bpsequence. The resulting output was the tabular file containing cell barcode, UMI, transcription factor barcode sequence and transcription factor associated with each barcode. The inventors also allowed the sequence to contain mismatches. The resulting matrix were further imported into R and used to calculate the number of UMIcounts for each exogenous transcription factor. Next, the inventors matched each cellwith corresponding transcription factor based on observation of cells having non-zero UMI counts for a particular transcription factor. Reprogramming trajectory analysis To order cells along a reprogramming pseudo-time, the inventors used Monocle 3 v1.3.1. The analysis was conducted on UMAP embeddings with default settings, with P6783PC02 the exception of the parameter "use_partition=FALSE," which assumes that all cells in the dataset descend from a common transcriptional ancestor. The root of the trajectory was automatically selected from the day 2 cells. Subsequently, the cells were ordered according to pseudo-time and fitted smooth splines with 3 degrees of freedom for both endogenous and exogenous levels of TFs. This approach allowed the inventors to visualize the trajectory of reprogramming and assess the dynamics of TF expression during this process. Estimating the effects of TF The inventors employed scPred with an SVM model trained on publicly available DC single-cell expression data. This model utilized 5,000 variable genes for training classifiers with the available DC data. Subsequently, the inventors applied this trained model to classify normalized expression levels from the reprogramming dataset. Cells were classified using a probability threshold of 0.95, and those belonging to the same cluster were annotated accordingly. To assess the frequency of the PIB plus one additional TF combination in DC1 classified cells, the inventors normalized the number of cells containing PIB plus one additional TF by the total number of cells containing PIB. The inventors then subtracted this normalized value from the number of cells containing PIB plus one additional TF in the remaining non-affiliated cells. This approach allowed the inventors to evaluate the relative enrichment of the PIB plus one additional TF combination in DC1-affiliated cells compared to non-affiliated cells. scRNA-seq data analysis to evaluate the impact of additional TFs To estimate the effect of adding an individual TF to the successful reprogrammingcombination, the inventors first extracted from the dataset only cells that either containthe TF combination PIB alone (3TFs = PU.1 + IRF8 + BATF3) or PIB + 1 additional TF. Next, the inventors calculated the number of cells in each of these seven distinct TF combinations, separately within the DC1 classified cells (positive population) and within the remaining cells (negative population). For each TF combination and populationseparately, the inventors calculated a normalized fraction by dividing the number of cellsby the number of cells that contained PIB alone. Finally, the inventors subtracted thefractions for the negative population from the fractions for the positive population to generate a normalized frequency score for each additional TF. P6783PC02 Identification of candidate reprogramming TFs in multiplexed screens with > 40 TFs Typically, combinations of 3-5 TFs are used in reprogramming. In multiplexed screens with 9 TFs in total, the inventors observed sufficient cell numbers with combinations of 3-5 different TFs. However, when increasing the total number of TFs in the screens, mostcells contained more than 5 TFs. Therefore, the inventors used a computationalframework to identify candidate reprogramming TF networks from cells containing a larger number of TFs. The computational framework was performed separately startingeither with combinations of 4 TFs. Here the inventors outline the steps of the framework,exemplified by starting with combinations of 4 TFs.1) All possible combinations of 4 TFs were listed given the total set of TFs in the screen. For example, for 48 TFs there were 194,580 possible 4-TF combinations (and 1,712,304 possible 5-TF combinations).2) To each cell, 4-TF combinations were assigned. Since cells typically contained more than 4 TFs, multiple 4-TF combinations were assigned to each cell. 3) The number of cells containing each of those combinations separately within the negative population were calculated (sorted negatively for a particular marker; for example, CD45-HLA-DR-) andthe positive population (here, the inventors used a distinct cluster as a positive populationof cDC1-affilitated cells), since, for a more general screen with a large number of TFs, multiple cell types could be induced simultaneously.4) For each population (positive and negative) separately, a normalized fraction for a TF combination was calculated by dividing its number of cells with the maximum number of cells found for any TF combination in the population. 5) The fractions for the negative population were subtracted from the fractions for the positive population to generate a normalized frequency score for each TF combination. 6) The top 1000 TF combinations with the largest normalized frequency scores were taken and the frequency of each TF appearing in these TF combinations was counted 7) 10004-TF combinations that were not included in the top 1000 were randomly subsampled and counted in how many of these each TF appears.10000 such subsamplings were generated and an empirical p-value for each TF was estimated as the fraction of subsamplings having at least the same count as thecount for the top 1000.8) Candidate reprogramming TFs for the positive population wereselected as having empirical p-values less than 0.05. 9) Steps 1-5 were repeated for shortened reprogramming candidate list by comparing a cell type specific-cluster of cells against remaining cells from the positive population. To estimate the divergence of dendritic cell states obtained by adding an individual TF to the PIB combination, the inventors first extracted from the dataset cells that only P6783PC02 contained PIB + 1 additional TF. Next, the inventors calculated the number of cells in each of these distinct TF combinations separately within cDC1 states (immature, mature,and migratory) (Maier et al. (2020)) and within remaining cells. For each TF combinationand population, the inventors separately calculated a normalized fraction by dividing thenumber of cells for the maximum number of cells found for any TF combination in thepopulation. Finally, the inventors subtracted the fractions for the negative population fromthe fractions for the positive population to generate a normalized frequency score for each additional TF.To extract cDC2 and pDC TF combinations, the inventors used the same logic describedabove (steps 1-7) and included an additional step to link combinations to a critical TF foreach DC lineage. For DC3 (cDC2)-restricted cells, the inventors required combinationsto contain PU.1 and for DC6-restricted cells to contain IRF8. The inventors then selected the top 10 TFs from corresponding clusters and composed new TF combinations of 4and ranked them based on normalized values between cluster-restricted cells againstremaining cells. Cell type annotation with pre-trained models For preprocessing the gene expression matrix, the inventors applied a standard single-cell data procedure (Heumos et al. (2023)). Initially, cells with total counts exceeding ±5median absolute deviations (MAD) were excluded, as well as cells with mitochondrial counts above 22%. The remaining 46,658 cells were normalized, using either CPM (Counts Per Million) normalization (specifically for CellTypist label transfer) or size-factor normalization (for all other analyses), followed by log1p transformation. Highly variablegenes were identified using the Scanpy package with the ‘seurat’ flavor setting. Cell typeannotations were performed using two methods: CellTypist (Domínguez Conde et al.(2022)) and scTab (Fischer et al. (2024)). For CellTypist, the inventors employed the pre-trained Immune_All_High model (https: / / www.celltypist.org / models), which includesdiverse cell types such as fibroblasts and immune cells. CellTypist was run with the default settings, though majority voting pruning was omitted due to the dynamic nature of our system. Additionally, the inventors utilized the scTab model, pre-trained on 22 million cells (https: / / pklab.med.harvard.edu / felix / data / scTab-checkpoints.tar.gz), to predict cell labels and calculate uncertainty scores, following the authors' guidelines. Label transfer from in-house dataset P6783PC02 In addition to pre-trained models, the inventors performed label transfer using a customreference dataset (Rosa et al. (2022)). This dataset included both HEFs and CD45+HLA-DR+, hiDC. The hiDC cells are reprogrammed DC1 cells obtained by transducing theHEF population with a polycistronic vector encoding PU.1, IRF8, and BATF3 and profiled by scRNA-seq at day 9. The gene expression count matrix underwent standard preprocessing, CPM normalization, and log1p transformation before model training. A CellTypist model was trained with feature_selection=True on the top 5,000 highly variable genes, identified using the Scanpy ‘seurat’ flavor function, achieving anaccuracy of 0.984 in 5-fold cross-validation. Labels were transferred with an averageconfidence score of 0.55. To validate predictions, the inventors confirmed the expressionof DC1 signature genes (Villani et al. (2017)) in cells annotated as hiDC.Decision Tree Modeling The gene expression matrix was pre-processed as described above. For the TF barcode count matrix, the inventors applied size-factor normalization, followed by log1ptransformation. The inventors first trained a DecisionTreeRegressor (Pedregosa et al.