Processes for the purification of viral particles and formulations thereof
A VSV-G pseudotyped lentivirus formulation with specific buffer, salt, sugar, and protein excipients stabilizes lentiviral vectors for in vivo use, addressing instability during freeze-thaw cycles and maintaining functional titer, thus ensuring safe and effective administration.
Patent Information
- Application Number
- PCT/US2025/039850
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-07-31
- Filing Date
- 2025-07-30
- Publication Date
- 2026-02-05
AI Technical Summary
Existing formulations for lentiviral vectors are inadequate for in vivo administration due to instability during multiple freeze-thaw cycles, leading to viral particle aggregation and loss of functional titer, necessitating a stable formulation with appropriate pH, osmolality, and excipients for safe human use.
A pharmaceutical composition comprising a VSV-G pseudotyped lentivirus with specific buffer, salt, sugar, and protein excipient concentrations, along with a pH range of 6.0 to 8.0, stabilizes the lentiviral vector through multiple freeze-thaw cycles, minimizing aggregation and maintaining functional titer.
The composition effectively stabilizes lentiviral vectors for in vivo use, ensuring minimal aggregation and consistent functional titer throughout processing and storage, enhancing the safety and efficacy of direct in vivo administration.
Smart Images

Figure US2025039850_05022026_PF_FP_ABST
Abstract
Description
PROCESSES FOR THE PURIFICATION OF VIRAL PARTICLES AND FORMULATIONS THEREOFRELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional Application Ser. No. 63 / 677,690 filed July 31, 2024, which is hereby incorporated by reference in its entirety.REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY
[0002] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on July 15, 2025, is named “INH-033WO_SL” and is 302,685 bytes in size.FIELD
[0003] Embodiments provided herein relate to viral vectors, and pharmaceutical compositions comprising the same. Embodiments provided herein also relate to the process of production of viral vectors, involving filtration.BACKGROUND
[0004] The stabilization of purified lentiviral particles physically and functionally requires an optimal formulation composition. Consideration must be given to pH, ionic strength and salt concentration, as well as stabilizing excipients during the processing, freezing, thawing, handling, and storage for optimal shelf-life. Lentiviral vectors have previously been formulated for mostly ex vivo use, which involves a single freeze-thaw cycle. The development of lentiviral vectors for direct in vivo administration that requires two freeze thaw cycles requires a formulation that stabilizes the product throughout this process. This is critical, as in vivo administration requires the use of appropriate formulation excipients that are safe for human administration with optimal pH and osmolality to minimize aggregation of viral particles while maintaining the functional titer. Pharmaceutical compositions comprising viral particles must have a higher ionic strength to minimize viral particle aggregation, and include a stabilizing excipient to preserve functional titer of viral particles through multiple freeze- thaw cycles and potential hold times during processing, after thawing, and prior to dose administration.
[0005] Sterile filtration is typically performed at the end of large biological molecule (protein, monoclonal antibody, viral vector) processing to remove bioburden and produce sterile drug substance. Many sterile filters are available commercially, with variations in pore size, material of construction, surface charge of the membrane, pore morphology, and filter membrane format. Any of the variables could affect recovery of the product of interest across the filter. Loss of product across sterile filtration has been reported for viruses due to physical retention of the product, related to either size and / or charge. Investigation of sterile filter types and feed concentration to maximize recovery of a particular product of interest have been reported.
[0006] The present disclosure addresses these needs and others.BRIEF SUMMARY
[0007] The disclosed embodiments are directed towards viral vectors, specifically comprising a VSV-G polypeptide, and pharmaceutical compositions that contain viruses, and particles thereof, that are specific for VSV-G.
[0008] In some embodiments, a pharmaceutical composition is provided comprising a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0009] In some embodiments, the lentiviral vector is present at a concentration of about 1.0E+05to about l.OE+09transducing units (TUs) / mL.
[0010] In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer.
[0011] In some embodiments, the histidine buffer is present at a concentration of about 10 mM to about 30 mM.
[0012] In some embodiments, the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0013] In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.0.
[0014] In some embodiments, the pharmaceutically acceptable salt is sodium chloride.
[0015] In some embodiments, the sodium chloride is present at a concentration of about150 mM.
[0016] In some embodiments, the sugar is sucrose.
[0017] In some embodiments, the sucrose is present at about 4% (w / v).
[0018] In some embodiments, the protein excipient is non-recombinant human serum albumin-
[0019] In some embodiments, the non-recombinant human serum albumin is present at about 1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.5% (w / v).
[0020] In some embodiments, the lentiviral vector is a VSV-G pseudotyped lentivirus
[0021] In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+05to about 1.0E+09TUs / mL.
[0022] In some embodiments, the VSV-G pseudotyped lentivirus comprises a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
[0023] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus; about 10 mM to about 30 mM of a L-Histidine buffer; about 100 mM to about 200 mM of sodium chloride; about 1% (w / v) to about 5% (w / v) of sucrose; and about 0.1% (w / v) to about 2% (w / v) of a non-recombinant human serum albumin, wherein the pharmaceutical composition has a pH of about 5.5 to about 8.0. In some embodiments, the plant recombinant human serum albumin is Exbumin®.
[0024] In some embodiments, the VSV-G psuedotyped lentivirus is present at a concentration of about 1.0E+05to about 1.0E+09TUs / mL.
[0025] In some embodiments, the L-Histidine is present at a concentration of about 20 mM and the pharmaceutical composition has a pH of about 7.0.
[0026] In some embodiments, sodium chloride is present at a concentration of about 150 mM.
[0027] In some embodiments, sucrose is present at about 4% (w / v).
[0028] In some embodiments, the non-recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1% (w / v).
[0029] In some embodiments, the VSV-G pseudotyped lentivirus comprises a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
[0030] In some embodiments, the VSV-G polypeptide comprises a mutation that corresponds to I182A, I182D or I182E as compared to a sequence of SEQ ID NO: 2.
[0031] In some embodiments, the polypeptide comprises a T214N and / or T352A mutation.
[0032] In some embodiments, the polypeptide comprises substitutions at positions 1182, T214, and T352 of SEQ ID NO: 2.
[0033] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 200 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 2% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0034] In some embodiments, the pseudotyped lentivirus further comprises a targeting moiety comprising an amino acid sequence having at least 90% identity to an amino acid sequence of SEQ ID NO: 89, SEQ ID NO: 90, or SEQ ID NO: 91.
[0035] In some embodiments, the pseudotyped lentivirus further comprises a nucleic acid molecule encoding for a heterologous molecule of interest. In some embodiments, the heterologous molecule of interest is a chimeric antigen receptor (“CAR”). In some embodiments, the CAR comprises an amino acid sequence having at least 90% identity to an amino acid sequence of SEQ ID NO: 120, SEQ ID NO: 121, or SEQ ID NO: 122.
[0036] In some embodiments, a method of purifying a viral vector or a method producing a concentrated sterilized solution are provided, the methods comprising the steps of clarifying a solution comprising cell culture media and the viral vector; filtering the clarified solution comprising the viral vector through a first chromatographic filter to produce a filtered clarified solution comprising the viral vector; passing the filtered clarified solution comprising the viral vector through a protein coated sterile membrane to produce a sterilized solution comprising the viral vector; and concentrating the sterilized solution comprising the viral vector to produce a concentrated sterilized solution comprising the viral vector.
[0037] In some embodiments, a protein solution comprises one or more component selected from a protein, 2-Amino-2-(hydroxymethyl)propane-l,3-diol (TRIS), histidine, phosphate, HEPES ((4-(2-hydroxyethyl)-l -piperazineethanesulfonic acid), sodium chloride, or combinations thereof.
[0038] In some embodiments, the protein solution comprises about 0.1% w / v to about 3.0% w / v of a protein, about 20 mM 2-Amino-2-(hydroxymethyl)propane-l,3-diol (TRIS), and about 100 mM to about 400 mM sodium chloride.
[0039] In some embodiments, the protein coated sterile membrane has a positive charge prior to being coated with a protein.
[0040] In some embodiments, the membrane is selected from a polyethersulfone (PES) membrane, a nylon membrane, or a polyvinylidene fluoride (PVDF) membrane.
[0041] In some embodiments, the method comprises the steps of digesting DNA in a solution comprising the viral vector to produce a first digested solution comprising the viral vector; clarifying the digested solution comprising the viral vector; filtering the clarified, digested solution comprising the viral vector through a first chromatographic filter to produce a filtered, clarified, digested solution comprising the viral vector; digesting DNA in the filtered, clarified, digested solution comprising the viral vector to produce a filtered, clarified, twice- digested solution comprising viral vector; filtering the filtered, clarified, twice-digested solution comprising the viral vector through a second chromatographic filter to produce a twice-filtered, clarified, twice-digested solution comprising viral vector; passing the twice- filtered, clarified, twice-digested solution comprising the viral vector through a protein coated sterile membrane to produce a sterilized solution comprising the viral vector; concentrating the sterilized solution comprising the viral vector to produce a concentrated sterilized solution comprising the viral vector.
[0042] In some embodiments, the protein solution comprises one or more component selected from a protein, 2-Amino-2-(hydroxymethyl)propane-l,3-diol (TRIS), histidine, phosphate, HEPES ((4-(2-hydroxyethyl)-l-piperazineethanesulfonic acid), sodium chloride, or combinations thereof.
[0043] In some embodiments, the protein solution comprises about 0.1% w / v to about 3.0% w / v of a protein, about 20 mM 2-Amino-2-(hydroxymethyl)propane-l ,3-diol (TRIS), about 100 mM to about 400 mM sodium chloride, and a pH of about 6.0 to about 8.0.
[0044] In some embodiments, the protein coated sterile membrane has a positive charge prior to being coated with a protein.
[0045] In some embodiments, the membrane is selected from a polyethersulfone (PES), a nylon membrane, or a polyvinylidene fluoride (PVDF) membrane.BRIEF DESCRIPTION OF THE DRAWINGS
[0046] FIG. 1 illustrates the lentiviral vector process for ex vivo and in vivo use.
[0047] FIG. 2 illustrates the results of a stability assessment of viral vector formulations as provided for herein at various temperatures for up to seven days.
[0048] FIG. 3 illustrates a viral vector production process.
[0049] FIG. 4A and 4B illustrate crystal structures of VSV-G bound to LDL-R. FIG. 4A illustrates the crystal structure of VSV-G bound to CR3 of the LDL-R. FIG. 4B illustrates the crystal structure of VSV-G bound to CR2 of the LDL-R.
[0050] FIG. 5A and 5B illustrate the effect of adding negatively charged amino acids to the VSV-G:LDL-R binding interface on native tropism and fusogenicity. FIG.5A illustrates the titration of VSV-G constructs on SupTl cells. FIG. 5B illustrates functional titer of each construct calculated from the titration in FIG. 5A.
[0051] FIG. 6A, 6B, 6C, and 6D illustrate an alignment of the ectodomains of different VSV-G proteins from different strains. Each of 6A, 6B, 6C, and 6D are portions from the same alignment, broken up into separate figures for ease of visualization.DETAILED DESCRIPTION
[0052] It is to be understood that the embodiments described herein are not limited to particular formulations, compositions and experimental conditions disclosed, as such formulations, compositions, and experimental conditions may vary. It is also to be understood that the terminology used herein is only for the purpose of describing particular embodiments, and it is not intended to be limiting.
[0053] Furthermore, the formulations, compositions, and experimental conditions described herein, unless otherwise indicated, use conventional molecular and cellular biological and immunological techniques known within the skill of the art. Such techniques are well known to the skilled worker, and are explained fully in the literature. See, e.g., Ausubel, et al., ed., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, N.Y. (1987- 2008), including all supplements, Molecular Cloning: A Laboratory Manual (Fourth Edition) by MR Green and J. Sambrook and Harlow et al., Antibodies: A Laboratory Manual, Chapter 14, Cold Spring Harbor Laboratory, Cold Spring Harbor (2013, 2nd edition).
[0054] Unless otherwise defined, scientific and technical terms used herein have the meanings that are commonly understood by those of ordinary skill in the art. In the event of any latent ambiguity, definitions provided herein take precedent over any dictionary or extrinsic definition. Unless otherwise required by context, singular terms shall includepluralities and plural terms shall include the singular. The use of “or” means “and / or” unless stated otherwise. The use of the term “including,” as well as other forms, such as “includes” and “included,” is not limiting.
[0055] Generally, nomenclature used in connection with cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein is well-known and commonly used in the art. The methods and techniques provided herein are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. Enzymatic reactions are performed according to manufacturer’s specifications, as commonly accomplished in the art or as described herein. The nomenclatures used in connection with, and the laboratory procedures and techniques of, analytical chemistry, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well-known and commonly used in the art.