(2011)) on the size-factor normalized, log-transformed barcode matrix, using highlyvariable genes as target variables across the entire dataset, including the DN population, and set `max_depth=6`. This model achieved an average R² score of 0.04 and a meansquared error (MSE) of 0.11 through 5-fold cross-validation. A secondDecisionTreeRegressor with `max_depth=5` was trained solely on cells from the CD45+ population to reduce background noise from the DN population, achieving R² and MSE values of 0.07 and 0.13, respectively, using 5-fold cross-validation. The inventors then integrated the CD45+ population branch from the second model into the full dataset tree by aligning overlapping nodes between trees. To assign cell lineages to each terminal branch, the inventors scored marker gene signatures with Scanpy’s score_genes function, adjusting for gene set length, and designated cell types to branches where specific gene signatures were uniquely expressed. Finally, differential gene expression analysis was conducted using Seurat FindMarkers function with logfc.threshold=0.1 at each branching point by dividing the cell populations using the thresholds defined by the regression tree, and individual marker gene expressions in respective lineages were visually inspected to validate the assignments. Statistical analysis P6783PC02 Statistical analyses were performed with GraphPad Prism 9 software. Data are shown as mean ± SD. P values are shown when relevant (*P < 0.05; **P < 0.01; ***P< 0.001; ****P < 0.0001). Example 2: Optimization of barcode position in plasmids encoding transcription factors to facilitate detection by single cell RNA sequencingThe inventors aimed to develope REPROcode, a novel platform for the single-cell-based identification of combinations of barcoded reprogramming factors. To reliablymap TF combinations to a particular cell using 3’ scRNA-seq, the inventors hypothesized that finding an optimal position for the barcode in the expression cassette would be key to allow efficient detection of barcodes and identification of corresponding transcription factor. Material and Methods Molecular cloning and vector design The coding regions of each candidate TF were individually cloned into the lentiviral vector containing the constitutive promotor pRRL.PPT-SFFV-MCS (SFFV) (Rosa et al. 2022). Cellular barcodes were designed consisting of a 20-bp sequence, comprising 6- bp constant flanking sequences and an 8-bp variable sequence in the middle. The barcodes were inserted 1) next to a TF in version 1 (v1) or 2) in the region between woodchuck hepatitis regulatory element (WPRE) and long terminal repeat (LTR) in version 2 (v2). Single-cell RNA sequencing hiDCs at day 2, and 9 (CD45-HLA-DR- and CD45+HLA-DR+) were FACS sorted for scRNA-seq. Purified cells were loaded on a 10× Chromium (10× Genomics) according to manufacturer’s protocol. scRNA-seq indexed libraries were prepared using Chromium Single Cell 3′ v2 and v3 Reagent Kit (10× Genomics) according to manufacturer’s protocol. Analysis of RNA sequencing data Paired-end sequencing reads of single cell RNA-seq were processed using the 10x Genomics software Cell Ranger v6.1.0 (https: / / support.10xgenomics.com / single-cell- P6783PC02 gene-expression / software). Firstly, cellranger mkfastq was used to convert binary base call files to FASTQ files and to decode the multiplexed samples simultaneously. Next, cellranger count was applied to FASTQ files and alignment to human (hg38) genome assemblies, and to a plasmid sequence, as well. The sparse expression matrix generated by cellranger analysis pipeline was used as input to Seurat R library. The bam files were separately processed to extract the barcode sequence. ResultsTo validate the Reprocode single cell platform, the inventors performed a pilotexperiment, where cells were transduced with 9 barcoded transcription factors (plasmid vector design v1) using two different multiplicity of infection (350 and 200 genomic copies / cell) and purified cells at day 2 and day 9 (CD45-HLA-DR- and CD45+HLA-DR+) for scRNA sequencing profiling. First, the inventors detected only residual numbers of cells (between 0 to 9 cells) carrying barcoded transcription factors (Fig.1A). To find an optimal position for barcode detection along the plasmid map, scRNA-seq was mapped to the sequence of a lentiviral transfer plasmid encoding barcoded BATF3 (plasmid vector design v1, Fig.1B). The inventors found out that most reads were coming from the region between WPRE and LTR on the plasmid. The top reads coverage came from 230-470 bp, with peak around 350 bp from polyA tail. Taking this information into account, the inventors designed and placed their barcodes in the region between WPRE and LTR (plasmid vector design v2), as in this case, it did not disrupt any functional elements and allowed the detection of a large number of reads (Fig.1C). The experiment was repeated with the updated vector design (v2) and the inventors were able to detect cells with 9 distinct transcription factors each carrying individual barcodes. Moreover, TF barcodes were detected in more than 90% of cells (Fig.1D). Interestingly, the inventors observed that the single cell platform allowed no transcription factor bias when compared to other TF screening methods that typicallyallow bias towards specific TFs (Joung et al.2023) (Fig.1E).Conclusion The inventors designed an optimized vector, which contains a barcode, placed between WPRE and LTR, corresponding to 350bp upstream of the polyA. This placement allows a consistent barcode detection using 10X Genomics 3’ scRNA-seq technology. P6783PC02 Example 3: Optimization of barcode detection Given that the PCR amplification step during scRNA-seq library preparation might introduce errors, the inventors hypothesised that the detection of barcodes could be improved by allowing mismatches. Material and Methods A computational tool was designed that takes the barcode sequence for a particular TF and build a dictionary of similar sequences within the user-specified mismatch range. Then, the sequence is matched to a particular TF not only if it has an exact match but also if it matches the sequence from the corresponding dictionary. Results First, the inventors matched the barcode sequence with scRNA-seq data without any mismatches and calculated the number of distinct TF in each cell (Fig.1F, upper panel). Next, the same procedure was repeated but allowing 2 mismatches in the mapping procedure (Fig.1F, bottom panel). The inventors could observe that they increased the number of cells carrying 2-6 distinct TFs per cell while reducing the 0-1 cases by introducing the mismatches allowance algorithm. Conclusion These data demonstrate that allowing mismatches in barcodes sequences can improve the detection rate of TF barcodes and increase the number of cells containing combinations of different transcription factors, which is a critical point for the development of novel direct cell fate reprogramming methods. Example 4. Combinatorial transcription factor screening identifies transcription factors that enhance human cDC1 reprogramming efficiency and fidelity Background Numerous direct reprogramming strategies have been developed leveraging the overexpression of cell type-specific transcription factors. While these approaches have proven effective in inducing diverse somatic cell types, including neurons, hepatocytes,and dendritic cells (Pires et al. 2019), the efficiency of the direct reprogramming P6783PC02 process remains low. Moreover, the identification of immune cell-inducing transcription factors is still a challenge in the field. Results To uncover TFs capable of driving immune-like cellular identities in unrelated somatic cells, the inventors have developed REPROcode, a novel platform for the single-cell- based identification of combinations of barcoded reprogramming factors. This methodology allows simultaneous assessment of cellular transcriptomes and exogenous transcription factor expression levels. For this, cells are first transduced with lentiviral vectors encoding a library of up to 408 transcription factors expressed in immune cells identified by the inventors, allowing delivery of multiple exogenous transcription factors into each cell. Depending on the combination of transcription factors acquired by the cell, reprogramming towards diverse cellular fates is initiated. Characterization of these cells is achieved through single-cell RNA sequencing (scRNA-seq), wherein the transcriptome of each cell is correlated with that of specific natural immune cell types, and the corresponding TF barcodes acquired by the cells are identified. Thus, REPROcode enables an unbiased exploration of reprogramming factor combinations able to induce immune cell-specific transcriptomes, facilitating the identification of transcription factor combinations allowing direct reprogramming to different immune cell types within a single, well-controlled experimental framework. To assess the feasibility of the REPROcode approach, the inventors applied the strategy to cDC1 reprogramming mediated by the TFs PU.1, IRF8 and BATF3 (Rosa etal. 2018, Rosa et al.2022, Zimmermannova et al.2023) (Fig. 2A). The inventorsstarted by transducing human fibroblasts using a lentiviral library encoding 9 barcoded transcription factors, including PU.1, IRF8 and BATF3. Cells were purified at day 2 (live cells) and at day 9 for non-reprogrammed (CD45−HLA-DR−) or reprogrammed (CD45+HLA-DR+) cells and profiled by scRNA-seq. Transcription factor barcodes were recovered and matched with corresponding cells. This analysis demonstrated successful detection of all 9 barcoded transcription factors and feasibility to detect combinations of transcription factors (Fig.2B, C). Next, the inventors used the computational barcode detection by implementing a mismatches allowance algorithm, resulting in improved sensitivity (Example 3). Interestingly, the most frequent combination among reprogrammed cells, independently of the MOI used, was PU.1, IRF8 and BATF3, validating the utility of the platform to identify immune cell-inducing transcription factors (Fig.2D). P6783PC02 Next, the inventors hypothesized that reprogramming efficiency might be influenced by the levels of TFs. To address this question, the inventors classified single cells within our reprogrammed cell population using a support vector machine (SVM) classifiertrained with publicly available DC datasets (Villani et al. 2017) and examined theexogenous levels of reprogramming factors in cDC1-affiliated and non-affiliated cells (Fig.2E). TF levels in DC1-affiliated cells were not only higher compared to their non- affiliated counterparts but were also expressed in a particular stoichiometry, suggesting requirement for high levels of SPI1 and BATF3 and lower levels of IRF8 compared toSPI1 and BATF3 to be beneficial for the conversion (Fig.2F). To validate thisexperimentally, the inventors simultaneously overexpressed PIB with SPI1, IRF8 or BATF3. The inventors observed an increase in the reprogramming efficiency for PIB and BATF3, supporting the observation in DC1-affiliated cells (Fig.2G). Next, the inventors aimed to investigate whether additional transcription factors could cooperate with PU.1, IRF8 and BATF3 to induce higher reprogramming fidelity. Frequencies of cells containing PIB plus one additional factor within cDC1-affiliated cells were calculated and it was observed that the addition of GATA2 to PIB increased the frequency of DC1-affiliated cells, suggesting that GATA2 may act as a cDC1 reprogramming facilitator (Fig.2H). In agreement with this, overexpression of PU.1, IRF8 and BATF3, with GATA2 increased surface expression of CD40 (Fig.2I), suggesting that REPROcode allows the identification of transcription factors that cooperate with PU.1, IRF8 and BATF3 to achieve higher cDC1 reprogramming fidelity. Next, the inventors transduced human fibroblasts using a lentiviral library of 42 barcoded transcription factors. The analysis demonstrated successful detection and even distribution of all 42 barcoded TFs (Fig.2J). Moreover, it was observed that lower multiplicity of infection (5-15 genomic copies per cell) allows better multiplexity of barcodes (below 10 TFs per cell) when compared to higher multiplicity of infection (40 