[0056] Unless otherwise required by context, singular terms shall include pluralities, and plural terms shall include the singular.
[0057] That the disclosure may be more readily understood, select terms are defined below.
[0058] As used herein, the terms “a” or “an” means that “at least one” or “one or more” unless the context clearly indicates otherwise.
[0059] As used herein, the term “about” means that the numerical value is approximate and small variations would not significantly affect the practice of the disclosed embodiments. Where a numerical limitation is used, unless indicated otherwise by the context, “about” means the numerical value can vary by ±10% and remain within the scope of the disclosed embodiments. Additionally, where a phrase recites “about x to y,” the term “about” modifies both x and y and can be used interchangeably with the phrase “about x to about y” unless context dictates differently.
[0060] As used herein, the term “individual” or “subject,” or “patient” used interchangeably, means any animal, including mammals, such as mice, rats, other rodents, rabbits, dogs, cats, swine, cattle, sheep, horses, or primates, such as humans.
[0061] As used herein, the terms “comprising” (and any form of comprising, such as “comprise”, “comprises”, and “comprised”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”), or “containing” (and any form of containing, such as “contains” and “contain”), are inclusive oropen-ended and do not exclude additional, unrecited elements or method steps. Any step or composition that uses the transitional phrase of “comprise” or “comprising” can also be said to describe the same with the transitional phase of “consisting of” or “consists.”
[0062] As used herein, the phrase “viral vector recovery” is defined as the amount of viral vector post-filtration compared to the amount of viral vector pre- filtration expressed as a percentage.
[0063] As used herein, the phrase “purified viral vector” is defined as viral vector which has been purified from cell culture harvest using at least one chromatography step.
[0064] As used herein, “non-concentrated” viral vector is a viral vector in a solution that has not undergone a concentration step during its production. As used herein, a “non- concentrated” viral vector does not have a limit on the concentration of viral particles therein, but rather, unless explicitly state otherwise, solely denotes whether a solution comprising a viral vector has undergone a concentration step or not.
[0065] As used herein, the term “contacting” means bringing together of two elements in an in vitro system or an in vivo system. For example, “contacting” virus or vector described herein with an individual or patient or cell includes the administration of the virus to an individual or patient, such as a human, as well as, for example, introducing a compound into a sample containing a cellular or purified preparation containing the cell.
[0066] As used herein, the term “fused” or “linked” when used in reference to a protein having different domains or heterologous sequences means that the protein domains are part of the same peptide chain that are connected to one another with either peptide bonds or other covalent bonding. The domains or section can be linked or fused directly to one another or another domain or peptide sequence can be between the two domains or sequences and such sequences would still be considered to be fused or linked to one another. In some embodiments, the various domains or proteins provided for herein are linked or fused directly to one another or a linker sequences, such as the glycine / serine sequences described herein link the two domains together.
[0067] A “disease” in an animal is a state of health wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal’s health continues to deteriorate. In contrast, a “disorder” in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal’s state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal’s state of health.
[0068] “Effective amount” or “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result or provides a therapeutic or prophylactic benefit. Such results may include, but are not limited to an amount that when administered to a mammal, causes a detectable level of immune cell activation compared to the immune cell activation detected in the absence of the composition. The immune response can be readily assessed by a plethora of art-recognized methods. The skilled artisan would understand that the amount of the composition administered herein varies and can be readily determined based on a number of factors such as the disease or condition being treated, the age and health and physical condition of the mammal being treated, the severity of the disease, the particular compound being administered, and the like.
[0069] “Encoding” refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
[0070] “Expression vector” refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., Sendai viruses, lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide.
[0071] As used herein, the phrase “ex vivo” in reference to a cell being transduced, transfected or transformed ex vivo, refers to a cell being transduced, transfected or transformed outside of the subject, that is with the cells being removed from the subject before such cells are transduced, transfected or transformed.
[0072] “Identity” as used herein refers to the subunit sequence identity between two polymeric molecules such as between two nucleic acid or amino acid molecules, such as,between two polynucleotide or polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid or two nucleic acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage. The identity between two amino acid or two nucleic acid sequences is a direct function of the number of matching or identical positions; e.g., if half of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions (e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical.
[0073] By "substantially identical" is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). In some embodiments, such a sequence is at least 60%, 80% or 85%, or 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison. Other percentages of identity in reference to specific sequences are described herein.
[0074] Sequence identity can be measured / determined using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP / PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and / or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e3 and el 00 indicating a closely related sequence. In some embodiments, sequence identity is determined by using BLAST with the default settings.
[0075] To the extent embodiments provided for herein, include compositions comprising various proteins, these proteins may, in some instances, comprise amino acid sequences that have sequence identity to the amino acid sequences disclosed herein. Therefore, in certain embodiments, depending on the particular sequence, the degree of sequence identity is preferably greater than 50% (e.g. 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) to the SEQ ID NOs disclosed herein. In addition to thesepercentages, other percentages of identity are provided for herein. Identity between polypeptides can be determined by the Smith-Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty - 12 and gap extension penalty = 1. These proteins may, compared to the disclosed proteins, include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain. Genetically -encoded amino acids are generally divided into four families: (1 ) acidic i.e. aspartate, glutamate; (2) basic i.e. lysine, arginine, histidine; (3) non polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e. glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In general, Substitution of single amino acids within these families does not have a major effect on the biological activity. The proteins may have one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to the disclosed protein sequences. The proteins may also include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions (e.g. each of 1, 2, 3, 4 or 5 amino acids) relative to the disclosed protein sequences.
[0076] As used herein, the phrase “in vivo” in reference to a cell being transduced, transfected or transformed in vivo, refers to a cell being transduced, transfected or transformed in the subject without the cells being removed from the subject before such cells are transduced, transfected or transformed.
[0077] “Isolated” means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
[0078] A “lentivirus” as used herein refers to a genus of the Retroviridae family that is able to infect non-dividing cells. Non- limiting examples of lend viruses are HIV, SIV, and FIV. Vectors or viral-like particles derived from lentiviruses can be used to transduce cells and deliver genes or other molecules and have them expressed in a cell either in vitro, ex-vivo, or in vivo.
[0079] By the term “modified” as used herein, is meant a changed state or structure of a molecule or cell as provided herein. Molecules may be modified in many ways, including chemically, structurally, and functionally, such as mutations, substitutions, insertions, ordeletions (e.g. internal deletions truncations). Cells may be modified through the introduction of nucleic acids or the expression of heterologous proteins.
[0080] By the term “modulating,” as used herein, is meant mediating an increase or decrease in the level of a response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and / or compared with the level of a response in an otherwise identical but untreated subject. The term encompasses perturbing and / or affecting a native signal or response thereby mediating a beneficial therapeutic response in a subject, such as, a human.
[0081] Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
[0082] The term “oligonucleotide” typically refers to short polynucleotides. It will be understood that when a nucleotide sequence is represented by a DNA sequence (i.e., A, T, C, G), this also provides the corresponding RNA sequence (i.e., A, U, C, G) in which “U” replaces “T.”
[0083] “Parenteral” administration of a composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intracistemal injection, intrathecal, or infusion techniques.
[0084] The term “polynucleotide” as used herein is defined as a chain of nucleotides. Furthermore, nucleic acids are polymers of nucleotides. Thus, the terms “nucleic acids” and “polynucleotides” as used herein are interchangeable. As used herein polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any methods available in the art, including, without limitation, recombinant methods, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using cloning technology and PCR, and the like, and by synthetic means.
[0085] As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of a plurality of amino acid residues covalently linked by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides,modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
[0086] The term “pseudotyped” or “pseudotyped viral particle”, as used herein, refers to a viral particle bearing glycoproteins derived from other viruses having envelopes or a viral vector encoding envelope glycoproteins from a virus that is different from the parental virus. The host range of the vector particles can thus be expanded or altered depending on the type of cell surface receptor used by the glycoprotein. For example, a virus can be pseudotyped with a VSV-G mutant protein as provided for herein.
[0087] By the term “specifically binds,” as used herein with respect to an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross- species reactivity does not itself alter the classification of an antibody as specific. In another example, an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of an antibody as specific. In some instances, the terms “specific binding” or “specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope “A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A” and the antibody, will reduce the amount of labeled A bound to the antibody. In some embodiments, the targeting moieties described herein that can be used to target the viral particles comprising the mutant VSV-G protein, or other viral structural proteins used to pseudotype a virus, can specifically bind to their target.
[0088] The term “therapeutic” as used herein means a treatment and / or prophylaxis. A therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
[0089] The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into a cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny. In some embodiments, the transfection, transformation, or transduction is performed or occurs in vivo.
[0090] A “vector” is a composition of matter which comprises an isolated nucleic acid encoding a protein or a peptide. Numerous vectors are known in the art including, but not limited to, linear polynucleotides, plasmids, DNA, and RNA. Examples of viral vectors include, but are not limited to, Sendai viral vectors, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
[0091] As used herein, the terms “viral vector”, “virus”, and “viral particle” are understood to be synonymous, unless the context of the embodiment specifically or explicitly dictates otherwise. This understanding is true for specific viral vector, too. For examples, as used herein, the terms “lentiviral vector”, “lentivirus”, and “lentiviral particle” are understood to be synonymous, unless the context of the embodiment specifically or explicitly dictates otherwise.
[0092] A “carrier” or “delivery vehicle” includes viral particles, viruses, polylysine compounds, and liposomes, which facilitate transfer of nucleic acid into cells. A carrier or delivery vehicle can also be used to deliver a protein or peptide to a cell.
[0093] Ranges: throughout this disclosure, various aspects of the embodiments can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range. Unless otherwise explicitly stated to the contrary, a range that is disclosed also includes the endpoints of the range.PHARMACEUTICAL COMPOSITIONS
[0094] The term "composition" as used herein means a product which results from the mixing or combining of more than one element or ingredient.
[0095] The term “carrier” as used herein encompasses carriers, excipients, and diluents, meaning a material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material involved in carrying or transporting a pharmaceutical, cosmetic or other agent across a tissue layer.
[0096] The phrase “pharmaceutically acceptable” is employed herein to refer to those agents of interest / compounds, salts, compositions, pharmaceutical dosage forms, etc., whichare, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and / or other mammals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit / risk ratio. In some embodiments, pharmaceutically acceptable means approved by a regulatory agency of the federal or a state government, or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals (e.g., mammals), and more particularly, in humans.
[0097] As used herein, “stable”, a “stable composition” or “stable pharmaceutical composition” refers to a composition or pharmaceutical composition that maintains the characteristics of the composition within a defined margin when subject to various stressors such as, but not limited to, heat, light, temperature, humidity, repeated freeze thaw cycles, and extended storage. Such characteristics include, but are not limited to, pH, presence of aggregates, functional titer, or concentration of protein excipient. In some embodiments, the defined margins for pH, presence of aggregates, functional titer, or concentration of protein excipient are as provided for herein.
[0098] The term "excipient" refers to a pharmacologically inactive substance formulated with an antibody, antigen-binding fragment thereof, viral vector, or any other pharmacologically active molecules as provided for herein.
[0099] In some embodiments, a pharmaceutical composition is provided, comprising a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1 % (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0100] In some embodiments, the pharmaceutical composition comprises a lentiviral vector at a concentration of about 1.0E+05to about 1.0E+09TUs / mL.
[0101] In some embodiments, the lentiviral vector is present at a concentration of about 1.0E+05to about l.OE+09TUs / mL, about 1.0E+05to about 1.0E+08TUs / mL, about 1.0E+05to about l.OE+07TUs / mL, about 1.0E+05to about 1.0E+06TUs / mL, about l.OE+06to about l.OE+09TUs / mL, about 1.0E+06to about 1.0E+08TUs / mL, about l.OE+06to about 1.0E+07TUs / mL, about 1.0E+07to about 1.0E+09TUs / mL, about 1.0E+07to about 1.0E+08TUs / mL, or about LOE+08to about 1.0E+09TUs / mL.
[0102] In some embodiments, the lentiviral vector is present at a concentration of about 1.0E+05to about 1.0E+09TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about 1.0E+05to about 1.0E+08TUs / mL. In some embodiments, thelentiviral vector is present at a concentration of about l.OE+05to about l.OE+07TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about 1.0E+05to about l.OE+06TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about l.OE+06to about l.OE+09TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about l.OE+06to about l.OE+08TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about l.OE+06to about l.OE+07TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about 1.0E+07to about l.OE+09TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about l.OE+07to about l.OE+08TUs / mL. In some embodiments, the lentiviral vector is present at a concentration of about l.OE+08to about l.OE+09TUs / mL.