genomic copies per cell) that induced 40 transcription factor copies per cell (Fig.2K). By combining reprogrammed cells coming from 5, 10 or 15 TF copies per cell samples and normalising them to non-reprogrammed cells, PU.1, IRF8 and BATF3 were identified as the most abundant combination of 3 TF independently of the single cell RNA sequencing platform, validating the feasibility of the platform even in low and high multiplexed setting (Figure 2L). Conclusion P6783PC02 Overall, the data demonstrate that REPROcode can identify immune cell-inducing transcription factors in a pooled screen containing more than 40 TFs, providing a screening platform to identify cDC1-inducing transcription factors in a highly multiplexed setting. Ultimately, the same approach can be used to identify transcription factors for direct reprogramming of unrelated cells into alternative immune cell fates.Example 5. REPROcode identifies transcription factors able to induce distinctcDC1 states Background To understand whether addition of individual TFs to PIB allows the generation of different cDC1 states, the inventors used REPROcode and started by transducing human fibroblasts using a lentiviral library of 42 barcoded immune cell transcriptionfactors (Fig.3A). CD45+ transduced cells were FACS-sorted at day 9 and profiled byscRNA-seq. The inventors used gene signatures for immature, immunostimulatory, andactivated migratory cDC1 states (Meiser et al. (2023)) and calculated frequencies ofcells containing PIB and one additional factor within each state. Results The inventors observed non-overlapping top two TFs inducing the 3 states, including NFKBIA and NFKBIB for the immature cDC1 state, ID2 and MXD1 forimmunostimulatory cDC1, and BCL6 and IRF7 for the migratory cDC1 state (Fig. 3B).To further validate these findings, the inventors co-expressed PIB with NFKBIA at increasing MOIs and observed decreased surface expression levels of HLA-DR and CD40 (Fig.3C), indicating that NFKBIA promotes an immature cDC1 state. Finally, the inventors observed that immature, immunostimulatory and migratory cDC1 cells generated by reprogramming using the different combinations of TFs showed uniquegene expression programs (Fig.3D-L).ConclusionOverall, the data demonstrate that REPROcode can identify immune cell-inducingtranscription factors in a pooled screen containing more than 40 TFs, providing a screening platform to identify cDC1-inducing transcription factors in a highly multiplexed setting. These data revealed additional regulators of immature, immunostimulatory and activated migratory cDC1 states. Ultimately, the same P6783PC02 approach can be used to identify transcription factors for direct reprogramming of unrelated cells into alternative immune cell fates. Example 6. Combinatorial transcription factor screening identifies transcription factors that program different immune cell identities Background To validate REPROcode’s ability to induce multiple immune cell types in a single experiment, the inventors selected 48 TFs enriched in cDC1, cDC2, and pDC (SPI1, IRF8, BATF3, IRF2, TCF4, MYCL, GFI1B, GATA2, TBX21, ETS1, MXD1, NFKB1, PLEK, TSC22D3, NR4A3, IRF5, RUNX3, KLF4, BCL6, NFIL3, ID2, PRDM1, NR4A1, IRF4, TRPS1, ZBTB46, IKZF1, ARID5A, ZEB2, BCL11a, POU2F2, CREB3L2, IKZF3, STAT5A, MEF2C, ARID3A, JUNB, FOXN2, ZNF366, HHEX, IKZF2, MYB, RBPJ, REL, TCF12, SPIB, CEBPA and ETV6), and used lineage classifiers to identify reprogrammed immune fates induced. HEFs were transduced with 48 TFs (10 copies per cell) and at day 9 non-reprogrammed (CD45−HLA-DR−) and reprogrammed (CD45+) cells were FACS-sorted and profiled by scRNA-seq (Fig.4A). Results First, UMAP visualization of 44,296 cells revealed a separation of non-reprogrammed and reprogrammed cells (Fig.4B). Then, the inventors used the CellTypist classifier(Domínguez Conde et al. (2022)), a logistic regression model trained on 357,211 cells,of which 329,762 were immune cells — to classify reprogrammed cells with naturalimmune cell types. The resulting cell type annotations were categorized into three groups: reprogrammed immune cells, fibroblasts, and partially reprogrammed cells for cases with a low confidence score for fibroblast identity (Fig.4C). Next, the inventors investigated whether cDC1-like cells could be detected using the PIB combination. Todo this, the inventors first overlaid DC1 (Villani et al. (2017)) and hiDC (Rosa et al.(2022)) gene signatures and used the resulting overlaid gene signature to identify cDC1-like cells and look for combinations of TFs overexpressed in cDC1-like cells. This analysis successfully identified PIB in the top 5 combinations containing 4 TFs (Fig. 4D). Moreover, the inventors identified TFs that combined with PIB allowed higher expression of cDC1 genes when compared to PIB alone, including NR4A1, RBPJ,ARID3A, ARID3A+ETS1, ETS1+NR4A1 and NR4A1+HHEX (Fig. 4E). P6783PC02 The inventors then asked whether combinations for cDC2 and pDC lineages could be identified using REPROcode. They used cDC2 (DC3) or pDC (DC6) (Villani et al.(2017)) gene signatures and found that the most frequent TF combinations in DC3-restricted cells included TFs such as PU.1, KLF4, IRF8, TBX21, RBPJ, and ARID3A (Fig.5A). Regarding pDC identity, the most frequent TF combinations in DC6- restricted cells include TFs such as IRF8, RBPJ, ETS1, RUNX3, NR4A1, and NFIL3. The inventors then considered a complementary strategy to investigate immune specification by focusing on the most frequently expressed TFs across the dataset. PU.1 was the most frequent TF (82.77 % of cells CD45+ cells profiled, compared to 1.46 % of CD45−HLA-DR−) in reprogrammed cells which expression coincided (90.34%) with PTPRC expression (Fig.5B). In addition to PTPRC expression, we observed distinct expression patterns of HLA-DR (55.68 % of PTPRC+ cells) and CD7 (26.86% of PTPRC+ cells), which are markers of antigen presenting myeloid cells and lymphoid cells, respectively, highlighting the specification and segregation of reprogrammed lineages. These observations led the inventors to assess the hierarchical relationships among TFs during immune cell reprogramming. To further understand the hierarchical relationships among TFs in immune cell reprogramming, the inventors constructed a decision tree based on TF expression levels from barcodedTF data. By overlaying cell-type markers and cell-type – specific gene signatures, theinventors aimed to pinpoint key regulators among the 48 TFs that drive cell fate decisions at different branching points (Fig.5C). As expected from the correlation between PTPRC and PU.1, high PU.1 expression distinguished hematopoietic (CD45+) reprogrammed cells from non-reprogrammed (CD45-HLA-DR-) cells or populations retaining fibroblast gene signatures at the initial branch. Within the PU.1-high group, cells further diverged based on KLF4 expression, where high KLF4 levels were associated with genes such as IL12B, CD52, and CD7, while low KLF4 expression correlated with NRP1, CTSK, C150RF48 and TGFBI expression (Fig.5C). In the KLF4 high population, cells with high REL expression were directed towards migratory regulatory dendritic cells (mRegDCs), characterized by activation markers (CD40, CD80, CD86, CD83), along with SOX2 and FAS (Fig.5D)(Maier et al. (2020)). Conversely, in the low REL branch, IKZF2 expression influencedcommitment to a lymphoid lineage (Fig.5E). High IKZF2 expression associated with cells expressing natural killer (NK) markers, including GZMB and NCR1, indicating that IKZF2, in conjunction with other TFs, directs cells toward lymphoid fate. Interestingly, low IKZF2 expression redirected cells from a lymphoid to alternative myeloid lineages, P6783PC02 such as monocytes and neutrophils (Fig.5C). Within the IKZF2 low population, high expression of RUNX3 was associated with cells expressing the monocytic markers S100A8, S100A9, and S100A12 (Fig.5F), suggesting a role for RUNX3 in guiding monocytic differentiation within this reprogramming framework. Conclusion In summary, REPROcode enables the induction of diverse immune fates within a single experiment, facilitating the identification of TF combinations across closely related cell types with overlapping regulatory pathways as well as distinct cell typessuch as NK-like cells. In particular, REPROcode allowed the identification of TFcombinations that can be harnessed to reprogram different immune cell fates, including DC states like mRegDCs, lymphoid cells such as NK cells, monocytes, neutrophils and others. Sequence overviewSEQ ID NO: 1: PU.1 polypeptide sequence. NCBI Reference Sequence: NP_003111.2.MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH HVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVS YLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKK KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTY QKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH SEQ ID NO: 2: IRF8 polypeptide sequence. NCBI Reference Sequence: NP_002154.1. MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIF KAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVP EEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRS QLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGC RLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQ GVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRL PDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPP PDQVFRMFPDICASHQRSFFRENQQITV SEQ ID NO: 3: BATF3 polypeptide sequence. NCBI Reference Sequence: NP_061134.1. P6783PC02 MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRK KQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFV PVPPRPDPVAGCLPR SEQ ID NO: 4: KLF4 polypeptide sequence. NCBI Reference Sequence: NP_004226.3. MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPP VLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLT HPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGL LYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGK FVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCT HLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPH PGPNYPSFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTC DYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGH RPFQCQKCDRAFSRSDHLALHMKRHF SEQ ID NO: 5: REL polypeptide sequence. NCBI Reference Sequence: NP_002899.1. MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGK GKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEV KEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIY DNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQA DVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKA KKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRP GLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMA PLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIY NNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNL ENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMI NESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV SEQ ID NO: 6: ID2 polypeptide sequence. NCBI Reference Sequence: NP_002157.2. MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKK VSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASE FPSELMSNDSKALCG P6783PC02 SEQ ID NO: 7: MXD1 polypeptide sequence. NCBI Reference Sequence: NP_002348.1. MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSS SRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRK AVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLT GDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL SEQ ID NO: 8: NR4A1 polypeptide sequence. NCBI Reference Sequence: NP_002126.2. MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMD GYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGP LSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLR AWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPT AFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTC EGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTD SLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGK EDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSK PGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDR HGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRI FYLKLEDLVPPPPIIDKIFMDTLPF SEQ ID NO: 9: RBPJ polypeptide sequence. NCBI Reference Sequence: NP_976029.1. MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPP CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAK TLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTK VALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIH YGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLS QERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGW RWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNES NTNSEGSYTNASTNSTSVTSSTATVVS SEQ ID NO: 10: HHEX polypeptide sequence. NCBI Reference Sequence: NP_002720.1. P6783PC02 MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSF TSLVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLR HDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKM LQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKG ASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG SEQ ID NO: 11: ETS1 polypeptide sequence. NCBI Reference Sequence: NP_005229.1. MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKE QQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFL ELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPP SEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVT PDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDS EDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLT DKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNII HKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE SEQ ID NO: 12: IRF7 polypeptide sequence. NCBI Reference Sequence: NP_004020.1. MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEAD ARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDN SGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQ APGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGA CAGGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPS CTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQL WARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQR RGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLS LCLSSANSLYDDIECFLMELEQPA SEQ ID NO: 13: BCL6 polypeptide sequence. NCBI Reference Sequence: NP_001124317.1. MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYS IFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVV DTCRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCE SRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCD P6783PC02 SARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNA PYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESC SSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSP RAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSS ESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAF FCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPY RCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPYPC EICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQ YRVSATDLPPELPKAC SEQ ID NO: 14: TBX21 polypeptide sequence. NCBI Reference Sequence: NP_037483.1. MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLG SPYPGGALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAP DPRAGLYPGPREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFP FLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHP DSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGE PEAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSI PSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSY EAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRP MRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYP SSGDSSSPAGAPSPFDKEAEGQFYNYFPN SEQ ID NO: 15: ARID3A polypeptide sequence. NCBI Reference Sequence: NP_005215.1. MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPESARMQ RAQMAALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPG EEHFEDMASDEDMKPKWEEEEMEEDLGEDE EEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQE RPGPGPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFSF MQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSA AFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAH GMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQ AAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNF P6783PC02 LAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPA PTPTSAPNKGGGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP SEQ ID NO: 16: IKZF2 polypeptide sequence. NCBI Reference Sequence: NP_057344.2. METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSD EECDRKPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCD VCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPF CSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYLQNVSM EAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTGNMGKRKSSTPQKF VGEKLMRFSYPDIHFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPP STIAEVAPVISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQEREASP SNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDI YKVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHMGCHGYRDPLECNICGYRSQDRYEF SSHIVRGEHTFH SEQ ID NO: 17: RUNX3 polypeptide sequence. NCBI Reference Sequence: NP_001026850.1. MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVG PGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALG DVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITV FTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTP SPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYP GAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPS PYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGG QSDGVEADGSHSNSPTALSTPGRMDEAVWRPY SEQ ID NO: 18: NFKBIA polypeptide sequence. NCBI Reference Sequence: NP_065390.1. MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEP QEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTP LHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHL HSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPD LVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEES YDTESEFTEFTEDELPYDDCVFGGQRLTL P6783PC02 SEQ ID NO: 19: NFKBIB polypeptide sequence. NCBI Reference Sequence: NP_002494.2. MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVT EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLY AAGAGLCVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTP DTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLR DAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAML RPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRL PPTPASKPLPDDPRPV SEQ ID NO: 20: PU.1 polynucleotide sequence. NCBI Reference Sequence: NM_003120.3. ATGTTACAGGCGTGCAAAATGGAAGGGTTTCCCCTCGTCCCCCCTCCATCAGAAG ACCTGGTGCCCTATGACACGGATCTATACCAACGCCAAACGCACGAGTATTACCC CTATCTCAGCAGTGATGGGGAGAGCCATAGCGACCATTACTGGGACTTCCACCCC CACCACGTGCACAGCGAGTTCGAGAGCTTCGCCGAGAACAACTTCACGGAGCTC CAGAGCGTGCAGCCCCCGCAGCTGCAGCAGCTCTACCGCCACATGGAGCTGGA GCAGATGCACGTCCTCGATACCCCCATGGTGCCACCCCATCCCAGTCTTGGCCA CCAGGTCTCCTACCTGCCCCGGATGTGCCTCCAGTACCCATCCCTGTCCCCAGC CCAGCCCAGCTCAGATGAGGAGGAGGGCGAGCGGCAGAGCCCCCCACTGGAGG TGTCTGACGGCGAGGCGGATGGCCTGGAGCCCGGGCCTGGGCTCCTGCCTGGG GAGACAGGCAGCAAGAAGAAGATCCGCCTGTACCAGTTCCTGTTGGACCTGCTC CGCAGCGGCGACATGAAGGACAGCATCTGGTGGGTGGACAAGGACAAGGGCAC CTTCCAGTTCTCGTCCAAGCACAAGGAGGCGCTGGCGCACCGCTGGGGCATCCA GAAGGGCAACCGCAAGAAGATGACCTACCAGAAGATGGCGCGCGCGCTGCGCA ACTACGGCAAGACGGGCGAGGTCAAGAAGGTGAAGAAGAAGCTCACCTACCAGT TCAGCGGCGAAGTGCTGGGCCGCGGGGGCCTGGCCGAGCGGCGCCACCCGCC CCACTGA SEQ ID NO: 21: IRF8 polynucleotide sequence. NCBI Reference Sequence: NM_002163.4 ATGTGTGACCGGAATGGTGGTCGGCGGCTTCGACAGTGGCTGATCGAGCAGATT GACAGTAGCATGTATCCAGGACTGATTTGGGAGAATGAGGAGAAGAGCATGTTCC GGATCCCTTGGAAACACGCTGGCAAGCAAGATTATAATCAGGAAGTGGATGCCTC P6783PC02 CATTTTTAAGGCCTGGGCAGTTTTTAAAGGGAAGTTTAAAGAAGGGGACAAAGCT GAACCAGCCACTTGGAAGACGAGGTTACGCTGTGCTTTGAATAAGAGCCCAGATT TTGAGGAAGTGACGGACCGGTCCCAACTGGACATTTCCGAGCCATACAAAGTTTA CCGAATTGTTCCTGAGGAAGAGCAAAAATGCAAACTAGGCGTGGCAACTGCTGGC TGCGTGAATGAAGTTACAGAGATGGAGTGCGGTCGCTCTGAAATCGACGAGCTGA TCAAGGAGCCTTCTGTGGACGATTACATGGGGATGATCAAAAGGAGCCCTTCCCC GCCGGAGGCCTGTCGGAGTCAGCTCCTTCCAGACTGGTGGGCGCAGCAGCCCA GCACAGGCGTGCCGCTGGTGACGGGGTACACCACCTACGACGCGCACCATTCAG CATTCTCCCAGATGGTGATCAGCTTCTACTATGGGGGCAAGCTGGTGGGCCAGG CCACCACCACCTGCCCCGAGGGCTGCCGCCTGTCCCTGAGCCAGCCTGGGCTG CCCGGCACCAAGCTGTATGGGCCCGAGGGCCTGGAGCTGGTGCGCTTCCCGCC GGCCGACGCCATCCCCAGCGAGCGACAGAGGCAGGTGACGCGGAAGCTGTTCG GGCACCTGGAGCGCGGGGTGCTGCTGCACAGCAGCCGGCAGGGCGTGTTCGTC AAGCGGCTGTGCCAGGGCCGCGTGTTCTGCAGCGGCAACGCCGTGGTGTGCAA AGGCAGGCCCAACAAGCTGGAGCGTGATGAGGTGGTCCAGGTCTTCGACACCAG CCAGTTCTTCCGAGAGCTGCAGCAGTTCTATAACAGCCAGGGCCGGCTTCCTGAC GGCAGGGTGGTGCTGTGCTTTGGGGAAGAGTTTCCGGATATGGCCCCCTTGCGC TCCAAACTCATTCTCGTGCAGATTGAGCAGCTGTATGTCCGGCAACTGGCAGAAG AGGCTGGGAAGAGCTGTGGAGCCGGCTCTGTGATGCAGGCCCCCGAGGAGCC GCCGCCAGACCAGGTCTTCCGGATGTTTCCAGATATTTGTGCCTCACACCAGAGA TCATTTTTCAGAGAAAACCAACAGATCACCGTCTAA SEQ ID NO: 22: BATF3 polynucleotide sequence. NCBI Reference Sequence: NM_018664.3. ATGTCGCAAGGGCTCCCGGCCGCCGGCAGCGTCCTGCAGAGGAGCGTCGCGGC GCCCGGGAACCAGCCGCAGCCGCAGCCGCAGCAGCAGAGCCCTGAGGATGATG ACAGGAAGGTCCGAAGGAGAGAAAAAAACCGAGTTGCTGCTCAGAGAAGTCGGA AGAAGCAGACCCAGAAGGCTGACAAGCTCCATGAGGAATATGAGAGCCTGGAGC AAGAAAACACCATGCTGCGGAGAGAGATCGGGAAGCTGACAGAGGAGCTGAAGC ACCTGACAGAGGCACTGAAGGAGCACGAGAAGATGTGCCCGCTGCTGCTCTGCC CTATGAACTTTGTGCCAGTGCCTCCCCGGCCGGACCCTGTGGCCGGCTGCTTGC CCCGATGA SEQ ID NO: 23: KLF4 polynucleotide sequence. NCBI Reference Sequence: NM_004235.6. P6783PC02 ATGAGGCAGCCACCTGGCGAGTCTGACATGGCTGTCAGCGACGCGCTGCTCCCA TCTTTCTCCACGTTCGCGTCTGGCCCGGCGGGAAGGGAGAAGACACTGCGTCAA GCAGGTGCCCCGAATAACCGCTGGCGGGAGGAGCTCTCCCACATGAAGCGACTT CCCCCAGTGCTTCCCGGCCGCCCCTATGACCTGGCGGCGGCGACCGTGGCCAC AGACCTGGAGAGCGGCGGAGCCGGTGCGGCTTGCGGCGGTAGCAACCTGGCGC CCCTACCTCGGAGAGAGACCGAGGAGTTCAACGATCTCCTGGACCTGGACTTTAT TCTCTCCAATTCGCTGACCCATCCTCCGGAGTCAGTGGCCGCCACCGTGTCCTCG TCAGCGTCAGCCTCCTCTTCGTCGTCGCCGTCGAGCAGCGGCCCTGCCAGCGCG CCCTCCACCTGCAGCTTCACCTATCCGATCCGGGCCGGGAACGACCCGGGCGTG GCGCCGGGCGGCACGGGCGGAGGCCTCCTCTATGGCAGGGAGTCCGCTCCCCC TCCGACGGCTCCCTTCAACCTGGCGGACATCAACGACGTGAGCCCCTCGGGCGG CTTCGTGGCCGAGCTCCTGCGGCCAGAATTGGACCCGGTGTACATTCCGCCGCA GCAGCCGCAGCCGCCAGGTGGCGGGCTGATGGGCAAGTTCGTGCTGAAGGCGT CGCTGAGCGCCCCTGGCAGCGAGTACGGCAGCCCGTCGGTCATCAGCGTCAGC AAAGGCAGCCCTGACGGCAGCCACCCGGTGGTGGTGGCGCCCTACAACGGCGG GCCGCCGCGCACGTGCCCCAAGATCAAGCAGGAGGCGGTCTCTTCGTGCACCCA CTTGGGCGCTGGACCCCCTCTCAGCAATGGCCACCGGCCGGCTGCACACGACTT CCCCCTGGGGCGGCAGCTCCCCAGCAGGACTACCCCGACCCTGGGTCTTGAGG AAGTGCTGAGCAGCAGGGACTGTCACCCTGCCCTGCCGCTTCCTCCCGGCTTCC ATCCCCACCCGGGGCCCAATTACCCATCCTTCCTGCCCGATCAGATGCAGCCGC AAGTCCCGCCGCTCCATTACCAAGAGCTCATGCCACCCGGTTCCTGCATGCCAGA GGAGCCCAAGCCAAAGAGGGGAAGACGATCGTGGCCCCGGAAAAGGACCGCCA CCCACACTTGTGATTACGCGGGCTGCGGCAAAACCTACACAAAGAGTTCCCATCT CAAGGCACACCTGCGAACCCACACAGGTGAGAAACCTTACCACTGTGACTGGGA CGGCTGTGGATGGAAATTCGCCCGCTCAGATGAACTGACCAGGCACTACCGTAAA CACACGGGGCACCGCCCGTTCCAGTGCCAAAAATGCGACCGAGCATTTTCCAGG TCGGACCACCTCGCCTTACACATGAAGAGGCATTTTTAA SEQ ID NO: 24: REL polynucleotide sequence. NCBI Reference Sequence: NM_002908.4. ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGA GGGGAATGCGTTTTAGATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAG GGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTA TTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAAC CTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCAGA P6783PC02 ATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGA AGAAAAAAGAAGTAAAAGAAGCTATTATTACAAGAATAAAGGCAGGAATCAATCCA TTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGT GAGACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTC TTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCTCCAAATACTGCAGAA TTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAA TATTTCTACTTTGTGACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGA ACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTAGC CATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAA AAATGCAGTTGCGGAGACCTTCTGACCAGGAAGTTAGTGAATCTATGGATTTTAGA TATCTGCCAGATGAAAAAGATACTTACGGCAATAAAGCAAAGAAACAAAAGACAAC TCTGCTTTTCCAGAAACTGTGCCAGGATCACGTAGAAACAGGGTTTCGCCATGTT GACCAGGATGGTCTTGAACTCCTGACATCAGGTGATCCACCCACCTTGGCCTCCC AAAGTGCTGGGATTACAGTTAATTTTCCTGAGAGACCAAGACCTGGTCTCCTCGG TTCAATTGGAGAAGGAAGATACTTCAAAAAAGAACCAAACTTGTTTTCTCATGATG CAGTTGTGAGAGAAATGCCTACAGGGGTTTCAAGTCAAGCAGAATCCTACTATCC CTCACCTGGGCCCATCTCAAGTGGATTGTCACATCATGCCTCAATGGCACCTCTG CCTTCTTCAAGCTGGTCATCAGTGGCCCACCCCACCCCACGCTCAGGCAATACAA ACCCACTGAGTAGTTTTTCAACAAGGACACTTCCTTCTAATTCGCAAGGTATCCCA CCATTCCTGAGAATACCTGTTGGGAATGATTTAAATGCTTCTAATGCTTGCATTTAC AACAATGCCGATGACATAGTCGGAATGGAAGCGTCATCCATGCCATCAGCAGATT TATATGGTATTTCTGATCCCAACATGCTGTCTAATTGTTCTGTGAATATGATGACAA CCAGCAGTGACAGCATGGGAGAGACTGATAATCCAAGACTTCTGAGCATGAATCT TGAAAACCCCTCATGTAATTCAGTGTTAGACCCAAGAGACTTGAGACAGCTCCATC AGATGTCCTCTTCCAGTATGTCAGCAGGCGCCAATTCCAATACTACTGTTTTTGTT TCACAATCAGATGCATTTGAGGGATCTGACTTCAGTTGTGCAGATAACAGCATGAT AAATGAGTCGGGACCATCAAACAGTA CTAATCCAAACAGTCATGGTTTTGTTCAAGATAGTCAGTATTCAGGTATTGGCAGT ATGCAAAATGAGCAATTGAGTGACTCCTTTCCATATGAATTTTTTCAAGTATAA SEQ ID NO: 25: ID2 polynucleotide sequence. NCBI Reference Sequence: NM_002166.5. ATGAAAGCCTTCAGTCCCGTGAGGTCCGTTAGGAAAAACAGCCTGTCGGACCACA GCCTGGGCATCTCCCGGAGCAAAACCCCTGTGGACGACCCGATGAGCCTGCTAT ACAACATGAACGACTGCTACTCCAAGCTCAAGGAGCTGGTGCCCAGCATCCCCCA P6783PC02 GAACAAGAAGGTGAGCAAGATGGAAATCCTGCAGCACGTCATCGACTACATCTTG GACCTGCAGATCGCCCTGGACTCGCATCCCACTATTGTCAGCCTGCATCACCAGA GACCCGGGCAGAACCAGGCGTCCAGGACGCCGCTGACCACCCTCAACACGGATA TCAGCATCCTGTCCTTGCAGGCTTCTGAATTCCCTTCTGAGTTAATGTCAAATGAC AGCAAAGCACTGTGTGGCTGA SEQ ID NO: 26: MXD1 polynucleotide sequence. NCBI Reference Sequence: NM_002357.4. ATGGCGGCGGCGGTTCGGATGAACATCCAGATGCTGCTGGAGGCGGCCGACTAT CTGGAGCGGCGGGAGAGAGAAGCTGAACATGGTTATGCCTCCATGTTACCATACA ATAACAAGGACAGAGATGCCTTAAAACGGAGGAACAAATCCAAAAAGAATAACAG CAGTAGCAGATCAACTCACAATGAAATGGAGAAGAATAGACGGGCTCATCTTCGC TTGTGCCTGGAGAAGTTGAAGGGGCTGGTGCCACTTGGACCCGAATCAAGTCGA CACACTACGTTGAGTTTATTAACAAAAGCCAAATTGCACATAAAGAAACTTGAAGA TTGTGACAGAAAAGCCGTTCACCAAATCGACCAGCTTCAGCGAGAGCAGCGACAC CTGAAGAGGCAGCTGGAGAAGCTGGGCATTGAGAGGATCCGGATGGACAGCATC GGCTCCACCGTCTCCTCGGAGCGCTCCGACTCCGACAGGGAAGAAATCGACGTT GACGTGGAGAGCACGGACTATCTCACAGGTGATCTGGACTGGAGCAGCAGCAGT GTGAGCGACTCTGACGAGCGGGGCAGCATGCAGAGCCTCGGCAGTGATGAGGG CTATTCCAGCACCAGCATCAAGAGAATAAAGCTGCAGGACAGTCACAAGGCGTGT CTTGGTCTCTAA SEQ ID NO: 27: NR4A1 polynucleotide sequence. NCBI Reference Sequence: NM_002135.5. ATGCCCTGTATCCAAGCCCAATATGGGACACCAGCACCGAGTCCGGGACCCCGT GACCACCTGGCAAGCGACCCCCTGACCCCTGAGTTCATCAAGCCCACCATGGAC CTGGCCAGCCCCGAGGCAGCCCCCGCTGCCCCCACTGCCCTGCCCAGCTTCAG CACCTTCATGGACGGCTACACAGGAGAGTTTGACACCTTCCTCTACCAGCTGCCA GGAACAGTCCAGCCATGCTCCTCAGCCTCCTCCTCGGCCTCCTCCACATCCTCGT CCTCAGCCACCTCCCCTGCCTCTGCCTCCTTCAAGTTCGAGGACTTCCAGGTGTA CGGCTGCTACCCCGGCCCCCTGAGCGGCCCAGTGGATGAGGCCCTGTCCTCCA GTGGCTCTGACTACTATGGCAGCCCCTGCTCGGCCCCGTCGCCCTCCACGCCCA GCTTCCAGCCGCCCCAGCTCTCTCCCTGGGATGGCTCCTTCGGCCACTTCTCGC CCAGCCAGACTTACGAAGGCCTGCGGGCATGGACAGAGCAGCTGCCCAAAGCCT CTGGGCCCCCACAGCCTCCAGCCTTCTTTTCCTTCAGTCCTCCCACCGGCCCCAG P6783PC02 CCCCAGCCTGGCCCAGAGCCCCCTGAAGTTGTTCCCCTCACAGGCCACCCACCA GCTGGGGGAGGGAGAGAGCTATTCCATGCCTACGGCCTTCCCAGGTTTGGCACC CACTTCTCCACACCTTGAGGGCTCGGGGATACTGGATACACCCGTGACCTCAACC AAGGCCCGGAGCGGGGCCCCAGGTGGAAGTGAAGGCCGCTGTGCTGTGTGTGG GGACAACGCTTCATGCCAGCATTATGGTGTCCGCACATGTGAGGGCTGCAAGGG CTTCTTCAAGCGCACAGTGCAGAAAAACGCCAAGTACATCTGCCTGGCTAACAAG GACTGCCCTGTGGACAAGAGGCGGCGAAACCGCTGCCAGTTCTGCCGCTTCCAG AAGTGCCTGGCGGTGGGCATGGTGAAGGAAGTTGTCCGAACAGACAGCCTGAAG GGGCGGCGGGGCCGGCTACCTTCAAAACCCAAGCAGCCCCCAGATGCCTCCCCT GCCAATCTCCTCACTTCCCTGGTCCGTGCACACCTGGACTCAGGGCCCAGCACT GCCAAACTGGACTACTCCAAGTTCCAGGAGCTGGTGCTGCCCCACTTTGGGAAG GAAGATGCTGGGGATGTACAGCAGTTCTACGACCTGCTCTCCGGTTCTCTGGAGG TCATCCGCAAGTGGGCGGAGAAGATCCCTGGCTTTGCTGAGCTGTCACCGGCTG ACCAGGACCTGTTGCTGGAGTCGGCCTTCCTGGAGCTCTTCATCCTCCGCCTGG CGTACAGGTCTAAGCCAGGCGAGGGCAAGCTCATCTTCTGCTCAGGCCTGGTGC TACACCGGCTGCAGTGTGCCCGTGGCTTCGGGGACTGGATTGACAGTATCCTGG CCTTCTCAAGGTCCCTGCACAGCTTGCTTGTCGATGTCCCTGCCTTCGCCTGCCT CTCTGCCCTTGTCCTCATCACCGACCGGCATGGGCTGCAGGAGCCGCGGCGGGT GGAGGAGCTGCAGAACCGCATCGCCAGCTGCCTGAAGGAGCACGTGGCAGCTG TGGCGGGCGAGCCCCAGCCAGCCAGCTGCCTGTCACGTCTGTTGGGCAAACTGC CCGAGCTGCGGACCCTGTGCACCCAGGGCCTGCAGCGCATCTTCTACCTCAAGC TGGAGGACTTGGTGCCCCCTCCACCCATCATTGACAAGATCTTCATGGACACGCT GCCCTTCTGA SEQ ID NO: 28: RBPJ polynucleotide sequence. NCBI Reference Sequence: NM_203284.3. ATGGCGTGGATTAAAAGGAAATTTGGTGAGCGGCCTCCACCTAAACGACTTACTA GGGAAGCTATGCGAAATTATTTAAAAGAGCGAGGGGATCAAACAGTACTTATTCTT CATGCAAAAGTTGCACAGAAGTCATATGGAAATGAAAAAAGGTTTTTTTGCCCACC TCCTTGTGTATATCTTATGGGCAGTGGATGGAAGAAAAAAAAAGAACAAATGGAAC GCGATGGTTGTTCTGAACAAGAGTCTCAACCGTGTGCATTTATTGGGATAGGAAAT AGTGACCAAGAAATGCAGCAGCTAAACTTGGAAGGAAAGAACTATTGCACAGCCA AAACATTGTATATATCTGACTCAGACAAGCGAAAGCACTTCATGTTGTCTGTAAAG ATGTTCTATGGCAACAGTGATGACATTGGTGTGTTCCTCAGCAAGCGGATAAAAGT CATCTCCAAACCTTCCAAAAAGAAGCAGTCATTGAAAAATGCTGACTTATGCATTG P6783PC02 CCTCAGGAACAAAGGTGGCTCTGTTTAATCGACTACGATCCCAGACAGTTAGTAC CAGATACTTGCATGTAGAAGGAGGTAATTTTCATGCCAGTTCACAGCAGTGGGGA GCCTTTTTTATTCATCTCTTGGATGATGATGAATCAGAAGGAGAAGAATTCACAGT CCGAGATGGCTACATCCATTATGGACAAACAGTCAAACTTGTGTGCTCAGTTACTG GCATGGCACTCCCAAGATTGATAATTAGGAAAGTTGATAAGCAGACCGCATTATTG GATGCAGATGATCCTGTGTCACAACTCCATAAATGTGCATTTTACCTTAAGGATAC AGAAAGAATGTATTTGTGCCTTTCTCAAGAAAGAATAATTCAATTTCAGGCCACTC CATGTCCAAAAGAACCAAATAAAGAGATGATAAATGATGGCGCTTCCTGGACAATC ATTAGCACAGATAAGGCAGAGTATACATTTTATGAGGGAATGGGCCCTGTCCTTG CCCCAGTCACTCCTGTGCCTGTGGTAGAGAGCCTTCAGTTGAATGGCGGTGGGG ACGTAGCAATGCTTGAACTTACAGGACAGAATTTCACTCCAAATTTACGAGTGTGG TTTGGGGATGTAGAAGCTGAAACTATGTACAGGTGTGGAGAGAGTATGCTCTGTG TCGTCCCAGACATTTCTGCATTCCGAGAAGGTTGGAGATGGGTCCGGCAACCAGT CCAGGTTCCAGTAACTTTGGTCCGAAATGATGGAATCATTTATTCCACCAGCCTTA CCTTTACCTACACACCAGAACCAGGGCCGCGGCCACATTGCAGTGCAGCAG GAGCAATCCTTCGAGCCAATTCAAGCCAGGTGCCCCCTAACGAATCAAACACAAA CAGCGAGGGAAGTTACACAAACGCCAGCACAAATTCAACCAGTGTCACATCATCT ACAGCCACAGTGGTATCCTAA SEQ ID NO: 29: HHEX polynucleotide sequence. NCBI Reference Sequence: NM_002729.5. ATGCAGTACCCGCACCCCGGGCCGGCGGCGGGCGCCGTGGGGGTGCCGCTGTA CGCGCCCACGCCGCTGCTGCAACCCGCACACCCGACGCCCTTTTACATCGAGGA CATCCTGGGCCGCGGGCCCGCCGCGCCCACGCCCGCCCCCACGCTGCCGTCCC CCAACTCCTCCTTCACCAGCCTCGTGTCCCCCTACCGGACCCCGGTGTACGAGC CCACGCCGATCCATCCAGCCTTCTCGCACCACTCCGCCGCCGCGCTGGCCGCTG CCTACGGACCCGGCGGCTTCGGGGGCCCTCTGTACCCCTTCCCGCGGACGGTG AACGACTACACGCACGCCCTGCTCCGCCACGACCCCCTGGGCAAACCTCTACTC TGGAGCCCCTTCTTGCAGAGGCCTCTGCATAAAAGGAAAGGCGGCCAGGTGAGA TTCTCCAACGACCAGACCATCGAGCTGGAGAAGAAATTCGAGACGCAGAAATATC TCTCTCCGCCCGAGAGGAAGCGTCTGGCCAAGATGCTGCAGCTCAGCGAGAGAC AGGTCAAAACCTGGTTTCAGAATCGACGCGCTAAATGGAGGAGACTAAAACAGGA GAACCCTCAAAGCAATAAAAAAGAAGAACTGGAAAGTTTGGACAGTTCCTGTGATC AGAGGCAAGATTTGCCCAGTGAACAGAATAAAGGTGCTTCTTTGGATAGCTCTCA P6783PC02 ATGTTCGCCCTCCCCTGCCTCCCAGGAAGACCTTGAATCAGAGATTTCAGAGGAT TCTGATCAGGAAGTGGACATTGAGGGCGATAAAAGCTATTTTAATGCTGGATGA SEQ ID NO: 30: ETS1 polynucleotide sequence. NCBI Reference Sequence: NM_005238.4. ATGAAGGCGGCCGTCGATCTCAAGCCGACTCTCACCATCATCAAGACGGAAAAAG TCGATCTGGAGCTTTTCCCCTCCCCGGATATGGAATGTGCAGATGTCCCACTATTA ACTCCAAGCAGCAAAGAAATGATGTCTCAAGCATTAAAAGCTACTTTCAGTGGTTT CACTAAAGAACAGCAACGACTGGGGATCCCAAAAGACCCCCGGCAGTGGACAGA AACCCATGTTCGGGACTGGGTGATGTGGGCTGTGAATGAATTCAGCCTGAAAGGT GTAGACTTCCAGAAGTTCTGTATGAATGGAGCAGCCCTCTGCGCCCTGGGTAAAG ACTGCTTTCTCGAGCTGGCCCCAGACTTTGTTGGGGACATCTTATGGGAACATCT AGAGATCCTGCAGAAAGAGGATGTGAAACCATATCAAGTTAATGGAGTCAACCCA GCCTATCCAGAATCCCGCTATACCTCGGATTACTTCATTAGCTATGGTATTGAGCA TGCCCAGTGTGTTCCACCATCGGAGTTCTCAGAGCCCAGCTTCATCACAGAGTCC TATCAGACGCTCCATCCCATCAGCTCGGAAGAGCTCCTCTCCCTCAAGTATGAGA ATGACTACCCCTCGGTCATTCTCCGAGACCCTCTCCAGACAGACACCTTGCAGAA TGACTACTTTGCTATCAAACAAGAAGTCGTCACCCCAGACAACATGTGCATGGGG AGGACCAGTCGTGGTAAACTCGGGGGCCAGGACTCTTTTGAAAGCATAGAGAG CTACGATAGTTGTGATCGCCTCACCCAGTCCTGGAGCAGCCAGTCATCTTTCAAC AGCCTGCAGCGTGTTCCCTCCTATGACAGCTTCGACTCAGAGGACTATCCGGCTG CCCTGCCCAACCACAAGCCCAAGGGCACCTTCAAGGACTATGTGCGGGACCGTG CTGACCTCAATAAGGACAAGCCTGTCATTCCTGCTGCTGCCCTAGCTGGCTACAC AGGCAGTGGACCAATCCAGCTATGGCAGTTTCTTCTGGAATTACTCACTGATAAAT CCTGT CAGTCTTTTATCAGCTGGACAGGAGATGGCTGGGAATTCAAACTTTCTGACCCAG ATGAGGTGGCCAGGAGATGGGGAAAGAGGAAAAACAAACCTAAGATGAATTATGA GAAACTGAGCCGTGGCCTACGCTACTATTACGACAAAAACATCATCCACAAGACA GCGGGGAAACGCTACGTGTACCGCTTTGTGTGTGACCTGCAGAGCCTGCTGGGG TACACCCCTGAGGAGCTGCACGCCATGCTGGACGTCAAGCCAGATGCCGACGAG TGA SEQ ID NO: 31: IRF7 polynucleotide sequence. NCBI Reference Sequence: NM_004029.4. P6783PC02 ATGGCCTTGGCTCCTGAGAGGGCAGCCCCACGCGTGCTGTTCGGAGAGTGGCTC CTTGGAGAGATCAGCAGCGGCTGCTATGAGGGGCTGCAGTGGCTGGACGAGGC CCGCACCTGTTTCCGCGTGCCCTGGAAGCACTTCGCGCGCAAGGACCTGAGCGA GGCCGACGCGCGCATCTTCAAGGCCTGGGCTGTGGCCCGCGGCAGGTGGCCGC CTAGCAGCAGGGGAGGTGGCCCGCCCCCCGAGGCTGAGACTGCGGAGCGCGCC GGCTGGAAAACCAACTTCCGCTGCGCACTGCGCAGCACGCGTCGCTTCGTGATG CTGCGGGATAACTCGGGGGACCCGGCCGACCCGCACAAGGTGTACGCGCTCAG CCGGGAGCTGTGCTGGCGAGAAGGCCCAGGCACGGACCAGACTGAGGCAGAGG CCCCCGCAGCTGTCCCACCACCACAGGGTGGGCCCCCAGGGCCATTCCTGGCA CACACACATGCTGGACTCCAAGCCCCAGGCCCCCTCCCTGCCCCAGCTGGTGAC AAGGGGGACCTCCTGCTCCAGGCAGTGCAACAGAGCTGCCTGGCAGACCATCTG CTGACAGCGTCATGGGGGGCAGATCCAGTCCCAACCAAGGCTCCTGGAGAGGGA CAAGAAGGGCTTCCCCTGACTGGGGCCTGTGCTGGAGGCGAGGCCGCGGCCCC AGAGTCCCCGCACCAGGCAGAGCCGTACCTGTCACCCTCCCCAAGCGCCTGCAC CGCGGTGCAAGAGCCCAGCCCAGGGGCGCTGGACGTGACCATCATGTACAAGG GCCGCACGGTGCTGCAGAAGGTGGTGGGACACCCGAGCTGCACGTTCCTATACG GCCCCCCAGACCCAGCTGTCCGGGCCACAGACCCCCAGCAGGTAGCATTCCCCA GCCCTGCCGAGCTCCCGGACCAGAAGCAGCTGCGCTACACGGAGGAACTGCTG CGGCACGTGGCCCCTGGGTTGCACCTGGAGCTTCGGGGGCCACAGCTGTGGGC CCGGCGCATGGGCAAGTGCAAGGTGTACTGGGAGGTGGGCGGACCCCCAGGCT CCGCCAGCCCCTCCACCCCAGCCTGCCTGCTGCCTCGGAACTGTGACACCCCCA TCTTCGACTTCAGAGTCTTCTTCCAAGAGCTGGTGGAATTCCGGGCACGGCAGCG CCGTGGCTCCCCACGCTATACCATCTACCTGGGCTTCGGGCAGGACCTGTCAGC TGGGAGGCCCAAGGAGAAGAGCCTGGTCCTGGTGAAGCTGGAACCCTGGCTGTG