[0103] In some embodiments, the lentiviral vector is present at a concentration of at least 1.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 2.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 3.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 4.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 5.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 6.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 7.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 8.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 9.0E+05. In some embodiments, the lentiviral vector is present at a concentration of at least 1 .0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 2.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 3.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 4.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 5.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 6.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 7.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 8.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 9.0E+06. In some embodiments, the lentiviral vector is present at a concentration of at least 1.0E+07. In some embodiments, the lentiviral vector is present at a concentration of at least 2.0E+07. In some embodiments, the lentiviral vector is present at a concentration of at least 3.0E+07. In some embodiments, the lentiviral vector is present at a concentration of at least 4.0E+07. In some embodiments, the lentiviral vector is present at a concentration of at least 5.0E+07. In some embodiments, the lentiviral vector is present at a concentration of atleast 6.OE+07. In some embodiments, the lentiviral vector is present at a concentration of at least 7.0E+07. In some embodiments, the lentiviral vector is present at a concentration of at least 8.0E+07. In some embodiments, the lentiviral vector is present at a concentration of at least 9.OE+07. In some embodiments, the lentiviral vector is present at a concentration of at least l.OE+08. In some embodiments, the lentiviral vector is present at a concentration of at least 2.0E+08. In some embodiments, the lentiviral vector is present at a concentration of at least 3.0E+08. In some embodiments, the lentiviral vector is present at a concentration of at least 4.OE+08. In some embodiments, the lentiviral vector is present at a concentration of at least 5.OE+08. In some embodiments, the lentiviral vector is present at a concentration of at least 6.OE+08. In some embodiments, the lentiviral vector is present at a concentration of at least 7.0E+08. In some embodiments, the lentiviral vector is present at a concentration of at least 8.0E+08. In some embodiments, the lentiviral vector is present at a concentration of at least 9.OE+08. In some embodiments, the lentiviral vector is present at a concentration of at least l.OE+09.
[0104] In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 5 mM to about 100 mM, about 5 mM to about 90 mM, about 5 mM to about 80 mM, about 5 mM to about 70 mM, about 5 mM to about 60 mM, about 5 mM to about 50 mM, about 5 mM to about 40 mM, about 5 mM to about 30 mM, about 5 mM to about 25 mM, about 10 mM to about 100 mM, about 10 mM to about 90 mM, about 10 mM to about 80 mM, about 10 mM to about 70 mM, about 10 mM to about 60 mM, about 10 mM to about 50 mM, about 10 mM to about 40 mM, about 10 mM to about 30 mM, about 10 mM to about 25 mM, about 15 mM to about 100 mM, about 15 mM to about 90 mM, about 15 mM to about 80 mM, about 15 mM to about 70 mM, about 15 mM to about 60 mM, about 15 mM to about 50 mM, about 15 mM to about 40 mM, about 15 mM to about 30 mM, or about 15 mM to about25 mM.
[0105] In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 5 mM to about 100 mM, about 5 mM to about 70 mM, about 5 mM to about 60 mM, about 10 mM to about 60 mM, about 10 mM to about 50 mM, about 10 mM to about 40 mM, about 15 mM to about 30 mM, or about 15 mM to about 25 mM.
[0106] In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 5 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 10 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 15 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 20 mM. In some embodiments, thepharmaceutically acceptable buffer has a concentration of about 25 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 30 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 35 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 40 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 45 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 50 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 55 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 60 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 65 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 70 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 75 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 80 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 85 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 90 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 95 mM. In some embodiments, the pharmaceutically acceptable buffer has a concentration of about 100 mM.
[0107] In some embodiments, the pharmaceutically acceptable buffer is selected from histidine buffer, HEPES, phosphoric acid buffer, citric acid buffer, acetic acid buffer, succinic acid buffer, phosphate buffer, acetate buffer, citrate buffer, succinate buffer, ascorbic acid buffer, glutamic acid buffer, lactic acid buffer, maleic acid buffer, trometamol buffer, gluconic acid buffer, or combinations thereof.
[0108] In some embodiments, the pharmaceutically acceptable buffer is histidine buffer. In some embodiments, the pharmaceutically acceptable buffer is HEPES. In some embodiments, the pharmaceutically acceptable buffer is phosphoric acid buffer. In some embodiments, the pharmaceutically acceptable buffer is citric acid buffer. In some embodiments, the pharmaceutically acceptable buffer is acetic acid buffer. In some embodiments, the pharmaceutically acceptable buffer is succinic acid buffer. In some embodiments, the pharmaceutically acceptable buffer is phosphate buffer. In some embodiments, the pharmaceutically acceptable buffer is acetate buffer. In some embodiments, the pharmaceutically acceptable buffer is citrate buffer. In some embodiments, the pharmaceutically acceptable buffer is succinate buffer. In some embodiments, the pharmaceutically acceptable buffer is ascorbic acid buffer. In some embodiments, thepharmaceutically acceptable buffer is glutamic acid buffer. In some embodiments, the pharmaceutically acceptable buffer is lactic acid buffer. In some embodiments, the pharmaceutically acceptable buffer is maleic acid buffer. In some embodiments, the pharmaceutically acceptable buffer is trometamol buffer. In some embodiments, the pharmaceutically acceptable buffer is gluconic acid buffer.
[0109] In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer.
[0110] In some embodiments, the histidine buffer has a concentration of about 5 mM to about 100 mM, about 5 mM to about 90 mM, about 5 mM to about 80 mM, about 5 mM to about 70 mM, about 5 mM to about 60 mM, about 5 mM to about 50 mM, about 5 mM to about 40 mM, about 5 mM to about 30 mM, about 5 mM to about 25 mM, about 10 mM to about 100 mM, about 10 mM to about 90 mM, about 10 mM to about 80 mM, about 10 mM to about 70 mM, about 10 mM to about 60 mM, about 10 mM to about 50 mM, about 10 mM to about 40 mM, about 10 mM to about 30 mM, about 10 mM to about 25 mM, about 15 mM to about 100 mM, about 15 mM to about 90 mM, about 15 mM to about 80 mM, about 15 mM to about 70 mM, about 15 mM to about 60 mM, about 15 mM to about 50 mM, about 15 mM to about 40 mM, about 15 mM to about 30 mM, or about 15 mM to about 25 mM.
[0111] In some embodiments, the histidine buffer has a concentration of about 5 mM to about 100 mM, about 5 mM to about 70 mM, about 5 mM to about 60 mM, about 10 mM to about 60 mM, about 10 mM to about 50 mM, about 10 mM to about 40 mM, about 15 mM to about 30 mM, or about 15 mM to about 25 mM.
[0112] In some embodiments, the histidine buffer has a concentration of about 5 mM. In some embodiments, the histidine buffer has a concentration of about 10 mM. In some embodiments, the histidine buffer has a concentration of about 11 mM. In some embodiments, the histidine buffer has a concentration of about 12 mM. In some embodiments, the histidine buffer has a concentration of about 13 mM. In some embodiments, the histidine buffer has a concentration of about 14 mM. In some embodiments, the histidine buffer has a concentration of about 15 mM. In some embodiments, the histidine buffer has a concentration of about 16 mM. In some embodiments, the histidine buffer has a concentration of about 17 mM. In some embodiments, the histidine buffer has a concentration of about 18 mM. In some embodiments, the histidine buffer has a concentration of about 19 mM. In some embodiments, the histidine buffer has a concentration of about 20 mM. In some embodiments, the histidine buffer has a concentration of about 25 mM. In some embodiments, the histidine buffer has a concentration of about 30 mM. In some embodiments, the histidine buffer has a concentration of about 35mM. In some embodiments, the histidine buffer has a concentration of about 40 mM. In some embodiments, the histidine buffer has a concentration of about 45 mM. In some embodiments, the histidine buffer has a concentration of about 50 mM. In some embodiments, histidine buffer has a concentration of about 55 mM. In some embodiments, the histidine buffer has a concentration of about 60 mM. In some embodiments, the histidine buffer has a concentration of about 65 mM. In some embodiments, the histidine buffer has a concentration of about 70 mM. In some embodiments, the histidine buffer has a concentration of about 75 mM. In some embodiments, the histidine buffer has a concentration of about 80 mM. In some embodiments, the histidine buffer has a concentration of about 85 mM. In some embodiments, the histidine buffer has a concentration of about 90 mM. In some embodiments, the histidine buffer has a concentration of about 95 mM. In some embodiments, the histidine buffer has a concentration of about 100 mM.
[0113] In some embodiments, the histidine buffer has a concentration of about 14 mM. In some embodiments, the histidine buffer is present at a concentration of about 20 mM.
[0114] In some embodiments, the pharmaceutical composition has a pH of about 6 to about 8, about 6.5 to about 8, about 7 to about 8, about 7.5 to about 8, about 6 to about 7.5, about 6 to about 7, about 6 to about 6.5, about 6.5 to about 7.5, or any value or range therein. In some embodiments, the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0115] In some embodiments, the pharmaceutical composition has a pH of about 6.0. In some embodiments, the pharmaceutical composition has a pH of about 6.1. In some embodiments, the pharmaceutical composition has a pH of about 6.2. In some embodiments, the pharmaceutical composition has a pH of about 6.3. In some embodiments, the pharmaceutical composition has a pH of about 6.4. In some embodiments, the pharmaceutical composition has a pH of about 6.5. In some embodiments, the pharmaceutical composition has a pH of about 6.6. In some embodiments, the pharmaceutical composition has a pH of about 6.7. In some embodiments, the pharmaceutical composition has a pH of about 6.8. In some embodiments, the pharmaceutical composition has a pH of about 6.9. In some embodiments, the pharmaceutical composition has a pH of about 7.0. In some embodiments, the pharmaceutical composition has a pH of about 7.1. In some embodiments, the pharmaceutical composition has a pH of about 7.2. In some embodiments, the pharmaceutical composition has a pH of about 7.3. In some embodiments, the pharmaceutical composition has a pH of about 7.4. In some embodiments, the pharmaceutical composition has a pH of about7.5. In some embodiments, the pharmaceutical composition has a pH of about 7.6. In some embodiments, the pharmaceutical composition has a pH of about 7.7. In some embodiments, the pharmaceutical composition has a pH of about 7.8. In some embodiments, the pharmaceutical composition has a pH of about 7.9. In some embodiments, the pharmaceutical composition has a pH of about 8.0.
[0116] In some embodiments, the pharmaceutical composition has a pH of about 7.0.
[0117] In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6 to about 8. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0118] In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.0. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.1. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about6.2. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.3. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.4. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.5. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about6.6. In some embodiments, the pH pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.7. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.8. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 6.9. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.0. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.1. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.2. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about7.3. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and thepharmaceutical composition has a pH of about 7.4. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of 7.5. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.6. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.7. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.8. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.9. In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 8.0.
[0119] In some embodiments, the pharmaceutically acceptable buffer is a histidine buffer and the pharmaceutical composition has a pH of about 7.0.
[0120] In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 800 mM, or any value or range in-between.
[0121] In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 700 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 600 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 500 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 400 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 300 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 250 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 175 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 150 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 125 mM.
[0122] In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 125 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentrationof about 150 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 175 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 200 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 250 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 300 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 350 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 400 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 500 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 600 mM to about 800 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 700 mM to about 800 mM.
[0123] In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 100 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 110 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 120 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 130 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 140 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 150 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 160 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 170 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 180 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 190 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 200 mM In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 210 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 220 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 230 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 240 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 250 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 260 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentrationof about 270 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 280 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 290 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 300 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 310 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 320 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 330 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 340 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 350 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 360 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 370 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 380 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 390 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 400 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 410 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 420 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 430 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 440 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 450 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 460 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 470 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 480 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 490 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 500 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 510 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 520 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 530 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 540 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 550 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 560mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 570 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 580 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 590 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 600 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 610 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 620 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 630 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 640 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 650 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 660 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 670 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 680 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 690 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 700 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 710 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 720 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 730 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 740 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 750 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 760 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 770 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 780 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 790 mM. In some embodiments, the pharmaceutically acceptable salt is present at a concentration of about 800 mM.
[0124] In some embodiments, the pharmaceutically acceptable salt is any appropriate pharmaceutically acceptable salt. Pharmaceutically acceptable salts are known in the art, and any such salt is within the scope of the present disclosure. In some embodiments, the pharmaceutically acceptable salt is selected from sodium chloride, potassium chloride, magnesium chloride, calcium chloride, or combinations thereof.
[0125] In some embodiments, the pharmaceutically acceptable salt is sodium chloride. In some embodiments, the pharmaceutically acceptable salt is potassium chloride. In some embodiments, the pharmaceutically acceptable salt is magnesium chloride. In some embodiments, the pharmaceutically acceptable salt is calcium chloride.