CCGAGTGCACCTAGAGGGCACGCAGCGTGAGGGTGTGTCTTCCCTGGATAGCAG CAGCCTCAGCCTCTGCCTGTCCAGCGCCAACAGCCTCTATGACGACATCGAGTG CTTCCTTATGGAGCTGGAGCAGCCCGCCTAG SEQ ID NO: 32: BCL6 polynucleotide sequence. NCBI Reference Sequence: NM_001130845.2. ATGGCCTCGCCGGCTGACAGCTGTATCCAGTTCACCCGCCATGCCAGTGATGTTC TTCTCAACCTTAATCGTCTCCGGAGTCGAGACATCTTGACTGATGTTGTCATTGTT GTGAGCCGTGAGCAGTTTAGAGCCCATAAAACGGTCCTCATGGCCTGCAGTGGC CTGTTCTATAGCATCTTTACAGACCAGTTGAAATGCAACCTTAGTGTGATCAATCTA GATCCTGAGATCAACCCTGAGGGATTCTGCATCCTCCTGGACTTCATGTACACAT P6783PC02 CTCGGCTCAATTTGCGGGAGGGCAACATCATGGCTGTGATGGCCACGGCTATGT ACCTGCAGATGGAGCATGTTGTGGACACTTGCCGGAAGTTTATTAAGGCCAGTGA AGCAGAGATGGTTTCTGCCATCAAGCCTCCTCGTGAAGAGTTCCTCAACAGCCGG ATGCTGATGCCCCAAGACATCATGGCCTATCGGGGTCGTGAGGTGGTGGAGAAC AACCTGCCACTGAGGAGCGCCCCTGGGTGTGAGAGCAGAGCCTTTGCCCCCAGC CTGTACAGTGGCCTGTCCACACCGCCAGCCTCTTATTCCATGTACAGCCACCTCC CTGTCAGCAGCCTCCTCTTCTCCGATGAGGAGTTTCGGGATGTCCGGATGCCTGT GGCCAACCCCTTCCCCAAGGAGCGGGCACTCCCATGTGATAGTGCCAGGCCAGT CCCTGGTGAGTACAGCCGGCCGACTTTGGAGGTGTCCCCCAATGTGTGCCACAG CAATATCTATTCACCCAAGGAAACAATCCCAGAAGAGGCACGAAGTGATATGCAC TACAGTGTGGCTGAGGGCCTCAAACCTGCTGCCCCCTCAGCCCGAAATGCCCCC TACTTCCCTTGTGACAAGGCCAGCAAAGAAGAAGAGAGACCCTCCTCGGAAGATG AGATTGCCCTGCATTTCGAGCCCCCCAATGCACCCCTGAACCGGAAGGGTCTGG TTAGTCCACAGAGCCCCCAGAAATCTGACTGCCAGCCCAACTCGCCCACAGAGTC CTGCAGCAGTAAGAATGCCTGCATCCTCCAGGCTTCTGGCTCCCCTCCAGCCAAG AGCCCCACTGACCCCAAAGCCTGCAACTGGAAGAAATACAAGTTCATCGTGCTCA ACAGCCTCAACCAGAATGCCAAACCAGAGGGGCCTGAGCAGGCTGAGCTGGGCC GCCTTTCCCCACGAGCCTACACGGCCCCACCTGCCTGCCAGCCACCCATGGAGC CTGAGAACCTTGACCTCCAGTCCCCAACCAAGCTGAGTGCCAGCGGGGAGGACT CCACCATCCCACAAGCCAGCCGGCTCAATAACATCGTTAACAGGTCCATGACGGG CTCTCCCCGCAGCAGCAGCGAGAGCCACTCACCACTCTACATGCACCCCCCGAA GTGCACGTCCTGCGGCTCTCAGTCCCCACAGCATGCAGAGATGTGCCTCCACAC CGCTGGCCCCACGTTCCCTGAGGAGATGGGAGAGACCCAGTCTGAGTACTCAGA TTCTAGCTGTGAGAACGGGGCCTTCTTCTGCAATGAGTGTGACTGCCGCTTCTCT GAGGAGGCCTCACTCAAGAGGCACAC GCTGCAGACCCACAGTGACAAACCCTACAAGTGTGACCGCTGCCAGGCCTCCTT CCGCTACAAGGGCAACCTCGCCAGCCACAAGACCGTCCATACCGGTGAGAAACC CTATCGTTGCAACATCTGTGGGGCCCAGTTCAACCGGCCAGCCAACCTGAAAACC CACACTCGAATTCACTCTGGAGAGAAGCCCTACAAATGCGAAACCTGCGGAGCCA GATTTGTACAGGTGGCCCACCTCCGTGCCCATGTGCTTATCCACACTGGTGAGAA GCCCTATCCCTGTGAAATCTGTGGCACCCGTTTCCGGCACCTTCAGACTCTGAAG AGCCACCTGCGAATCCACACAGGAGAGAAACCTTACCATTGTGAGAAGTGTAACC TGCATTTCCGTCACAAAAGCCAGCTGCGACTTCACTTGCGCCAGAAGCATGGCGC CATCACCAACACCAAGGTGCAATACCGCGTGTCAGCCACTGACCTGCCTCCGGA GCTCCCCAAAGCCTGCTGA P6783PC02 SEQ ID NO: 33: TBX21 polynucleotide sequence. NCBI Reference Sequence: NM_013351.2. ATGGGCATCGTGGAGCCGGGTTGCGGAGACATGCTGACGGGCACCGAGCCGAT GCCGGGGAGCGACGAGGGCCGGGCGCCTGGCGCCGACCCGCAGCACCGCTAC TTCTACCCGGAGCCGGGCGCGCAGGACGCGGACGAGCGTCGCGGGGGCGGCA GCCTGGGGTCTCCCTACCCGGGGGGCGCCTTGGTGCCCGCCCCGCCGAGCCGC TTCCTTGGAGCCTACGCCTACCCGCCGCGACCCCAGGCGGCCGGCTTCCCCGG CGCGGGCGAGTCCTTCCCGCCGCCCGCGGACGCCGAGGGCTACCAGCCGGGC GAGGGCTACGCCGCCCCGGACCCGCGCGCCGGGCTCTACCCGGGGCCGCGTG AGGACTACGCGCTACCCGCGGGACTGGAGGTGTCGGGGAAACTGAGGGTCGCG CTCAACAACCACCTGTTGTGGTCCAAGTTTAATCAGCACCAGACAGAGATGATCAT CACCAAGCAGGGACGGCGGATGTTCCCATTCCTGTCATTTACTGTGGCCGGGCT GGAGCCCACCAGCCACTACAGGATGTTTGTGGACGTGGTCTTGGTGGACCAGCA CCACTGGCGGTACCAGAGCGGCAAGTGGGTGCAGTGTGGAAAGGCCGAGGGCA GCATGCCAGGAAACCGCCTGTACGTCCACCCGGACTCCCCCAACACAGGAGCGC ACTGGATGCGCCAGGAAGTTTCATTTGGGAAACTAAAGCTCACAAACAACAAGGG GGCGTCCAACAATGTGACCCAGATGATTGTGCTCCAGTCCCTCCATAAGTACCAG CCCCGGCTGCATATCGTTGAGGTGAACGACGGAGAGCCAGAGGCAGCCTGCAAC GCTTCCAACACGCATATCTTTACTTTCCAAGAAACCCAGTTCATTGCCGTGACTGC CTACCAGAATGCCGAGATTACTCAGCTGAAAATTGATAATAACCCCTTTGCCAAAG GATTCCGGGAGAACTTTGAGTCCATGTACACATCTGTTGACACCAGCATCCCCTC CCCGCCTGGACCCAACTGTCAATTCCTTGGGGGAGATCACTACTCTCCTCTCCTA CCCAACCAGTATCCTGTTCCCAGCCGCTTCTACCCCGACCTTCCTGGCCAGGCGA AGGATGTGGTTCCCCAGGCTTACTGGCTGGGGGCCCCCCGGGACCACAGCTATG AGGCTGAGTTTCGAGCAGTCAGCATGAAGCCTGCATTCTTGCCCTCTGCCCCTGG GCCCACCATGTCCTACTACCGAGGCCAGGAGGTCCTGGCACCTGGAGCTGGCTG GCCTGTGGCACCCCAGTACCCTCCCAAGATGGGCCCGGCCAGCTGGTTCCGCCC TATGCGGACTCTGCCCATGGAACCCGGCCCTGGAGGCTCAGAGGGACGGGGAC CAGAGGACCAGGGTCCCCCCTTGGTGTGGACTGAGATTGCCCCCATCCGGCCGG AATCCAGTGATTCAGGACTGGGCGAAGGAGACTCTAAGAGGAGGCGCGTGTCCC CCTATCCTTCCAGTGGTGACAGCTCCTCCCCTGCTGGGGCCCCTTCTCCTTTTGA TAAGGAAGCTGAAGGACAGTTTTATAACTATTTTCCCAACTGA P6783PC02 SEQ ID NO: 34: ARID3A polynucleotide sequence. NCBI Reference Sequence: NM_005224.3. ATGAAACTACAGGCCGTGATGGAGACGCTGTTGCAGCGGCAGCAGCGGGCGCG CCAGGAGCTGGAGGCCCGGCAGCAGCTGCCCCCCGATCCCCCTGCTGCACCCC CCGGCCGGGCCCGGGCTGCCCCCGACGAGGACAGAGAGCCCGAGAGTGCCCG GATGCAGCGGGCTCAGATGGCCGCACTGGCAGCCATGCGGGCTGCAGCTGCG GGCCTGGGACACCCAGCCAGCCCCGGCGGCTCTGAGGATGGGCCCCCAGGCTC GGAGGAGGAGGACGCGGCCCGGGAGGGGACACCGGGCTCACCCGGGCGAGGC AGAGAAGGGCCAGGAGAGGAGCACTTTGAGGACATGGCCTCCGACGAGGACATG AAGCCCAAATGGGAGGAGGAGGAGATGGAGGAAGACCTCGGGGAGGATGAGGA GGAGGAGGAGGAGGATTACGAGGATGAGGAGGAGGAGGAGGACGAGGAGGGG CTGGGCCCCCCAGGCCCTGCCAGCTTGGGCACCACGGCACTGTTCCCCCGAAAG GCCCAGCCACCCCAGGCCTTCCGCGGCGATGGCGTTCCCAGGGTGCTGGGGGG CCAGGAGCGGCCGGGGCCTGGCCCTGCCCACCCCGGAGGGGCCGCCCACGTA GCCCCGCAGCTGCAGCCGCCTGACCACGGCGACTGGACTTACGAGGAGCAGTTT AAGCAGCTCTACGAACTCGACGGGGACCCCAAGAGGAAGGAATTCCTGGATGAC TTGTTCAGCTTCATGCAGAAGCGAGGGACACCTGTGAACCGCATCCCCATCATGG CCAAACAGGTCCTTGACCTGTTCATGCTGTACGTGCTGGTGACGGAGAAGGGCG GCCTCGTGGAGGTCATCAACAAGAAGCTGTGGCGTGAGATCACCAAGGGCCTCA ACCTGCCCACGTCCATCACCAGTGCAGCCTTCACCCTGCGGACCCAATACATGAA GTACCTGTACCCCTACGAGTGTGAGAAGCGGGGCCTCAGTAACCCCAATGAGCT CCAGGCAGCCATAGACAGCAACCGACGGGAGGGCCGGCGCCAGAGCTTTGGTG GCTCCCTCTTTGCCTACTCGCCAGGCGGGGCACACGGCATGCTCTCCTCACCCA AGCTACCCGTGTCCTCCCTGGGCCTGGCCGCAAGCACCAATGGCAGCTCCATCA CCCCCGCCCCTAAGATCAAGAAAGAGGAGGACTCAGCCATCCCCATCACAGTCC CTGGCCGCCTGCCTGTGTCCCTGGCGGGCCACCCTGTGGTGGCAGCCCAGGCA GCAGCTGTGCAAGCAGCAGCCGCCCAAGCAGCTGTGGCCGCACAGGCAGCTGC CCTGGAACAGCTGCGGGAGAAGCTGGAGTCTGCAGAGCCTCCGGAGAAGAAGAT GGCCCTGGTGGCCGATGAGCAGCAACGGCTGATGCAACGTGCACTCCAGCAGAA CTTCCTGGCCATGGCGGCCCAGCTGCCCATGAGCATTCGGATCAACAGCCAAGC CTCCGAAAGCCGCCAGGACTCTGCTGTGAACCTGACGGGCACCAACGGCAGCAA CAGCATCAGCATGTCGGTGGAGATCAACGGCATCATGTACACAGGAGTTCTGTTT GCTCAGCCGCCGGCCCCCACGCCAACCTCTGCTCCCAACAAAGGAGGCGGCGG CGGCGGCGGCAGCAGCAGCAACGCAGGCGGCCGGGGAGGAAACACCGGAACC P6783PC02 AGCGGCGGCCAGGCTGGGCCAGCGGGGCTGTCCACACCCTCCACATCTACCTCA AATAACTCGTTGCCTTAA SEQ ID NO: 35: IKZF2 polynucleotide sequence. NCBI Reference Sequence: NM_016260.3. ATGGAAACAGAGGCTATTGATGGCTATATAACGTGTGACAATGAGCTTTCACCCG AAAGGGAGCACTCCAATATGGCAATTGACCTCACCTCAAGCACACCCAATGGACA GCATGCCTCACCAAGTCACATGACAAGCACAAATTCAGTAAAGCTAGAAATGCAG AGTGATGAAGAGTGTGACAGGAAACCCCTGAGCCGTGAAGATGAGATCAGGGGC CATGATGAGGGTAGCAGCCTAGAAGAACCCCTAATTGAGAGCAGCGAGGTGGCT GACAACAGGAAAGTCCAGGAGCTTCAAGGCGAGGGAGGAATCCGGCTTCCGAAT GGTAAACTGAAATGTGACGTCTGTGGCATGGTTTGCATTGGGCCCAATGTGCTTA TGGTACATAAAAGGAGTCACACTGGTGAACGCCCCTTCCACTGTAACCAGTGTGG AGCTTCTTTTACTCAGAAGGGCAACCTTCTGAGACACATAAAGTTACACTCTGGAG AGAAGCCGTTCAAATGTCCTTTCTGTAGCTACGCCTGTAGAAGAAGGGACGCCCT CACAGGACACCTCAGGACCCATTCTGTGGGTAAACCTCACAAGTGCAACTACTGT GGACGAAGCTACAAGCAGCGCAGTTCACTGGAGGAGCACAAGGAACGCTGCCAC AACTATCTCCAGAATGTCAGCATGGAGGCTGCTGGGCAGGTCATGAGTCACCATG TACCTCCTATGGAAGATTGTAAGGAACAAGAGCCTATTATGGACAACAATATTTCT CTGGTGCCTTTTGAGAGACCTGCTGTCATAGAGAAGCTCACGGGGAATATGGGAA AACGTAAAAGCTCCACTCCACAAAAGTTTGTGGGGGAAAAGCTCATGCGATTCAG CTACCCAGATATTCACTTTGATATGAACTTAACATATGAGAAGGAGGCTGAGCTGA TGCAGTCTCATATGATGGACCAAGCCATCAACAATGCAATCACCTACCTTGGAGCT GAGGCCCTTCACCCTCTGATGCAGCACCCGCCAAGCACAATCGCTGAAGTGGCC CCAGTTATAAGCTCAGCTTATTCTCAGGTCTATCATCCAAATAGGATAGAAAGACC CATTAGCAGGGAAACTGCTGATAGTCATGAAAACAACATGGATGGCCCCATCTCT CTCATCAGACCAAAGAGTCGACCCCAGGAAAGAGA GGCCTCTCCCAGCAATAGCTGCCTGGATTCCACTGACTCAGAAAGCAGCCATGAT GACCACCAGTCCTACCAAGGACACCCTGCCTTAAATCCCAAGAGGAAACAAAGCC CAGCTTACATGAAGGAGGATGTCAAAGCTTTGGATACTACCAAGGCTCCTAAGGG CTCTCTGAAGGACATCTACAAGGTCTTCAATGGAGAAGGAGAACAGATTAGGGCC TTCAAGTGTGAGCACTGCCGAGTCCTTTTCCTAGACCATGTCATGTACACCATTCA CATGGGTTGCCATGGCTACCGGGACCCACTGGAATGCAACATCTGTGGCTACAG AAGCCAGGACCGTTATGAGTTTTCATCACACATTGTTCGAGGGGAGCACACATTC CACTAG P6783PC02 SEQ ID NO: 36: RUNX3 polynucleotide sequence. NCBI Reference Sequence: NM_001031680.2. ATGGCATCGAACAGCATCTTCGACTCCTTCCCGACCTACTCGCCGACCTTCATCC GCGACCCAAGCACCAGCCGCCGCTTCACACCTCCCTCCCCGGCCTTCCCCTGCG GCGGCGGCGGCGGCAAGATGGGCGAGAACAGCGGCGCGCTGAGCGCGCAGGC GGCCGTGGGGCCCGGAGGGCGCGCCCGGCCCGAGGTGCGCTCGATGGTGGAC GTGCTGGCGGACCACGCAGGCGAGCTCGTGCGCACCGACAGCCCCAACTTCCTC TGCTCCGTGCTGCCCTCGCACTGGCGCTGCAACAAGACGCTGCCCGTCGCCTTC AAGGTGGTGGCATTGGGGGACGTGCCGGATGGTACGGTGGTGACTGTGATGGCA GGCAATGACGAGAACTACTCCGCTGAGCTGCGCAATGCCTCGGCCGTCATGAAG AACCAGGTGGCCAGGTTCAACGACCTTCGCTTCGTGGGCCGCAGTGGGCGAGG GAAGAGTTTCACCCTGACCATCACTGTGTTCACCAACCCCACCCAAGTGGCGACC TACCACCGAGCCATCAAGGTGACCGTGGACGGACCCCGGGAGCCCAGACGGCA CCGGCAGAAGCTGGAGGACCAGACCAAGCCGTTCCCTGACCGCTTTGGGGACCT GGAACGGCTGCGCATGCGGGTGACACCGAGCACACCCAGCCCCCGAGGCTCAC TCAGCACCACAAGCCACTTCAGCAGCCAGCCCCAGACCCCAATCCAAGGCACCT CGGAACTGAACCCATTCTCCGACCCCCGCCAGTTTGACCGCTCCTTCCCCACGCT GCCAACCCTCACGGAGAGCCGCTTCCCAGACCCCAGGATGCATTATCCCGGGGC CATGTCAGCTGCCTTCCCCTACAGCGCCACGCCCTCGGGCACGAGCATCAGCAG CCTCAGCGTGGCGGGCATGCCGGCCACCAGCCGCTTCCACCATACCTACCTCCC GCCACCCTACCCGGGGGCCCCGCAGAACCAGAGCGGGCCCTTCCAGGCCAACC CGTCCCCCTACCACCTCTACTACGGGACATCCTCTGGCTCCTACCAGTTCTCCAT GGTGGCCGGCAGCAGCAGTGGGGGCGACCGCTCACCTACCCGCATGCTGGCCT CTTGCACCAGCAGCGCTGCCTCTGTCGCCGCCGGCAACCTCATGAACCCCAGCC TGGGCGGCCAGAGTGATGGCGTGGAGGCCGACGGCAGCCACAGCAACTCACCC ACGGCCCTGAGCACGCCAGGCCGCATGGATGAGGCCGTGTGGCGGCCCTACTG A SEQ ID NO: 37: NFKBIA polynucleotide sequence. NCBI Reference Sequence: NM_020529.3. ATGTTCCAGGCGGCCGAGCGCCCCCAGGAGTGGGCCATGGAGGGCCCCCGCGA CGGGCTGAAGAAGGAGCGGCTACTGGACGACCGCCACGACAGCGGCCTGGACT CCATGAAAGACGAGGAGTACGAGCAGATGGTCAAGGAGCTGCAGGAGATCCGCC TCGAGCCGCAGGAGGTGCCGCGCGGCTCGGAGCCCTGGAAGCAGCAGCTC P6783PC02 ACCGAGGACGGGGACTCGTTCCTGCACTTGGCCATCATCCATGAAGAAAAGGCA CTGACCATGGAAGTGATCCGCCAGGTGAAGGGAGACCTGGCCTTCCTCAACTTC CAGAACAACCTGCAGCAGACTCCACTCCACTTGGCTGTGATCACCAACCAGCCAG AAATTGCTGAGGCACTTCTGGGAGCTGGCTGTGATCCTGAGCTCCGAGACTTTCG AGGAAATACCCCCCTACACCTTGCCTGTGAGCAGGGCTGCCTGGCCAGCGTGGG AGTCCTGACTCAGTCCTGCACCACCCCGCACCTCCACTCCATCCTGAAGGCTACC AACTACAATGGCCACACGTGTCTACACTTAGCCTCTATCCATGGCTACCTGGGCA TCGTGGAGCTTTTGGTGTCCTTGGGTGCTGATGTCAATGCTCAGGAGCCCTGTAA TGGCCGGACTGCCCTTCACCTCGCAGTGGACCTGCAAAATCCTGACCTGGTGT CACTCCTGTTGAAGTGTGGGGCTGATGTCAACAGAGTTACCTACCAGGGCTATTC TCCCTACCAGCTCACCTGGGGCCGCCCAAGCACCCGGATACAGCAGCAGCTGGG CCAGCTGACACTAGAAAACCTTCAGATGCTGCCAGAGAGTGAGGATGAGGAGAG CTATGACACAGAGTCAGAGTTCACGGAGTTCACAGAGGACGAGCTGCCCTATGAT GACTGTGTGTTTGGAGGCCAGCGTCTGACGTTATGA SEQ ID NO: 38: NFKBIB polynucleotide sequence. NCBI Reference Sequence: NM_002503.5. ATGGCTGGGGTCGCGTGCTTGGGAAAAGCTGCCGACGCAGATGAATGGTGCGAC AGCGGCCTGGGCTCCCTGGGTCCGGACGCAGCGGCCCCCGGAGGACCTGGGTT GGGCGCGGAGTTGGGCCCGGGGCTGTCGTGGGCTCCCCTCGTCTTCGGCTACG TCACTGAGGATGGGGACACGGCACTGCACTTGGCTGTGATTCATCAGCATGAACC CTTCCTGGATTTTCTTCTAGGCTTCTCGGCCGGCACTGAGTACATGGACCTGCAG AATGACCTAGGCCAGACAGCCCTGCACCTGGCAGCCATCCTGGGGGAGACATCC ACGGTGGAGAAGCTGTACGCAGCAGGCGCCGGGCTGTGTGTGGCGGAGCGTAG GGGCCACACGGCGCTGCACCTGGCCTGCCGTGTGGGGGCACACGCCTGTGCCC GTGCCCTGCTTCAGCCCCGCCCCCGGCGCCCCAGGGAAGCCCCCGACACCTAC CTCGCTCAGGGCCCTGACCGTACTCCCGACACCAACCATACCCCTGTCGCCTTGT ACCCCGATTCCGACTTGGAGAAGGAAGAAGAGGAGAGTGAGGAGGACTGGAAGC TGCAGCTGGAGGCTGAAAACTACGAGGGCCACACCCCACTCCACGTGGCCGTTA TCCACAAAGATGTGGAGATGGTCCGGCTGCTCCGAGATGCTGGAGCTGACCTTG ACAAACCGGAGCCCACGTGCGGCCGGAGCCCCCTTCATTTGGCAGTGGAGGCCC