[0126] In some embodiments, the pharmaceutically acceptable salt is sodium chloride.
[0127] In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 800 mM, or any value or range in-between. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 700 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 600 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 500 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 300 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 250 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 175 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 150 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 125 mM.
[0128] In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 125 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 150 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 175 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 200 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 250 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 300 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 350 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 400 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 500 mM to about 800 mM. In some embodiments, the sodium chloride is present at a concentration of about 600 mM to about 800mM. In some embodiments, the sodium chloride is present at a concentration of about 700 mM to about 800 mM.
[0129] In some embodiments, the sodium chloride is present at a concentration of about 100 mM. In some embodiments, the sodium chloride is present at a concentration of about 110 mM. In some embodiments, the sodium chloride is present at a concentration of about 120 mM. In some embodiments, the sodium chloride is present at a concentration of about 130 mM. In some embodiments, the sodium chloride is present at a concentration of about 140 mM. In some embodiments, the sodium chloride is present at a concentration of about 150 mM. In some embodiments, the sodium chloride is present at a concentration of about 160 mM. In some embodiments, the sodium chloride is present at a concentration of about 170 mM. In some embodiments, the sodium chloride is present at a concentration of about 180 mM. In some embodiments, the sodium chloride is present at a concentration of about 190 mM. In some embodiments, the sodium chloride is present at a concentration of about 200 mM. In some embodiments, the sodium chloride is present at a concentration of about 210 mM. In some embodiments, the sodium chloride is present at a concentration of about 220 mM. In some embodiments, the sodium chloride is present at a concentration of about 230 mM. In some embodiments, the sodium chloride is present at a concentration of about 240 mM. In some embodiments, the sodium chloride is present at a concentration of about 250 mM. In some embodiments, the sodium chloride is present at a concentration of about 260 mM. In some embodiments, the sodium chloride is present at a concentration of about 270 mM. In some embodiments, the sodium chloride is present at a concentration of about 280 mM. In some embodiments, the sodium chloride is present at a concentration of about 290 mM. In some embodiments, the sodium chloride is present at a concentration of about 300 mM. In some embodiments, the sodium chloride is present at a concentration of about 310 mM. In some embodiments, the sodium chloride is present at a concentration of about 320 mM. In some embodiments, the sodium chloride is present at a concentration of about 330 mM. In some embodiments, the sodium chloride is present at a concentration of about 340 mM. In some embodiments, the sodium chloride is present at a concentration of about 350 mM. In some embodiments, the sodium chloride is present at a concentration of about 360 mM. In some embodiments, the sodium chloride is present at a concentration of about 370 mM. In some embodiments, the sodium chloride is present at a concentration of about 380 mM. In some embodiments, the sodium chloride is present at a concentration of about 390 mM. In some embodiments, the sodium chloride is present at a concentration of about 400 mM. In some embodiments, the sodium chloride is present at a concentration ofabout 410 mM. In some embodiments, the sodium chloride is present at a concentration of about 420 mM. In some embodiments, the sodium chloride is present at a concentration of about 430 mM. In some embodiments, the sodium chloride is present at a concentration of about 440 mM. In some embodiments, the sodium chloride is present at a concentration of about 450 mM. In some embodiments, the sodium chloride is present at a concentration of about 460 mM. In some embodiments, the sodium chloride is present at a concentration of about 470 mM. In some embodiments, the sodium chloride is present at a concentration of about 480 mM. In some embodiments, the sodium chloride is present at a concentration of about 490 mM. In some embodiments, the sodium chloride is present at a concentration of about 500 mM. In some embodiments, the sodium chloride is present at a concentration of about 510 mM. In some embodiments, the sodium chloride is present at a concentration of about 520 mM. In some embodiments, the sodium chloride is present at a concentration of about 530 mM. In some embodiments, the sodium chloride is present at a concentration of about 540 mM. In some embodiments, the sodium chloride is present at a concentration of about 550 mM. In some embodiments, the sodium chloride is present at a concentration of about 560 mM. In some embodiments, the sodium chloride is present at a concentration of about 570 mM. In some embodiments, the sodium chloride is present at a concentration of about 580 mM. In some embodiments, the sodium chloride is present at a concentration of about 590 mM. In some embodiments, the sodium chloride is present at a concentration of about 600 mM. In some embodiments, the sodium chloride is present at a concentration of about 610 mM. In some embodiments, the sodium chloride is present at a concentration of about 620 mM. In some embodiments, the sodium chloride is present at a concentration of about 630 mM. In some embodiments, the sodium chloride is present at a concentration of about 640 mM. In some embodiments, the sodium chloride is present at a concentration of about 650 mM. In some embodiments, the sodium chloride is present at a concentration of about 660 mM. In some embodiments, the sodium chloride is present at a concentration of about 670 mM. In some embodiments, the sodium chloride is present at a concentration of about 680 mM. In some embodiments, the sodium chloride is present at a concentration of about 690 mM. In some embodiments, the sodium chloride is present at a concentration of about 700 mM. In some embodiments, the sodium chloride is present at a concentration of about 710 mM. In some embodiments, the sodium chloride is present at a concentration of about 720 mM. In some embodiments, the sodium chloride is present at a concentration of about 730 mM. In some embodiments, the sodium chloride is present at a concentration of about 740 mM. In some embodiments, the sodium chloride is present at a concentration ofabout 750 mM. In some embodiments, the sodium chloride is present at a concentration of about 760 mM. In some embodiments, the sodium chloride is present at a concentration of about 770 mM. In some embodiments, the sodium chloride is present at a concentration of about 780 mM. In some embodiments, the sodium chloride is present at a concentration of about 790 mM. In some embodiments, the sodium chloride is present at a concentration of about 800 mM.
[0130] In some embodiments, the sodium chloride is present at a concentration of about 150 mM.
[0131] In some embodiments, the pharmaceutically acceptable salt is potassium chloride.
[0132] In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 800 mM, or any value or range in-between. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 700 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 600 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 500 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 400 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 300 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 250 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 175 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 150 mM. In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 125 mM.
[0133] In some embodiments, the potassium chloride is present at a concentration of about 100 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 125 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 150 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 175 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 200 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 250 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 300 mM to about800 mM. In some embodiments, the potassium chloride is present at a concentration of about 350 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 400 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 500 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 600 mM to about 800 mM. In some embodiments, the potassium chloride is present at a concentration of about 700 mM to about 800 mM.
[0134] In some embodiments, the potassium chloride is present at a concentration of about 100 mM. In some embodiments, the potassium chloride is present at a concentration of about 110 mM. In some embodiments, the potassium chloride is present at a concentration of about 120 mM. In some embodiments, the potassium chloride is present at a concentration of about 130 mM. In some embodiments, the potassium chloride is present at a concentration of about 140 mM. In some embodiments, the potassium chloride is present at a concentration of about 150 mM. In some embodiments, the potassium chloride is present at a concentration of about 160 mM. In some embodiments, the potassium chloride is present at a concentration of about 170 mM. In some embodiments, the potassium chloride is present at a concentration of about 180 mM. In some embodiments, the potassium chloride is present at a concentration of about 190 mM. In some embodiments, the potassium chloride is present at a concentration of about 200 mM. In some embodiments, the potassium chloride is present at a concentration of about 210 mM. In some embodiments, the potassium chloride is present at a concentration of about 220 mM. In some embodiments, the potassium chloride is present at a concentration of about 230 mM. In some embodiments, the potassium chloride is present at a concentration of about 240 mM. In some embodiments, the potassium chloride is present at a concentration of about 250 mM. In some embodiments, the potassium chloride is present at a concentration of about 260 mM. In some embodiments, the potassium chloride is present at a concentration of about 270 mM. In some embodiments, the potassium chloride is present at a concentration of about 280 mM. In some embodiments, the potassium chloride is present at a concentration of about 290 mM. In some embodiments, the potassium chloride is present at a concentration of about 300 mM. In some embodiments, the potassium chloride is present at a concentration of about 310 mM. In some embodiments, the potassium chloride is present at a concentration of about 320 mM. In some embodiments, the potassium chloride is present at a concentration of about 330 mM. In some embodiments, the potassium chloride is present at a concentration of about 340 mM. In some embodiments, the potassium chloride is present at a concentration of about 350 mM. In some embodiments, the potassium chloride is present at aconcentration of about 360 mM. In some embodiments, the potassium chloride is present at a concentration of about 370 mM. In some embodiments, the potassium chloride is present at a concentration of about 380 mM. In some embodiments, the potassium chloride is present at a concentration of about 390 mM. In some embodiments, the potassium chloride is present at a concentration of about 400 mM. In some embodiments, the potassium chloride is present at a concentration of about 410 mM. In some embodiments, the potassium chloride is present at a concentration of about 420 mM. In some embodiments, the potassium chloride is present at a concentration of about 430 mM. In some embodiments, the potassium chloride is present at a concentration of about 440 mM. In some embodiments, the potassium chloride is present at a concentration of about 450 mM. In some embodiments, the potassium chloride is present at a concentration of about 460 mM. In some embodiments, the potassium chloride is present at a concentration of about 470 mM. In some embodiments, the potassium chloride is present at a concentration of about 480 mM. In some embodiments, the potassium chloride is present at a concentration of about 490 mM. In some embodiments, the potassium chloride is present at a concentration of about 500 mM. In some embodiments, the potassium chloride is present at a concentration of about 510 mM. In some embodiments, the potassium chloride is present at a concentration of about 520 mM. In some embodiments, the potassium chloride is present at a concentration of about 530 mM. In some embodiments, the potassium chloride is present at a concentration of about 540 mM. In some embodiments, the potassium chloride is present at a concentration of about 550 mM. In some embodiments, the potassium chloride is present at a concentration of about 560 mM. In some embodiments, the potassium chloride is present at a concentration of about 570 mM. In some embodiments, the potassium chloride is present at a concentration of about 580 mM. In some embodiments, the potassium chloride is present at a concentration of about 590 mM. In some embodiments, the potassium chloride is present at a concentration of about 600 mM. In some embodiments, the potassium chloride is present at a concentration of about 610 mM. In some embodiments, the potassium chloride is present at a concentration of about 620 mM. In some embodiments, the potassium chloride is present at a concentration of about 630 mM. In some embodiments, the potassium chloride is present at a concentration of about 640 mM. In some embodiments, the potassium chloride is present at a concentration of about 650 mM. In some embodiments, the potassium chloride is present at a concentration of about 660 mM. In some embodiments, the potassium chloride is present at a concentration of about 670 mM. In some embodiments, the potassium chloride is present at a concentration of about 680 mM. In some embodiments, the potassium chloride is present at a concentration of about 690 mM. In some embodiments, the potassium chloride is present at aconcentration of about 700 mM. In some embodiments, the potassium chloride is present at a concentration of about 710 mM. In some embodiments, the potassium chloride is present at a concentration of about 720 mM. In some embodiments, the potassium chloride is present at a concentration of about 730 mM. In some embodiments, the potassium chloride is present at a concentration of about 740 mM. In some embodiments, the potassium chloride is present at a concentration of about 750 mM. In some embodiments, the potassium chloride is present at a concentration of about 760 mM. In some embodiments, the potassium chloride is present at a concentration of about 770 mM. In some embodiments, the potassium chloride is present at a concentration of about 780 mM. In some embodiments, the potassium chloride is present at a concentration of about 790 mM. In some embodiments, the potassium chloride is present at a concentration of about 800 mM.
[0135] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride.
[0136] In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 800 mM, or any value or range in-between. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 700 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 600 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 500 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 400 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 300 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 250 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 175 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 150 mM. In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 125 mM.
[0137] In some embodiments, the magnesium chloride is present at a concentration of about 100 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 125 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 150 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 175 mM to about 800 mM. In some embodiments, the magnesium chloride is present at aconcentration of about 200 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 250 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 300 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 350 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 400 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 500 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 600 mM to about 800 mM. In some embodiments, the magnesium chloride is present at a concentration of about 700 mM to about 800 mM.
[0138] In some embodiments, the magnesium chloride is present at a concentration of about 100 mM. In some embodiments, the magnesium chloride is present at a concentration of about 110 mM. In some embodiments, the magnesium chloride is present at a concentration of about 120 mM. In some embodiments, the magnesium chloride is present at a concentration of about 130 mM. In some embodiments, the magnesium chloride is present at a concentration of about 140 mM. In some embodiments, the magnesium chloride is present at a concentration of about 150 mM. In some embodiments, the magnesium chloride is present at a concentration of about 160 mM. In some embodiments, the magnesium chloride is present at a concentration of about 170 mM. In some embodiments, the magnesium chloride is present at a concentration of about 180 mM. In some embodiments, the magnesium chloride is present at a concentration of about 190 mM. In some embodiments, the magnesium chloride is present at a concentration of about 200 mM. In some embodiments, the magnesium chloride is present at a concentration of about 210 mM. In some embodiments, the magnesium chloride is present at a concentration of about 220 mM. In some embodiments, the magnesium chloride is present at a concentration of about 230 mM. In some embodiments, the magnesium chloride is present at a concentration of about 240 mM. In some embodiments, the magnesium chloride is present at a concentration of about 250 mM. In some embodiments, the magnesium chloride is present at a concentration of about 260 mM. In some embodiments, the magnesium chloride is present at a concentration of about 270 mM. In some embodiments, the magnesium chloride is present at a concentration of about 280 mM. In some embodiments, the magnesium chloride is present at a concentration of about 290 mM. In some embodiments, the magnesium chloride is present at a concentration of about 300 mM. In some embodiments, the magnesium chloride is present at a concentration of about 310 mM. In some embodiments, the magnesium chloride is present at a concentration of about 320 mM. In some embodiments, the magnesium chloride is present ata concentration of about 330 mM. In some embodiments, the magnesium chloride is present at a concentration of about 340 mM. In some embodiments, the magnesium chloride is present at a concentration of about 350 mM. In some embodiments, the magnesium chloride is present at a concentration of about 360 mM. In some embodiments, the magnesium chloride is present at a concentration of about 370 mM. In some embodiments, the magnesium chloride is present at a concentration of about 380 mM. In some embodiments, the magnesium chloride is present at a concentration of about 390 mM. In some embodiments, the magnesium chloride is present at a concentration of about 400 mM. In some embodiments, the magnesium chloride is present at a concentration of about 410 mM. In some embodiments, the magnesium chloride is present at a concentration of about 420 mM. In some embodiments, the magnesium chloride is present at a concentration of about 430 mM. In some embodiments, the magnesium chloride is present at a concentration of about 440 mM. In some embodiments, the magnesium chloride is present at a concentration of about 450 mM. In some embodiments, the magnesium chloride is present at a concentration of about 460 mM. In some embodiments, the magnesium chloride is present at a concentration of about 470 mM. In some embodiments, the magnesium chloride is present at a concentration of about 480 mM. In some embodiments, the magnesium chloride is present at a concentration of about 490 mM. In some embodiments, the magnesium chloride is present at a concentration of about 500 mM. In some embodiments, the magnesium chloride is present at a concentration of about 510 mM. In some embodiments, the magnesium chloride is present at a concentration of about 520 mM. In some embodiments, the magnesium chloride is present at a concentration of about 530 mM. In some embodiments, the magnesium chloride is present at a concentration of about 540 mM. In some embodiments, the magnesium chloride is present at a concentration of about 550 mM. In some embodiments, the magnesium chloride is present at a concentration of about 560 mM. In some embodiments, the magnesium chloride is present at a concentration of about 570 mM. In some embodiments, the magnesium chloride is present at a concentration of about 580 mM. In some embodiments, the magnesium chloride is present at a concentration of about 590 mM. In some embodiments, the magnesium chloride is present at a concentration of about 600 mM. In some embodiments, the magnesium chloride is present at a concentration of about 610 mM. In some embodiments, the magnesium chloride is present at a concentration of about 620 mM. In some embodiments, the magnesium chloride is present at a concentration of about 630 mM. In some embodiments, the magnesium chloride is present at a concentration of about 640 mM. In some embodiments, the magnesium chloride is present at a concentration of about 650 mM. In some embodiments, the magnesium chloride is present at a concentration of about 660 mM. In some embodiments, the magnesium chloride is present ata concentration of about 670 mM. In some embodiments, the magnesium chloride is present at a concentration of about 680 mM. In some embodiments, the magnesium chloride is present at a concentration of about 690 mM. In some embodiments, the magnesium chloride is present at a concentration of about 700 mM. In some embodiments, the magnesium chloride is present at a concentration of about 710 mM. In some embodiments, the magnesium chloride is present at a concentration of about 720 mM. In some embodiments, the magnesium chloride is present at a concentration of about 730 mM. In some embodiments, the magnesium chloride is present at a concentration of about 740 mM. In some embodiments, the magnesium chloride is present at a concentration of about 750 mM. In some embodiments, the magnesium chloride is present at a concentration of about 760 mM. In some embodiments, the magnesium chloride is present at a concentration of about 770 mM. In some embodiments, the magnesium chloride is present at a concentration of about 780 mM. In some embodiments, the magnesium chloride is present at a concentration of about 790 mM. In some embodiments, the magnesium chloride is present at a concentration of about 800 mM.
[0139] In some embodiments, the pharmaceutically acceptable salt is calcium chloride.
[0140] In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 800 mM, or any value or range in-between. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 700 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 600 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 500 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 400 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 300 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 250 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 175 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 150 mM. In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 125 mM.
[0141] In some embodiments, the calcium chloride is present at a concentration of about 100 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 125 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 150 mM to about 800 mM. In someembodiments, the calcium chloride is present at a concentration of about 175 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 200 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 250 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 300 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 350 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 400 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 500 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 600 mM to about 800 mM. In some embodiments, the calcium chloride is present at a concentration of about 700 mM to about 800 mM.
[0142] In some embodiments, the calcium chloride is present at a concentration of about 100 mM. In some embodiments, the calcium chloride is present at a concentration of about 110 mM. In some embodiments, the calcium chloride is present at a concentration of about 120 mM. In some embodiments, the calcium chloride is present at a concentration of about 130 mM. In some embodiments, the calcium chloride is present at a concentration of about 140 mM. In some embodiments, the calcium chloride is present at a concentration of about 150 mM. In some embodiments, the calcium chloride is present at a concentration of about 160 mM. In some embodiments, the calcium chloride is present at a concentration of about 170 mM. In some embodiments, the calcium chloride is present at a concentration of about 180 mM. In some embodiments, the calcium chloride is present at a concentration of about 190 mM. In some embodiments, the calcium chloride is present at a concentration of about 200 mM. In some embodiments, the calcium chloride is present at a concentration of about 210 mM. In some embodiments, the calcium chloride is present at a concentration of about 220 mM. In some embodiments, the calcium chloride is present at a concentration of about 230 mM. In some embodiments, the calcium chloride is present at a concentration of about 240 mM. In some embodiments, the calcium chloride is present at a concentration of about 250 mM. In some embodiments, the calcium chloride is present at a concentration of about 260 mM. In some embodiments, the calcium chloride is present at a concentration of about 270 mM. In some embodiments, the calcium chloride is present at a concentration of about 280 mM. In some embodiments, the calcium chloride is present at a concentration of about 290 mM. In some embodiments, the calcium chloride is present at a concentration of about 300 mM. In some embodiments, the calcium chloride is present at a concentration of about 310 mM. In some embodiments, the calcium chloride is present at a concentration ofabout 320 mM. In some embodiments, the calcium chloride is present at a concentration of about 330 mM. In some embodiments, the calcium chloride is present at a concentration of about 340 mM. In some embodiments, the calcium chloride is present at a concentration of about 350 mM. In some embodiments, the calcium chloride is present at a concentration of about 360 mM. In some embodiments, the calcium chloride is present at a concentration of about 370 mM. In some embodiments, the calcium chloride is present at a concentration of about 380 mM. In some embodiments, the calcium chloride is present at a concentration of about 390 mM. In some embodiments, the calcium chloride is present at a concentration of about 400 mM. In some embodiments, the calcium chloride is present at a concentration of about 410 mM. In some embodiments, the calcium chloride is present at a concentration of about 420 mM. In some embodiments, the calcium chloride is present at a concentration of about 430 mM. In some embodiments, the calcium chloride is present at a concentration of about 440 mM. In some embodiments, the calcium chloride is present at a concentration of about 450 mM. In some embodiments, the calcium chloride is present at a concentration of about 460 mM. In some embodiments, the calcium chloride is present at a concentration of about 470 mM. In some embodiments, the calcium chloride is present at a concentration of about 480 mM. In some embodiments, the calcium chloride is present at a concentration of about 490 mM. In some embodiments, the calcium chloride is present at a concentration of about 500 mM. In some embodiments, the calcium chloride is present at a concentration of about 510 mM. In some embodiments, the calcium chloride is present at a concentration of about 520 mM. In some embodiments, the calcium chloride is present at a concentration of about 530 mM. In some embodiments, the calcium chloride is present at a concentration of about 540 mM. In some embodiments, the calcium chloride is present at a concentration of about 550 mM. In some embodiments, the calcium chloride is present at a concentration of about 560 mM. In some embodiments, the calcium chloride is present at a concentration of about 570 mM. In some embodiments, the calcium chloride is present at a concentration of about 580 mM. In some embodiments, the calcium chloride is present at a concentration of about 590 mM. In some embodiments, the calcium chloride is present at a concentration of about 600 mM. In some embodiments, the calcium chloride is present at a concentration of about 610 mM. In some embodiments, the calcium chloride is present at a concentration of about 620 mM. In some embodiments, the calcium chloride is present at a concentration of about 630 mM. In some embodiments, the calcium chloride is present at a concentration of about 640 mM. In some embodiments, the calcium chloride is present at a concentration of about 650 mM. In some embodiments, the calcium chloride is present at a concentration ofabout 660 mM. In some embodiments, the calcium chloride is present at a concentration of about 670 mM. In some embodiments, the calcium chloride is present at a concentration of about 680 mM. In some embodiments, the calcium chloride is present at a concentration of about 690 mM. In some embodiments, the calcium chloride is present at a concentration of about 700 mM. In some embodiments, the calcium chloride is present at a concentration of about 710 mM. In some embodiments, the calcium chloride is present at a concentration of about 720 mM. In some embodiments, the calcium chloride is present at a concentration of about 730 mM. In some embodiments, the calcium chloride is present at a concentration of about 740 mM. In some embodiments, the calcium chloride is present at a concentration of about 750 mM. In some embodiments, the calcium chloride is present at a concentration of about 760 mM. In some embodiments, the calcium chloride is present at a concentration of about 770 mM. In some embodiments, the calcium chloride is present at a concentration of about 780 mM. In some embodiments, the calcium chloride is present at a concentration of about 790 mM. In some embodiments, the calcium chloride is present at a concentration of about 800 mM.
[0143] In some embodiments, the sugar is present at about 1% (w / v) to about 10% (w / v), or any value or range in-between.
[0144] In some embodiments, the sugar is present at about 1% (w / v) to about 10% (w / v). In some embodiments, the sugar is present at about 1% (w / v) to about 8% (w / v). In some embodiments, the sugar is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the sugar is present at about 1 % (w / v) to about 6% (w / v). In some embodiments, the sugar is present at about 1% (w / v) to about 5% (w / v). In some embodiments, the sugar is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the sugar is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the sugar is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the sugar is present at about 1 % (w / v) to about 2% (w / v).
[0145] In some embodiments, the sugar is present at about 1% (w / v) to about10% (w / v). In some embodiments, the sugar is present at about 2% (w / v) to about 10% (w / v).In some embodiments, the sugar is present at about 3% (w / v) to about 10% (w / v). In some embodiments, the sugar is present at about 4% (w / v) to about 10% (w / v). In some embodiments, the sugar is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the sugar is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the sugar is present at about 7% (w / v) to about 10% (w / v). In someembodiments, the sugar is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the sugar is present at about 9% (w / v) to about 10% (w / v).
[0146] In some embodiments, the sugar is present at about 1% (w / v). In some embodiments, the sugar is present at about 2% (w / v). In some embodiments, the sugar is present at about 3% (w / v). In some embodiments, the sugar is present at about 4% (w / v). In some embodiments, the sugar is present at about 5% (w / v). In some embodiments, the sugar is present at about 6% (w / v). In some embodiments, the sugar is present at about 7% (w / v). In some embodiments, the sugar is present at about 8% (w / v). In some embodiments, the sugar is present at about 9% (w / v). In some embodiments, the sugar is present at about 10% (w / v).
[0147] In some embodiments, the sugar is selected from sucrose, trehalose, mannose, glucose, sorbitol, mannitol, or a combination thereof.
[0148] In some embodiments, the sugar is sucrose. In some embodiments, the sugar is trehalose. In some embodiments, the sugar is mannose. In some embodiments, the sugar is glucose. In some embodiments, the sugar is sorbitol. In some embodiments, the sugar is mannitol.
[0149] In some embodiments, the sugar is sucrose.