AGGCAGCCGATGTGCTGGAGCTTCTCCTGAGGGCAGGCGCGAACCCTGCTGCCC GCATGTACGGTGGCCGCACCCCACTCGGCAGTGCCATGCTCCGGCCCAACCCCA TCCTCGCCCGCCTCCTCCGTGCACACGGAGCCCCTGAGCCCGAGGGCGAGGAC GAGAAATCCGGCCCCTGCAGCAGCAGTAGCGACAGCGACAGCGGAGACGAGGG P6783PC02 CGATGAATACGACGACATTGTGGTTCACAGCAGCCGCAGCCAAACCCGGCTGCC TCCCACCCCAGCCTCAAAACCTCTTCCTGACGACCCCCGCCCCGTGTGA SEQ ID NO: 39SFFV promoter – polynucleotide sequenceCTGCAGCCCCGATAAAATAAAAGATTTTATTTAGTCTCCAGAAAAAGGGGGGAATG AAAGACCCCACCTGTAGGTTTGGCAAGCTAGCTGCAGTAACGCCATTTTGCAAGG CATGGAAAAATACCAAACCAAGAATAGAGAAGTTCAGATCAAGGGCGGGTACATG AAAATAGCTAACGTTGGGCCAAACAGGATATCTGCGGTGAGCAGTTTCGGCCCCG GCCCGGGGCCAAGAACAGATGGTCACCGCAGTTTCGGCCCCGGCCCGAGGCCA AGAACAGATGGTCCCCAGATATGGCCCAACCCTCAGCAGTTTCTTAAGACCCATC AGATGTTTCCAGGCTCCCCCAAGGACCTGAAATGACCCTGCGCCTTATTTGAATTA ACCAATCAGCCTGCTTCTCGCTTCTGTTCGCGCGCTTCTGCTTCCCGAGCTCTATA AAAGAGCTCACAACCCCTCACTCGGCGCGCCAGTCCTCCGACAGACTGAGTCGC CCGGG SEQ ID NO: 40PU.1 – polypeptide sequenceMLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH HVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVS YLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKK KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTY QKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH SEQ ID NO: 41IRF8 – polypeptide sequenceMCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIF KAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVP EEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRS QLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGC RLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQ GVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRL PDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPP PDQVFRMFPDICASHQRSFFRENQQITV P6783PC02 SEQ ID NO: 42BATF3 – polypeptide sequenceMSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRK KQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFV PVPPRPDPVAGCLPR SEQ ID NO: 43IRF8 – polynucleotide sequenceATGTGTGACCGGAATGGTGGTCGGCGGCTTCGACAGTGGCTGATCGAGCAGATT GACAGTAGCATGTATCCAGGACTGATTTGGGAGAATGAGGAGAAGAGCATGTTCC GGATCCCTTGGAAACACGCTGGCAAGCAAGATTATAATCAGGAAGTGGATGCCTC CATTTTTAAGGCCTGGGCAGTTTTTAAAGGGAAGTTTAAAGAAGGGGACAAAGCT GAACCAGCCACTTGGAAGACGAGGTTACGCTGTGCTTTGAATAAGAGCCCAGATT TTGAGGAAGTGACGGACCGGTCCCAACTGGACATTTCCGAGCCATACAAAGTTTA CCGAATTGTTCCTGAGGAAGAGCAAAAATGCAAACTAGGCGTGGCAACTGCTGGC TGCGTGAATGAAGTTACAGAGATGGAGTGCGGTCGCTCTGAAATCGACGAGCTGA TCAAGGAGCCTTCTGTGGACGATTACATGGGGATGATCAAAAGGAGCCCTTCCCC GCCGGAGGCCTGTCGGAGTCAGCTCCTTCCAGACTGGTGGGCGCAGCAGCCCA GCACAGGCGTGCCGCTGGTGACGGGGTACACCACCTACGACGCGCACCATTCAG CATTCTCCCAGATGGTGATCAGCTTCTACTATGGGGGCAAGCTGGTGGGCCAGG CCACCACCACCTGCCCCGAGGGCTGCCGCCTGTCCCTGAGCCAGCCTGGGCTG CCCGGCACCAAGCTGTATGGGCCCGAGGGCCTGGAGCTGGTGCGCTTCCCGCC GGCCGACGCCATCCCCAGCGAGCGACAGAGGCAGGTGACGCGGAAGCTGTTCG GGCACCTGGAGCGCGGGGTGCTGCTGCACAGCAGCCGGCAGGGCGTGTTCGTC AAGCGGCTGTGCCAGGGCCGCGTGTTCTGCAGCGGCAACGCCGTGGTGTGCAA AGGCAGGCCCAACAAGCTGGAGCGTGATGAGGTGGTCCAGGTCTTCGACACCAG CCAGTTCTTCCGAGAGCTGCAGCAGTTCTATAACAGCCAGGGCCGGCTTCCTGAC GGCAGGGTGGTGCTGTGCTTTGGGGAAGAGTTTCCGGATATGGCCCCCTTGCGC TCCAAACTCATTCTCGTGCAGATTGAGCAGCTGTATGTCCGGCAACTGGCAGAAG AGGCTGGGAAGAGCTGTGGAGCCGGCTCTGTGATGCAGGCCCCCGAGGAGCCG CCGCCAGACCAGGTCTTCCGGATGTTTCCAGATATTTGTGCCTCACACCAGAGAT CATTTTTCAGAGAAAACCAACAGATCACCGTC SEQ ID NO: 44PU.1 – polynucleotide sequence P6783PC02 ATGTTACAGGCGTGCAAAATGGAAGGGTTTCCCCTCGTCCCCCCTCCATCAGAAG ACCTGGTGCCCTATGACACGGATCTATACCAACGCCAAACGCACGAGTATTACCC CTATCTCAGCAGTGATGGGGAGAGCCATAGCGACCATTACTGGGACTTCCACCCC CACCACGTGCACAGCGAGTTCGAGAGCTTCGCCGAGAACAACTTCACGGAGCTC CAGAGCGTGCAGCCCCCGCAGCTGCAGCAGCTCTACCGCCACATGGAGCTGGA GCAGATGCACGTCCTCGATACCCCCATGGTGCCACCCCATCCCAGTCTTGGCCA CCAGGTCTCCTACCTGCCCCGGATGTGCCTCCAGTACCCATCCCTGTCCCCAGC CCAGCCCAGCTCAGATGAGGAGGAGGGCGAGCGGCAGAGCCCCCCACTGGAGG TGTCTGACGGCGAGGCGGATGGCCTGGAGCCCGGGCCTGGGCTCCTGCCTGGG GAGACAGGCAGCAAGAAGAAGATCCGCCTGTACCAGTTCCTGTTGGACCTGCTC CGCAGCGGCGACATGAAGGACAGCATCTGGTGGGTGGACAAGGACAAGGGCAC CTTCCAGTTCTCGTCCAAGCACAAGGAGGCGCTGGCGCACCGCTGGGGCATCCA GAAGGGCAACCGCAAGAAGATGACCTACCAGAAGATGGCGCGCGCGCTGCGCAA CTACGGCAAGACGGGCGAGGTCAAGAAGGTGAAGAAGAAGCTCACCTACCAGTT CAGCGGCGAAGTGCTGGGACGCGGGGGCCTGGCCGAGCGGCGCCACCCGCCC CAC SEQ ID NO: 45BATF3 – polynucleotide sequenceATGTCGCAAGGGCTCCCGGCCGCCGGCAGCGTCCTGCAGAGGAGCGTCGCGGC GCCCGGGAACCAGCCGCAGCCGCAGCCGCAGCAGCAGAGCCCTGAGGATGATG ACAGGAAGGTCCGAAGGAGAGAAAAAAACCGAGTTGCTGCTCAGAGAAGTCGGA AGAAGCAGACCCAGAAGGCTGACAAGCTCCATGAGGAATATGAGAGCCTGGAGC AAGAAAACACCATGCTGCGGAGAGAGATCGGGAAGCTGACAGAGGAGCTGAAGC ACCTGACAGAGGCACTGAAGGAGCACGAGAAGATGTGCCCGCTGCTGCTCTGCC CTATGAACTTTGTGCCAGTGCCTCCCCGGCCGGACCCTGTGGCCGGCTGCTTGC CCCGA SEQ ID NO: 46 Barcode 6bp motif upstream TGTACA SEQ ID NO: 47 Barcode 6bp motif downstream AGCGCT P6783PC02 ReferencesAlsinet et al. (2022). Robust temporal map of human in vitro myelopoiesis using single-cell genomics. Nat Commun 13, 2885. https: / / doi.org / 10.1038 / s41467-022-30557-4.Ascic et al. (2024). In vivo dendritic cell reprogramming for cancer immunotherapy.Science 386, eadn9083. https: / / doi.org / 10.1126 / science.adn9083.Cabeza-Cabrerizo et al. (2021). Dendritic Cells Revisited. Annu. Rev. Immunol.39,131–166. https: / / doi.org / 10.1146 / annurev-immunol-061020-053707.D’Alessio et al. (2015). A Systematic Approach to Identify Candidate TranscriptionFactors that Control Cell Identity. Stem Cell Reports 5, 763–775.https: / / doi.org / 10.1016 / j.stemcr.2015.09.016.Domínguez Conde et al. (2022). Cross-tissue immune cell analysis reveals tissue-specific features in humans. Science 376, eabl5197.https: / / doi.org / 10.1126 / science.abl5197. Duan et al. (2019). Rational Reprogramming of Cellular States by CombinatorialPerturbation. Cell Reports 27, 3486-3499.e6.https: / / doi.org / 10.1016 / j.celrep.2019.05.079. Ferreira, Zimmermannova, Kurochkin, Ascic, Åkerström, Pereira, Reprogramming Mouse and Human Cancer cells to Antigen Presenting Cells. Bio-Protocol.13, e4881 (2023)Fischer et al. (2024). scTab: Scaling cross-tissue single-cell annotation models. NatCommun 15, 6611. https: / / doi.org / 10.1038 / s41467-024-51059-5.Hao et al. (2021). Integrated analysis of multimodal single-cell data. Cell 184, 3573-3587.e29. https: / / doi.org / 10.1016 / j.cell.2021.04.048.Hersbach et al. (2022). Probing cell identity hierarchies by fate titration and collision P6783PC02during direct reprogramming. Molecular Systems Biology 18, e11129.https: / / doi.org / 10.15252 / msb.202211129.Heumos et al. (2023). Best practices for single-cell analysis across modalities. Nat RevGenet 24, 550–572. https: / / doi.org / 10.1038 / s41576-023-00586-w.Joung et al. (2023). A transcription factor atlas of directed differentiation. Cell 186, 209-229.e26. https: / / doi.org / 10.1016 / j.cell.2022.11.026.Jung et al. (2021). A computer-guided design tool to increase the efficiency of cellularconversions. Nat Commun 12, 1659. https: / / doi.org / 10.1038 / s41467-021-21801-4.Kamaraj et al. (2020). EpiMogrify Models H3K4me3 Data to Identify SignalingMolecules that Improve Cell Fate Control and Maintenance. Cell Systems 11, 509-522.e10. https: / / doi.org / 10.1016 / j.cels.2020.09.004. Lambert SA, Jolma A, Campitelli LF, Das PK, Yin Y, Albu M, Chen X, Taipale J, Hughes TR, Weirauch MT.(2018) The Human Transcription Factors. Cell.172(4):650- 665.Linde et al. (2023). Reprogramming Cancer into Antigen-Presenting Cells as a NovelImmunotherapy. Cancer Discovery 13, 1164–1185. https: / / doi.org / 10.1158 / 2159-8290.CD-21-0502.Liu, W., Saelens, W., et al. (2024). Dissecting reprogramming heterogeneity at single-cell resolution using scTF-seq. Preprint, https: / / doi.org / 10.1101 / 2024.01.30.577921Liu et al. (2024). Machine Learning–Directed Conversion of Glioblastoma Cells toDendritic Cell–Like Antigen-Presenting Cells as Cancer Immunotherapy. CancerImmunology Research 12, 1340–1360. https: / / doi.org / 10.1158 / 2326-6066.CIR-23-0721.Maier et al. (2020). A conserved dendritic-cell regulatory program limits antitumourimmunity. Nature 580, 257–262. https: / / doi.org / 10.1038 / s41586-020-2134-y. P6783PC02Meiser et al. (2023). A distinct stimulatory cDC1 subpopulation amplifies CD8+ T cellresponses in tumors for protective anti-cancer immunity. Cancer Cell 41, 1498-1515.e10. https: / / doi.org / 10.1016 / j.ccell.2023.06.008.Morris et al. (2014). Dissecting Engineered Cell Types and Enhancing Cell FateConversion via CellNet. Cell 158, 889–902. https: / / doi.org / 10.1016 / j.cell.2014.07.021.Ng, A.H.M., Khoshakhlagh, P., Rojo Arias, J.E. et al. A comprehensive library of humantranscription factors for cell fate engineering. Nat Biotechnol 39, 510–519 (2021).Parekh et al. (2018). Mapping Cellular Reprogramming via Pooled OverexpressionScreens with Paired Fitness and Single-Cell RNA-Sequencing Readout. CellSystems 7, 548-555.e8. https: / / doi.org / 10.1016 / j.cels.2018.10.008.Pedregosa et al. (2011). Scikit-learn: Machine Learning in Python. J. Mach. Learn.Res.12, 2825–2830. Pereira et al. (2012). Reprogramming cell fates: insights from combinatorialapproaches. Annals of the New York Academy of Sciences 1266, 7–17.https: / / doi.org / 10.1111 / j.1749-6632.2012.06508.x.Pereira et al. (2013). Induction of a Hemogenic Program in Mouse Fibroblasts. CellStem Cell 13, 205–218. https: / / doi.org / 10.1016 / j.stem.2013.05.024.Pires, Rosa, Kurochkin, Pereira, Understanding and Modulating Immunity With CellReprogramming. Front. Immunol.10 (2019).Ribas et al. (2018). Cancer immunotherapy using checkpoint blockade. Science 359,1350–1355. https: / / doi.org / 10.1126 / science.aar4060.Rosa et al. (2018). Direct reprogramming of fibroblasts into antigen-presenting dendriticcells. Sci. Immunol.3, eaau4292. https: / / doi.org / 10.1126 / sciimmunol.aau4292. P6783PC02Rosa et al. (2022). Single-cell transcriptional profiling informs efficient reprogrammingof human somatic cells to cross-presenting dendritic cells. Sci. Immunol.7, eabg5539.https: / / doi.org / 10.1126 / sciimmunol.abg5539.Takahashi et al. (2006). Induction of Pluripotent Stem Cells from Mouse Embryonic andAdult Fibroblast Cultures by Defined Factors. Cell 126, 663–676.https: / / doi.org / 10.1016 / j.cell.2006.07.024.The FANTOM Consortium et al. (2016). A predictive computational framework for directreprogramming between human cell types. Nat Genet 48, 331–335.https: / / doi.org / 10.1038 / ng.3487.Villani et al. (2017). Single-cell RNA-seq reveals new types of human blood dendriticcells, monocytes, and progenitors. Science 356, eaah4573.https: / / doi.org / 10.1126 / science.aah4573.Wang et al. (2021). Direct cell reprogramming: approaches, mechanisms and progress.Nat Rev Mol Cell Biol 22, 410–424. https: / / doi.org / 10.1038 / s41580-021-00335-z.Yin et al. (2021). Dendritic Cell Regulation of T Helper Cells. Annu. Rev. Immunol. 39,759–790. https: / / doi.org / 10.1146 / annurev-immunol-101819-025146.Zimmermannova et al. (2021). Cell Fate Reprogramming in the Era of CancerImmunotherapy. Front. Immunol.12, 714822. https: / / doi.org / 10.3389 / fimmu.2021.714822Zimmermannova et al. (2023). Restoring tumor immunogenicity with dendritic cellreprogramming. Sci. Immunol.8, eadd4817. https: / / doi.org / 10.1126 / sciimmunol.add4817.