[0150] In some embodiments, the sucrose is present at about 1% (w / v) to about10% (w / v), or any value or range in-between. In some embodiments, the sucrose is present at about 1% (w / v) to about 9% (w / v). In some embodiments, the sucrose is present at about 1% (w / v) to about 8% (w / v). In some embodiments, the sucrose is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the sucrose is present at about 1 % (w / v) to about 6% (w / v). In some embodiments, the sucrose is present at about 1% (w / v) to about 5% (w / v). In some embodiments, the sucrose is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the sucrose is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the sucrose is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the sucrose is present at about 1% (w / v) to about 2% (w / v).
[0151] In some embodiments, the sucrose is present at about 1% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 2% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 3% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 4% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 7% (w / v) to about 10% (w / v). In someembodiments, the sucrose is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the sucrose is present at about 9% (w / v) to about 10% (w / v).
[0152] In some embodiments, the sucrose is present at about 1 % (w / v). In some embodiments, the sucrose is present at about 2% (w / v). In some embodiments, the sucrose is present at about 3% (w / v). In some embodiments, the sucrose is present at about 4% (w / v). In some embodiments, the sucrose is present at about 5% (w / v). In some embodiments, the sucrose is present at about 6% (w / v). In some embodiments, the sucrose is present at about 7% (w / v). In some embodiments, the sucrose is present at about 8% (w / v). In some embodiments, the sucrose is present at about 9% (w / v). In some embodiments, the sucrose is present at about 10% (w / v).
[0153] In some embodiments, the sucrose is present at about 4% (w / v).
[0154] In some embodiments, the sugar is trehalose.
[0155] In some embodiments, the trehalose is present at about 1% (w / v) to about 10% (w / v), or any value or range in-between. In some embodiments, the trehalose is present at about 1% (w / v) to about 9% (w / v). In some embodiments, the trehalose is present at about 1% (w / v) to about 8% (w / v). In some embodiments, the trehalose is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the trehalose is present at about 1% (w / v) to about 6% (w / v). In some embodiments, the trehalose is present at about 1% (w / v) to about 5% (w / v). In some embodiments, the trehalose is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the trehalose is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the trehalose is present at about 1 % (w / v) to about 3% (w / v). In some embodiments, the trehalose is present at about 1% (w / v) to about 2% (w / v).
[0156] In some embodiments, the trehalose is present at about 1% (w / v) to about 10% (w / v). In some embodiments, the trehalose is present at about 2% (w / v) to about 10% (w / v). In some embodiments, the trehalose is present at about 3% (w / v) to about 10%(w / v). In some embodiments, the trehalose is present at about 4% (w / v) to about 10% (w / v).In some embodiments, the trehalose is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the trehalose is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the trehalose is present at about 7% (w / v) to about 10% (w / v). In some embodiments, the trehalose is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the trehalose is present at about 9% (w / v) to about 10% (w / v).
[0157] In some embodiments, the trehalose is present at about 1% (w / v). In some embodiments, the trehalose is present at about 2% (w / v). In some embodiments, the trehalose is present at about 3% (w / v). In some embodiments, the trehalose is present at about4% (w / v). In some embodiments, the trehalose is present at about 5% (w / v). In some embodiments, the trehalose is present at about 6% (w / v). In some embodiments, the trehalose is present at about 7% (w / v). In some embodiments, the trehalose is present at about 8% (w / v).In some embodiments, the trehalose is present at about 9% (w / v). In some embodiments, the trehalose is present at about 10% (w / v).
[0158] In some embodiments, the sugar is mannose.
[0159] In some embodiments, the mannose is present at about 1% (w / v) to about10% (w / v), or any value or range in-between. In some embodiments, the mannose is present at about 1% (w / v) to about 9% (w / v). In some embodiments, the mannose is present at about 1% (w / v) to about 8% (w / v). In some embodiments, the mannose is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the mannose is present at about 1% (w / v) to about 6% (w / v). In some embodiments, the mannose is present at about 1 % (w / v) to about 5% (w / v). In some embodiments, the mannose is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the mannose is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the mannose is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the mannose is present at about 1% (w / v) to about 2% (w / v).
[0160] In some embodiments, the mannose is present at about 1% (w / v) to about10% (w / v). In some embodiments, the mannose is present at about 2% (w / v) to about 10%(w / v). In some embodiments, the mannose is present at about 3% (w / v) to about 10% (w / v).In some embodiments, the mannose is present at about 4% (w / v) to about 10% (w / v). In some embodiments, the mannose is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the mannose is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the mannose is present at about 7% (w / v) to about 10% (w / v). In some embodiments, the mannose is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the mannose is present at about 9% (w / v) to about 10% (w / v).
[0161] In some embodiments, the mannose is present at about 1% (w / v). In some embodiments, the mannose is present at about 2% (w / v). In some embodiments, the mannose is present at about 3% (w / v). In some embodiments, the mannose is present at about 4% (w / v). In some embodiments, the mannose is present at about 5% (w / v). In some embodiments, the mannose is present at about 6% (w / v). In some embodiments, the mannose is present at about 7% (w / v). In some embodiments, the mannose is present at about 8% (w / v). In some embodiments, the mannose is present at about 9% (w / v). In some embodiments, the mannose is present at about 10% (w / v).
[0162] In some embodiments, the sugar is glucose.
[0163] In some embodiments, the glucose is present at about 1% (w / v) to about 10% (w / v), or any value or range in-between. In some embodiments, the glucose is present at about 1% (w / v) to about 9% (w / v). In some embodiments, the glucose is present at about 1%(w / v) to about 8% (w / v). In some embodiments, the glucose is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the glucose is present at about 1% (w / v) to about 6% (w / v). In some embodiments, the glucose is present at about 1% (w / v) to about 5% (w / v). In some embodiments, the glucose is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the glucose is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the glucose is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the glucose is present at about 1% (w / v) to about 2% (w / v).
[0164] In some embodiments, the glucose is present at about 1% (w / v) to about10% (w / v). In some embodiments, the glucose is present at about 2% (w / v) to about 10%(w / v). In some embodiments, the glucose is present at about 3% (w / v) to about 10% (w / v). In some embodiments, the glucose is present at about 4% (w / v) to about 10% (w / v). In some embodiments, the glucose is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the glucose is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the glucose is present at about 7% (w / v) to about 10% (w / v). In some embodiments, the glucose is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the glucose is present at about 9% (w / v) to about 10% (w / v).
[0165] In some embodiments, the glucose is present at about 1% (w / v). In some embodiments, the glucose is present at about 2% (w / v). In some embodiments, the glucose is present at about 3% (w / v). In some embodiments, the glucose is present at about 4% (w / v). In some embodiments, the glucose is present at about 5% (w / v). In some embodiments, the glucose is present at about 6% (w / v). In some embodiments, the glucose is present at about 7% (w / v). In some embodiments, the glucose is present at about 8% (w / v). In some embodiments, the glucose is present at about 9% (w / v). In some embodiments, the glucose is present at about 10% (w / v).
[0166] In some embodiments, the sugar is sorbitol.
[0167] In some embodiments, the sorbitol is present at about 1% (w / v) to about 10% (w / v), or any value or range in-between. In some embodiments, the sorbitol is present at about 1% (w / v) to about 9% (w / v). In some embodiments, the sorbitol is present at about 1% (w / v) to about 8% (w / v). In some embodiments, the sorbitol is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the sorbitol is present at about 1% (w / v) to about 6% (w / v). In some embodiments, the sorbitol is present at about 1% (w / v) to about 5% (w / v). Insome embodiments, the sorbitol is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the sorbitol is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the sorbitol is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the sorbitol is present at about 1% (w / v) to about 2% (w / v).
[0168] In some embodiments, the sorbitol is present at about 1% (w / v) to about10% (w / v). In some embodiments, the sorbitol is present at about 2% (w / v) to about 10%(w / v). In some embodiments, the sorbitol is present at about 3% (w / v) to about 10% (w / v). In some embodiments, the sorbitol is present at about 4% (w / v) to about 10% (w / v). In some embodiments, the sorbitol is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the sorbitol is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the sorbitol is present at about 7% (w / v) to about 10% (w / v). In some embodiments, the sorbitol is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the sorbitol is present at about 9% (w / v) to about 10% (w / v).
[0169] In some embodiments, the sorbitol is present at about 1% (w / v). In some embodiments, the sorbitol is present at about 2% (w / v). In some embodiments, the sorbitol is present at about 3% (w / v). In some embodiments, the sorbitol is present at about 4% (w / v). In some embodiments, the sorbitol is present at about 5% (w / v). In some embodiments, the sorbitol is present at about 6% (w / v). In some embodiments, the sorbitol is present at about 7% (w / v). In some embodiments, the sorbitol is present at about 8% (w / v). In some embodiments, the sorbitol is present at about 9% (w / v). In some embodiments, the sorbitol is present at about 10% (w / v).
[0170] In some embodiments, the sugar is mannitol.
[0171] In some embodiments, the mannitol is present at about 1 % (w / v) to about10% (w / v), or any value or range in-between. In some embodiments, the mannitol is present at about 1% (w / v) to about 9% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 8% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 7% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 6% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 5% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 4% (w / v). In some embodiments, the mannitol is present at about 2% (w / v) to about 4% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the mannitol is present at about 1% (w / v) to about 2% (w / v).
[0172] In some embodiments, the mannitol is present at about 1% (w / v) to about 10% (w / v). In some embodiments, the mannitol is present at about 2% (w / v) to about 10%(w / v). In some embodiments, the mannitol is present at about 3% (w / v) to about 10% (w / v).In some embodiments, the mannitol is present at about 4% (w / v) to about 10% (w / v). In some embodiments, the mannitol is present at about 5% (w / v) to about 10% (w / v). In some embodiments, the mannitol is present at about 6% (w / v) to about 10% (w / v). In some embodiments, the mannitol is present at about 7% (w / v) to about 10% (w / v). In some embodiments, the mannitol is present at about 8% (w / v) to about 10% (w / v). In some embodiments, the mannitol is present at about 9% (w / v) to about 10% (w / v).
[0173] In some embodiments, the mannitol is present at about 1% (w / v). In some embodiments, the mannitol is present at about 2% (w / v). In some embodiments, the mannitol is present at about 3% (w / v). In some embodiments, the mannitol is present at about4% (w / v). In some embodiments, the mannitol is present at about 5% (w / v). In some embodiments, the mannitol is present at about 6% (w / v). In some embodiments, the mannitol is present at about 7% (w / v). In some embodiments, the mannitol is present at about 8% (w / v). In some embodiments, the mannitol is present at about 9% (w / v). In some embodiments, the mannitol is present at about 10% (w / v).
[0174] In some embodiments, the pharmaceutically acceptable salt is sodium chloride and the sugar is sucrose.
[0175] In some embodiments, the pharmaceutically acceptable salt is sodium chloride and the sugar is trehalose.
[0176] In some embodiments, the pharmaceutically acceptable salt is sodium chloride and the sugar is mannose.
[0177] In some embodiments, the pharmaceutically acceptable salt is sodium chloride and the sugar is glucose.
[0178] In some embodiments, the pharmaceutically acceptable salt is sodium chloride and the sugar is sorbitol.
[0179] In some embodiments, the pharmaceutically acceptable salt is sodium chloride and the sugar is mannitol.
[0180] In some embodiments, the pharmaceutically acceptable salt is potassium chloride and the sugar is sucrose.
[0181] In some embodiments, the pharmaceutically acceptable salt is potassium chloride and the sugar is trehalose.
[0182] In some embodiments, the pharmaceutically acceptable salt is potassium chloride and the sugar is mannose.
[0183] In some embodiments, the pharmaceutically acceptable salt is potassium chloride and the sugar is glucose.
[0184] In some embodiments, the pharmaceutically acceptable salt is potassium chloride and the sugar is sorbitol.
[0185] In some embodiments, the pharmaceutically acceptable salt is potassium chloride and the sugar is mannitol.
[0186] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride and the sugar is sucrose.
[0187] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride and the sugar is trehalose.
[0188] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride and the sugar is mannose.
[0189] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride and the sugar is glucose.
[0190] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride and the sugar is sorbitol.
[0191] In some embodiments, the pharmaceutically acceptable salt is magnesium chloride and the sugar is mannitol.
[0192] In some embodiments, the pharmaceutically acceptable salt is calcium chloride and the sugar is sucrose.
[0193] In some embodiments, the pharmaceutically acceptable salt is calcium chloride and the sugar is trehalose.
[0194] In some embodiments, the pharmaceutically acceptable salt is calcium chloride and the sugar is mannose.
[0195] In some embodiments, the pharmaceutically acceptable salt is calcium chloride and the sugar is glucose.