Claims

P6783PC02 Claims 1. A composition comprising a combination of transcription factors, wherein saidcombination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;e. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; h. PU.1, KLF4, RBPJ, and TBX21;i. IRF8, and at least one, such as at least 2, such as at least 3, such as atleast 4, of RUNX3, NR4A1, NFIL3, or ETS1; j. IRF8, ETS1, RBPJ and at least one of ZBTB46 or RUNX3and / or k. PU.1 and at least one, such as at least 2, such as at least 3, such as atleast 4, of KLF4, REL, IKZF2, RUNX3, RBPJ, or HHEX, for use in inducing or reprogramming a cell into an immune cell.

2. One or more constructs or vectors encoding a combination of transcriptionfactors wherein said combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1;b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RPBJ;d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6;e. PU.1, KLF4, REL, and, optionally, at least one of IRF7 or BCL6;f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB;g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21, RBPJ,ETS1, or ARID3A; h. PU.1, KLF4, RBPJ, and TBX21;P6783PC02 i. IRF8, and at least one, such as at least 2, such as at least 3, such as atleast 4, of RUNX3, NR4A1, NFIL3, or ETS1; j. IRF8, ETS1, RBPJ and at least one of ZBTB46 or RUNX3and / or k. PU.1 and at least one, such as at least 2, such as at least 3, such as atleast 4, of KLF4, REL, IKZF2, RUNX3, RBPJ, or HHEX.

3. The composition or the one or more constructs or vectors according to any oneof the preceding claims, wherein the transcription factors individually are at least 90%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% identical to the polypeptide sequences selected from the group consisting of: a. PU.1 of SEQ ID NO: 1;b. IRF8 of SEQ ID NO: 2;c. BATF3 of SEQ ID NO: 3;d. KLF4 of SEQ ID NO: 4;e. REL of SEQ ID NO: 5,f. ID2 of SEQ ID NO: 6;g. MXD1 of SEQ ID NO: 7;h. NR4A1 of SEQ ID NO: 8;i. RBPJ of SEQ ID NO: 9;j. HHEX of SEQ ID NO: 10;k. ETS1 of SEQ ID NO: 11;l. IRF7 of SEQ ID NO: 12;m. BCL6 of SEQ ID NO: 13;n. TBX21 of SEQ ID NO: 14;o. ARID3A of SEQ ID NO: 15;p. IKZF2 of SEQ ID NO: 16;q. RUNX3 of SEQ ID NO: 17;r. NFKBIA of SEQ ID NO: 18;and / or s. NFKBIB of SEQ ID NO: 19, or biologically active variantsthereof.P6783PC024. The composition or the one or more constructs or vectors according to any oneof the preceding claims, further comprising or encoding one or more nucleic acid elements selected from the group consisting of: short hairpin RNA (shRNA), small interfering RNA (siRNA), antisense oligonucleotides, ribozymes, microRNA (miRNA) mimics, CRISPR-associated systems such as CRISPR interference (CRISPRi), wherein the one or more nucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4, RBPJ, RUNX3, and HHEX.

5. The composition or the one or more constructs or vectors encoding acombination of transcription factors according to any one of the preceding claims, wherein said combination comprises or consists of: a. PU.1, IRF8, BATF3, and at least one of ID2 or MXD1, wherein theimmune cell is an immunostimulatory cDC1; b. PU.1, IRF8, BATF3, and at least one, such as at least 2, of NR4A1,RBPJ, HHEX, or ETS1, wherein the immune cell is an “improved” cDC1, and, optionally, wherein the one or more elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ; c. PU.1, BATF3, NR4A1, and at least one of HHEX or RBPJ, wherein theimmune cell is an “improved” cDC1, and, optionally, wherein the one or more elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ; d. PU.1, IRF8, BATF3, and at least one of IRF7 or BCL6, wherein theimmune cell is a migratory cDC1; e. PU.1, KLF4, REL, optionally with at least one of IRF7 or BCL6, whereinthe immune cell is a migratory regulatory dendritic cell; f. PU.1, IRF8, BATF3, and at least one of NFKBIA or NFKBIB, whereinthe immune cell is an immature cDC1; g. PU.1, IRF8, and at least one, such as at least 2, of KLF4, TBX21,RBPJ, ETS1, or ARID3A, wherein the immune cell is a cDC2 or a myeloid cell such as a macrophage; h. PU.1, KLF4, RBPJ, and TBX21, wherein the immune cell is a cDC2;P6783PC02 i. IRF8, ETS1, and optionally at least one, such as at least 2, of RBPJ,ZBTB46, NR4A1, NFIL3 or RUNX3, wherein the immune cell is a pDC; j. PU.1, KLF4, and IKZF2, wherein the immune cell is a lymphoid cellsuch as a NK cell; and / or k. PU.1, RBPJ, and RUNX3 wherein the immune cell is a lymphoid cellsuch as a NK cell.

6. A host cell comprising the composition or the one or more constructs or vectorsaccording to any one of the preceding claims.

7. Use of the composition or the one or more constructs or vectors according toany one of the preceding claims to induce or reprogram cells into immune cells.

8. A method for reprogramming or inducing a cell into an immune cell, comprisingthe step of: a. transducing a cell with the one or more constructs or vectors accordingto any one of the preceding claims, or b. contacting a cell with the composition according to any one of thepreceding claims.

9. The method according to claim 8, wherein said method is an in-vitro method.

10. The one or more constructs or vectors, the composition, the host cell, the use,or the method, according to any one of the preceding claims, wherein the cell is astem cell or differentiated cell, such as a fibroblast or a cancer cell, ormixtures thereof.

11. An immune cell obtained by the method according to any one of claims 8 to 9.

12. The composition, the one or more constructs or vectors, the host cell, the use,the method, or the immune cell according to any one of the preceding claims, wherein the immune cell is a dendritic cell, such as a mature dendritic cell or an immature dendritic cell, and, optionally, wherein the one or more nucleic acidP6783PC02 elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL, IKZF2, KLF4 and RBPJ, preferably wherein the one or more nucleic acid elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: REL and IKZF2.

13. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding claims, wherein the immune cell is of the myeloid lineage, such as a dendritic cell, a monocyte or a macrophage, or of the lymphoid lineage, such as a NK cell.

14. The one or more constructs or vectors, the composition, the host cell, themethod, the use, or the immune cell according to any one of the preceding claims, wherein the immune cell is: a. a type 1 conventional dendritic cell (cDC1) and, optionally, wherein theone or more elements are configured to downregulate the expression of one or more target genes selected from the group consisting of: KLF4 and RBPJ; b. an immunostimulatory cDC1 cell.c. an “improved” cDC1 cell, preferably wherein said cell has improvedphenotypic (e.g., higher expression of cDC1 surface markers including but not restricted to CD45, HLA-DR and CD40), transcriptional (e.g., higher expression of distinct DC gene signatures including but not restricted to migratory cDC1, migratory regulatory cDC1, mature cDC1 and immature cDC1 gene signatures) and / or functional features, including but not restricted to migratory capacity towards chemokine (e.g., CCL19, CCL21, XCL1) gradients, antigen-presentation, effector T cell activation and / or regulatory T cell activation, compared to cDC1 cells generated, such as induced or reprogrammed, using the combination PU.1, IRF8, and BATF3 alone (PIB); d. a migratory cDC1 cell;e. a migratory regulatory dendritic cell (mRegDC)f. a type 2 conventional dendritic cell (cDC2).g. a plasmacytoid dendritic cell (pDC).P6783PC02 h. a natural killer cell (NK cell).

15. The one or more constructs or vectors, the composition, or the host cell, or theimmune cell according to any one of the preceding claims, for use in veterinary or human medicine.

16. The one or more constructs or vectors, the composition, the host cell, or theimmune cell according to any one of the preceding claims, for use in the treatment of cancer, such as solid tumor cancers and / or hematological cancers, autoimmune diseases, or infectious diseases.

17. A method of identifying the expression of at least one, such as at least twotranscription factors (TFs) associated with cell reprogramming in a population of host cells, the method comprising: a) generating a library of TFs polynucleotides sequences, wherein eachsequence is tagged with a unique nucleic acid barcode, in one or more vector(s) comprising a backbone comprising a sequence encoding a polyA signal, a post-transcriptional response element (PRE) and a 3’ long terminal repeat sequence (LTR) region, wherein each nucleic acid barcode is located upstream of the sequence encoding the polyA signal and in the region between the PRE and LTR on the vector(s) backbone, preferably wherein the barcode islocated at least 230 bp upstream of the polyA, such as 300bp upstream of the polyA, such as 350bp upstream of the polyA; b) transducing a population of host cells with said one or more vector(s);c) identifying the barcodes present in said transduced cells by single-celltranscriptomics, thereby identifying the TFs acquired by said transduced cells, preferably wherein in the range of 1 to 42 barcodes are identified per cell, such as in the range of 1 to 22 barcodes, such as in the range of 1 to 9 barcodes, such as in the range of 1 to 8 barcodes, such as in the range of 1 to 7 barcodes, such as in the range of 1 to 6, such as in the range of 1 to 5 barcodes, preferably in the range of 2 to 5 barcodes, such as 3 barcodes, such as 4 barcodes;P6783PC02 d) analysing the transcriptional profile of said transduced cells, therebycharacterizing the reprogramming state of said transduced cells; e) correlating the transcriptional profile of each cell analysed in step d)with that of specific natural immune cell types, and with the corresponding TFs acquired by said transduced cells; thereby identifying the expression of the at least one, such as at least two TFs associated with cell reprogramming in the population of host cells.

18. The method according to claim 17, wherein the post- transcriptional responseelement is selected from the group consisting of: a woodchuck hepatitis virus post- transcriptional response element (WPRE), a WPREmut6 sequence, aMason Pfizer monkey transport element (CTE) and the mouse RNA transport element (RTE).

19. The method according to any one of claims 17 to 18, wherein the vector(s)comprise(s) a backbone comprising in sequential order a transcription factor sequence, a woodchuck hepatitis virus post- transcriptional response element(wpre), a nucleic acid barcode sequence, a 3’ long terminal repeat sequence (LTR) and a polyadenylation signal sequence (polyA).

20. The method according to any one of claims 17 to 19, wherein the nucleic acidbarcode comprises an 8bp variable motif flanked by one 6bp motif upstream of the variable motif and one 6bp motif downstream of the variable motif.

21. The method according to claim 20 wherein the 6bp motif upstream consists ofSEQ ID NO 46.

22. The method according to any one of claims 20 to 21, wherein the 6bp motifdownstream consists of SEQ ID NO 47.

23. The method according to any one of claims 17 to 22, wherein the nucleic acidbarcode is located 300bp or 350bp upstream of the polyA.

Images