[0196] In some embodiments, the pharmaceutically acceptable salt is calcium chloride and the sugar is sorbitol.
[0197] In some embodiments, the pharmaceutically acceptable salt is calcium chloride and the sugar is mannitol.
[0198] In some embodiments, the protein excipient is selected from, but not limited to, myoglobulin, serum albumin, bovine serum albumin, human serum albumin, immunoglobulin, immunoglobulin fragments, fibronectin, vitronectin, or a combination thereof. In some embodiments, the protein excipient comprises serum albumin. In someembodiments, the protein excipient comprises human serum albumin. In some embodiments, the human serum albumin is recombinant human serum albumin. In some embodiments, the human serum albumin is non-recombinant human serum albumin. In some embodiments, the non-recombinant human serum albumin is US Pharmacopeia (USP) grade non-recombinant human serum albumin. In some embodiments, the non-recombinant human serum albumin is FDA approved non-recombinant human serum albumin.
[0199] In some embodiments, the protein excipient is recombinant human serum albumin. In some embodiments, the protein excipient is non-recombinant human serum albumin.
[0200] In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 3% (w / v), or any value or range in-between. In some embodiments, the protein excipient is present at about 0.2% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.3% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.4% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.5% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.6% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.7% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.8% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.9% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 1 .2% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 1.4% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 1.5% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 1.6% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 1.8% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 2% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 2.2% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 2.4% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 2.5% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 2.6% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 2.8% (w / v) to about 3% (w / v).
[0201] In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 3% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 2.8% (w / v). In some embodiments, the protein excipient is present at about0.1% (w / v) to about 2.6% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 2.5% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 2.4% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 2.2% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 2% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 1.8% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 1.6% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 1.5% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 1.4% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 1.2% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 1% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.9% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.8% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.7 % (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.6% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.5% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.4% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.3% (w / v). In some embodiments, the protein excipient is present at about 0.1% (w / v) to about 0.2% (w / v).
[0202] In some embodiments, the protein excipient is present at about 0.1% (w / v), about 0.2% (w / v), about 0.3% (w / v), about 0.4% (w / v), about 0.5% (w / v), about 0.6% (w / v), about 0.7% (w / v), about 0.8% (w / v), about 0.9% (w / v), about 1% (w / v), about 1.1% (w / v), about 1.2% (w / v), about 1.3% (w / v), about 1.4% (w / v), about 1.5% (w / v), about 1.6% (w / v), about 1.7% (w / v), about 1.8% (w / v), about 1.9% (w / v), about 2% (w / v), about 2.1% (w / v), about 2.2% (w / v), about 2.3% (w / v), about 2.4% (w / v), about 2.5% (w / v), about 2.6% (w / v), about 2.7% (w / v), about 2.8% (w / v), about 2.9% (w / v), or about 3% (w / v).
[0203] In some embodiments, the protein excipient is present at about 0.1% (w / v). In some embodiments, the protein excipient is present at about 0.2% (w / v). In some embodiments, the protein excipient is present at about 0.3% (w / v). In some embodiments, the protein excipient is present at about 0.4% (w / v). In some embodiments, the protein excipient is present at about 0.5% (w / v). In some embodiments, the protein excipient is present at about 0.6% (w / v). In some embodiments, the protein excipient is present at about 0.7% (w / v). In some embodiments, the protein excipient is present at about 0.8% (w / v). In some embodiments, the protein excipient is present at about 0.9% (w / v). In some embodiments, the proteinexcipient is present at about 1% (w / v). In some embodiments, the protein excipient is present at about 1.1% (w / v). In some embodiments, the protein excipient is present at about 1.2% (w / v). In some embodiments, the protein excipient is present at about 1.3% (w / v). In some embodiments, the protein excipient is present at about 1.4% (w / v). In some embodiments, the protein excipient is present at about 1.5% (w / v). In some embodiments, the protein excipient is present at about 1.6% (w / v). In some embodiments, the protein excipient is present at about 1.7% (w / v). In some embodiments, the protein excipient is present at about 1.8% (w / v). In some embodiments, the protein excipient is present at about 1.9% (w / v). In some embodiments, the protein excipient is present at about 2.0% (w / v). In some embodiments, the protein excipient is present at about 2.1% (w / v). In some embodiments, the protein excipient is present at about 2.2% (w / v). In some embodiments, the protein excipient is present at about 2.3% (w / v). In some embodiments, the protein excipient is present at about 2.4% (w / v). In some embodiments, the protein excipient is present at about 2.5% (w / v). In some embodiments, the protein excipient is present at about 2.6% (w / v). In some embodiments, the protein excipient is present at about 2.7% (w / v). In some embodiments, the protein excipient is present at about 2.8% (w / v). In some embodiments, the protein excipient is present at about 2.9% (w / v). In some embodiments, the protein excipient is present at about 3.0% (w / v).
[0204] In some embodiments, the protein excipient is present at about 0.5%. In some embodiments, the protein excipient is present at about 1%.
[0205] In some embodiments, the protein excipient is a recombinant human serum albumin. The recombinant human serum albumin may be produced from any source. Methods of making recombinant human serum albumin are known in the art, and any such method is within the scope of the present application. In some embodiments, human serum albumin is recombinantly produced from a bacteria source (e.g. bacteria cells). In some embodiments, recombinant human serum albumin is recombinantly produced from an insect source (e.g. insect cells). In some embodiments, recombinant human serum albumin is recombinantly produced from a mammalian source (e.g. mammalian cells). In some embodiments, recombinant human serum albumin is recombinantly produced from a plant source. For example, the albumin can be produced from a plant, such as monocot. One non- limiting example of a monocot that can be used is rice. Examples of such production systems are found in U.S. Patent Nos. 10,618,951 ; 7,304,208; and 8,686,225, which are hereby incorporated by reference in their entirety. In some embodiments, the albumin comprises a plant glycosyl group, which can be referred to as a plant glycosylated human serum albumin protein.
[0206] In some embodiments, the recombinant human serum albumin is any recombinant human serum albumin. In some embodiments, the recombinant human serum albumin is plant glycosylated human serum albumin. In some embodiments, the human serum albumin is free of blood (e.g., human blood) or animal contaminants. This can be achieved by producing the HSA in a plant, such as a monocot or rice as provided for herein. In some embodiments, the recombinant human serum albumin is sold under the names of Exbumin® (recombinant human albumin-Invitria), Cellastim S (recombinant human serum albumin- Invitria), Albagen (recombinant human albumin - Albumin Bioscience), Recombumin (recombinant human albumin - Albumedix), or Optibumin (recombinant human albumin - Invitria). In some embodiments, the recombinant human serum albumin is Exbumin®. In some embodiments, the recombinant human serum albumin is Cellastim S. In some embodiments, the recombinant human serum albumin is Albagen. In some embodiments, the recombinant human serum albumin is Recombumin. In some embodiments, the recombinant human serum albumin is Optibumin.
[0207] In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 3% (w / v), or any value or range in-between. In some embodiments, the recombinant human serum albumin is present at about 0.2% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.3% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.4% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.5% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.6% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.7% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.8% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.9% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.2% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1 .4% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.5% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.6% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.8% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2% (w / v) toabout 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.2% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.4% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.5% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.6% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.8% (w / v) to about 3% (w / v).
[0208] In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 2.8% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 2.6% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 2.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 2.4% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 2.2% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 2.0% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 1.8% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 1.6% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1 % (w / v) to about 1.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 1.4% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 1.2% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 1.0% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.9% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.8% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.7% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.6% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.4% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) toabout 0.3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v) to about 0.2% (w / v).
[0209] In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v), about 0.2% (w / v), about 0.3% (w / v), about 0.4% (w / v), about 0.5% (w / v), about 0.6% (w / v), about 0.7% (w / v), about 0.8% (w / v), about 0.9% (w / v), about 1% (w / v), about 1.1% (w / v), about 1.2% (w / v), about 1.3% (w / v), about 1.4% (w / v), about 1.5% (w / v), about 1.6% (w / v), about 1.7% (w / v), about 1.8% (w / v), about 1.9% (w / v), about 2% (w / v), about 2.1% (w / v), about 2.2% (w / v), about 2.3% (w / v), about 2.4% (w / v), about 2.5% (w / v), about 2.6% (w / v), about 2.7% (w / v), about 2.8% (w / v), about 2.9% (w / v), or about 3% (w / v).
[0210] In some embodiments, the recombinant human serum albumin is present at about 0.1% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.2% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.4% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.6% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.7% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.8% (w / v). In some embodiments, the recombinant human serum albumin is present at about 0.9% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.1 % (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.2% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.4% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.6% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.7% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.8% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1.9% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.1% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.2% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.3% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.4% (w / v). In some embodiments, the recombinant human serum albumin is presentat about 2.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.6% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.7% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.8% (w / v). In some embodiments, the recombinant human serum albumin is present at about 2.9% (w / v). In some embodiments, the recombinant human serum albumin is present at about 3% (w / v).
[0211] In some embodiments, the recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the recombinant human serum albumin is present at about 1% (w / v).
[0212] In some embodiments, the protein excipient is a plant recombinant human serum albumin. In some embodiments, the plant recombinant human serum albumin is any plant recombinant human serum albumin as provided for herein. In some embodiments, the plant recombinant human serum albumin is Exbumin®. In some embodiments, the protein excipient is Exbumin®.
[0213] In some embodiments, the Exbumin® is present at about 0.1% (w / v) to 3% (w / v), or any value or range in-between. In some embodiments, the Exbumin® is present at about 0.2% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.3% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.4% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.5% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.6% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.7% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.8% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.9% (w / v) to about 3%(w / v). In some embodiments, the Exbumin® is present at about 1% (w / v) to about 3% (w / v).In some embodiments, the Exbumin® is present at about 1.2% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 1.4% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 1.5% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 1.6% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 1.8% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 2% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 2.2% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 2.4% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 2.5% (w / v) to about 3% (w / v). In someembodiments, the Exbumin® is present at about 2.6% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 2.8% (w / v) to about 3% (w / v).
[0214] In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 3% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 2.8% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about2.6% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about2.5% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about2.4% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about2.2% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 2%(w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 1.8% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 1.6% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 1.5% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 1.4%(w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 1.2%(w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 1 % (w / v).In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.9% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.8% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.7% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.6% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.5% (w / v). In some embodiments, the Exbumin® is present at about 0.1 % (w / v) to about 0.4% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.3% (w / v). In some embodiments, the Exbumin® is present at about 0.1% (w / v) to about 0.2% (w / v).
[0215] In some embodiments, the Exbumin® is present at about 0.1% (w / v), about 0.2% (w / v), about 0.3% (w / v), about 0.4% (w / v), about 0.5% (w / v), about 0.6% (w / v), about 0.7% (w / v), about 0.8% (w / v), about 0.9% (w / v), about 1% (w / v), about 1.1% (w / v), about 1.2% (w / v), about 1.3% (w / v), about 1.4% (w / v), about 1.5% (w / v), about 1.6% (w / v), about 1.7% (w / v), about 1.8% (w / v), about 1.9% (w / v), about 2% (w / v), about 2.1% (w / v), about 2.2% (w / v), about 2.3% (w / v), about 2.4% (w / v), about 2.5% (w / v), about 2.6% (w / v), about 2.7% (w / v), about 2.8% (w / v), about 2.9% (w / v), or about 3% (w / v).
[0216] In some embodiments, the Exbumin® is present at about 0.1% (w / v). In some embodiments, the Exbumin® is present at about 0.2% (w / v). In some embodiments, the Exbumin® is present at about 0.3% (w / v). In some embodiments, the Exbumin® is present at about 0.4% (w / v). In some embodiments, the Exbumin® is present at about 0.5% (w / v). Insome embodiments, the Exbumin® is present at about 0.6% (w / v). In some embodiments, the Exbumin® is present at about 0.7% (w / v). In some embodiments, the Exbumin® is present at about 0.8% (w / v). In some embodiments, the Exbumin® is present at about 0.9% (w / v). In some embodiments, the Exbumin® is present at about 1% (w / v). In some embodiments, the Exbumin® is present at about 1.1% (w / v). In some embodiments, the Exbumin® is present at about 1.2% (w / v). In some embodiments, the Exbumin® is present at about 1.3% (w / v). In some embodiments, the Exbumin® is present at about 1.4% (w / v). In some embodiments, the Exbumin® is present at about 1.5% (w / v). In some embodiments, the Exbumin® is present at about 1.6% (w / v). In some embodiments, the Exbumin® is present at about 1.7% (w / v). In some embodiments, the Exbumin® is present at about 1.8% (w / v). In some embodiments, the Exbumin® is present at about 1.9% (w / v). In some embodiments, the Exbumin® is present at about 2.0% (w / v). In some embodiments, the Exbumin® is present at about 2.1% (w / v). In some embodiments, the Exbumin® is present at about 2.2% (w / v). In some embodiments, the Exbumin® is present at about 2.3% (w / v). In some embodiments, the Exbumin® is present at about 2.4% (w / v). In some embodiments, the Exbumin® is present at about 2.5% (w / v). In some embodiments, the Exbumin® is present at about 2.6% (w / v). In some embodiments, the Exbumin® is present at about 2.7% (w / v). In some embodiments, the Exbumin® is present at about 2.8% (w / v). In some embodiments, the Exbumin® is present at about 2.9% (w / v). In some embodiments, the Exbumin® is present at about 3.0% (w / v).
[0217] In some embodiments, Exbumin® is present at about 0.5% (w / v). In some embodiments, Exbumin® is present at about 1 % (w / v).
[0218] In some embodiments, the protein excipient is non-recombinant human serum albumin. In some embodiments, the non-recombinant human serum albumin is any non- recombinant human serum albumin. In some embodiments, the non-recombinant human serum albumin is FDA approved, USP grade non-recombinant human serum albumin. The FDA approved, USP grade non-recombinant human serum albumin may be obtained via any appropriate commercial vendor, such as but not limited to, Nova, Octapharma, Grifols Bio Supplies, and the like.
[0219] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 3% (w / v), or any value or range in-between. In some embodiments, the non-recombinant human serum albumin is present at about 0.2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.3% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.4% (w / v) to about 3% (w / v). In some embodiments, thenon-recombinant human serum albumin is present at about 0.5% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.6% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.7% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.8% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.9% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1 % (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.4% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.5% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.6% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.8% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.4% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.5% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.6% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.8% (w / v) to about 3% (w / v).
[0220] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0. 1 % (w / v) to about 2.0% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.8% (w / v). In someembodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.0% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0. 1 % (w / v) to about 0.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0. 1 % (w / v) to about 0.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.2% (w / v).
[0221] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v), about 0.2% (w / v), about 0.3% (w / v), about 0.4% (w / v), about 0.5% (w / v), about 0.6% (w / v), about 0.7% (w / v), about 0.8% (w / v), about 0.9% (w / v), about 1% (w / v), about 1.1% (w / v), about 1.2% (w / v), about 1.3% (w / v), about 1.4% (w / v), about 1.5% (w / v), about 1.6% (w / v), about 1.7% (w / v), about 1.8% (w / v), about 1.9% (w / v), about 2% (w / v), about 2.1% (w / v), about 2.2% (w / v), about 2.3% (w / v), about 2.4% (w / v), about 2.5% (w / v), about 2.6% (w / v), about 2.7% (w / v), about 2.8% (w / v), about 2.9% (w / v), or about 3% (w / v).
[0222] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.4% (w / v). In some embodiments, the non- recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.7% (w / v). In someembodiments, the non-recombinant human serum albumin is present at about 0.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.6% (w / v). In some embodiments, the non- recombinant human serum albumin is present at about 1.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.8% (w / v). In some embodiments, the non- recombinant human serum albumin is present at about 2.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 3% (w / v).
[0223] In some embodiments, the non-recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1% (w / v).
[0224] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer; a pharmaceutically acceptable salt; a sugar; and a protein excipient, wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0225] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 5 mM toabout 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0226] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 50 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 2% (w / v) to about 5% (w / v); and (v) a protein excipient in an amount of about 0.1% (w / v) to about 2% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0227] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 40 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 300 mM; a sugar in an amount of about 3% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 1% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0228] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 200 mM; a sugar in an amount of about 3% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1 % (w / v) to about 1 % (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0229] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 200 mM; a sugar in an amount of about 3% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 1% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0230] In various embodiments, a pharmaceutical composition comprises: a lentiviral vector; a pharmaceutically acceptable buffer at a concentration of about 20mM; a pharmaceutically acceptable salt at a concentration of about 150mM; a sugar in an amount of about 4% (w / v); and a protein excipient in an amount of about 0.5% (w / v), wherein the pharmaceutical composition has a pH of about 7.0.
[0231] In some embodiments, the lentiviral vector is a pseudotyped lentiviral vector. Exemplary viral structural proteins that may be used for pseudotyping the lentiviral vectors provided for herein may be found at least in WO2023 / 064884, WO2023 / 114698, WO2023 / 114884, WO2023 / 154858, and WO2024 / 026284, each of which are incorporated herein by reference in their entirety. In some embodiments, the lentiviral vector is a VSV-G pseudotyped lentivirus. In some embodiments, the VSV-G pseudotyped lentivirus is as provided for herein.
[0232] In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about l.OE+05to l.OE+09TUs / mL.
[0233] In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+05to about 1.0E+O9TUs / mL, about 1.0E+05to about 1.0E+08TUs / mL, about I.OE+05to about 1.0E+07TUs / mL, about l.OE+05to about I.OE+06TUs / mL, about l.OE+06to about l.OE+09TUs / mL, about l.OE+06to about 1.0E+08TUs / mL, about l.OE+06to about l.OE+07TUs / mL, about l.OE+07to about l.OE+09TUs / mL, about l.OE+07to about l.OE+08TUs / mL, or about l.OE+08to about 1.0E+O9TUs / mL.
[0234] In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+05to about 1.0E+09TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+05to about l.OE+08TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about I.OE+05to about l.OE+07TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+05to about 1.0E+O6TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about l.OE+06to about l.OE+09TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+06to about l.OE+08TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+O6to about I.0E+07TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about l.OE+07to about 1.0E+09TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1.0E+07to about 1.0E+O8TUs / mL. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about l.OE+08to about I.OE+09TUs / mL.
[0235] In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least LOE+0. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 2.0E+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 3.0E+05. In some embodiments, the VSV-Gpseudotyped lentivirus is present at a concentration of at least 4.OE+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 5.0E+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 6.OE+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 7.OE+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 8.0E+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 9.OE+05. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least l.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 2.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 3.0E+Ofi. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 4.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 5.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 6.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 7.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 8.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 9.OE+06. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least l.OE+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 2.OE+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 3.0E+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 4.OE+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 5.0E+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 6.OE+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 7.OE+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 8.0E+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 9.OE+07. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least l.OE+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 2.OE+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 3.0E+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 4.OE+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 5.0E+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 6.0E+08. In someembodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 7.OE+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 8.0E+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least 9.OE+08. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of at least l.OE+09.
[0236] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus; about 10 mM to about 30 mM of L-Histidine; about 100 mM to about 400 mM of sodium chloride; about 1% (w / v) to about 5% (w / v) of sucrose; and about 0.1% (w / v) to about 3% (w / v) of non- recombinant human serum albumin, wherein the pharmaceutical composition has a pH of about 5.5 to about 8.0.
[0237] In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration as provided for herein. In some embodiments, the VSV-G pseudotyped lentivirus is present at a concentration of about 1 ,0E+05to about 1.0E+09as provided for herein.
[0238] In some embodiments, the L-Histidine is present at a concentration of about 10 mM to about 30 mM, or any value or range therein. In some embodiments, the L- Histidine is present at a concentration of about 15 mM to about 30 mM. In some embodiments, the L-Histidine is present at a concentration of about 20 mM to about 30 mM. In some embodiments, the L-Histidine is present at a concentration of about 25 mM to about 30 mM. In some embodiments, the L-Histidine is present at a concentration of about 10 mM to about 25 mM. In some embodiments, the L-Histidine is present at a concentration of about 10 mM to about 20 mM. In some embodiments, the L-Histidine is present at a concentration of about 10 mM to about 15 mM.
[0239] In some embodiments, the L-Histidine is present at a concentration of about 10 mM. In some embodiments, the L-Histidine is present at a concentration of about 11 mM. In some embodiments, the L-Histidine is present at a concentration of about 12 mM. In some embodiments, the L-Histidine is present at a concentration of about 13 mM. In some embodiments, the L-Histidine is present at a concentration of about 14 mM. In some embodiments, the L-Histidine is present at a concentration of about 15 mM. In some embodiments, the L-Histidine is present at a concentration of about 16 mM. In some embodiments, the L-Histidine is present at a concentration of about 17 mM. In some embodiments, the L-Histidine is present at a concentration of about 18 mM. In some embodiments, the L-Histidine is present at a concentration of about 19 mM. In some embodiments, the L-Histidine is present at a concentration of about 20 mM. In someembodiments, the L-Histidine is present at a concentration of about 25 mM. In some embodiments, the L-Histidine is present at a concentration of about 30 mM.
[0240] In some embodiments, the pharmaceutical composition has a pH of about 5.5 to about 8, or any value or range therein. In some embodiments, the pharmaceutical composition has a pH of about 6 to about 8. In some embodiments, the pharmaceutical composition has a pH of about 6.5 to about 8. In some embodiments, the pharmaceutical composition has a pH of about 7 to about 8. In some embodiments, the pharmaceutical composition has a pH of about 7.5 to about 8. In some embodiments, the pharmaceutical composition has a pH of about 6 to about 7.5. In some embodiments, the pharmaceutical composition has a pH of about 6 to about 7. In some embodiments, the pharmaceutical composition has a pH of about 6 to about 6.5.
[0241] In some embodiments, the pharmaceutical composition has a pH of about 6. In some embodiments, the pharmaceutical composition has a pH of about 6.5. In some embodiments, the pharmaceutical composition has a pH of about 7. In some embodiments, the pharmaceutical composition has a pH of about 7.5. In some embodiments, the pharmaceutical composition has a pH of about 8.
[0242] In some embodiments, the L-Histidine is present at about 10 mM to about 25 mM and the pharmaceutical composition has a pH of about 6 to about 7.
[0243] In some embodiments, the L- Histidine is present at about 14 mM and the pharmaceutical composition has a pH of about 7.0.
[0244] In some embodiments, the L-Histidine is present at about 20 mM and the pharmaceutical composition has a pH of about 7.0.
[0245] In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 400 mM, or any value or range therein. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 390 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 380 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 370 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 360 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 350 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 340 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 330 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 320 mM. In some embodiments, the sodium chloride is present at a concentration of about 100mM to about 310 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 300 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 290 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 280 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 270 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 260 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 250 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 240 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 230 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 220 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 210 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 190 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 180 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 170 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 160 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 150 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 140 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 130 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 120 mM. In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 110 mM.
[0246] In some embodiments, the sodium chloride is present at a concentration of about 110 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 120 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 130 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 140 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 150 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 160 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 170 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 180 mM to about 400 mM. In some embodiments, the sodium chlorideis present at a concentration of about 190 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 200 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 210 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 220 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 230 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 240 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 250 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 260 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 270 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 280 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 290 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 300 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 310 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 320 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 330 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 340 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 350 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 360 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 370 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 380 mM to about 400 mM. In some embodiments, the sodium chloride is present at a concentration of about 390 mM to about 400 mM.
[0247] In some embodiments, the sodium chloride is present at a concentration of about 100 mM to about 200 mM. In some embodiments, the sodium chloride is present at a concentration of about 125 mM to about 175 mM.
[0248] In some embodiments, the sodium chloride is present at a concentration of about 100 mM. In some embodiments, the sodium chloride is present at a concentration of about 110 mM. In some embodiments, the sodium chloride is present at a concentration of about 120 mM. In some embodiments, the sodium chloride is present at a concentration of about 125 mM. In some embodiments, the sodium chloride is present at a concentration of about 130 mM. In some embodiments, the sodium chloride is present at a concentration ofabout 140 mM. In some embodiments, the sodium chloride is present at a concentration of about 150 mM. In some embodiments, the sodium chloride is present at a concentration of about 160 mM. In some embodiments, the sodium chloride is present at a concentration of about 170 mM. In some embodiments, the sodium chloride is present at a concentration of about 175 mM. In some embodiments, the sodium chloride is present at a concentration of about 180 mM. In some embodiments, the sodium chloride is present at a concentration of about 190 mM. In some embodiments, the sodium chloride is present at a concentration of about 200 mM.
[0249] In some embodiments, sodium chloride is present at a concentration of about 150 mM.
[0250] In some embodiments, sucrose is present at about 1% (w / v) to about 5%(w / v), or any value or range therein. In some embodiments, sucrose is present at about 1% (w / v) to about 4% (w / v). In some embodiments, sucrose is present at about 1% (w / v) to about 3% (w / v). In some embodiments, sucrose is present at about 1% (w / v) to about 2% (w / v). In some embodiments, sucrose is present at about 2% (w / v) to about 5% (w / v). In some embodiments, sucrose is present at about 3% (w / v) to about 5% (w / v). In some embodiments, sucrose is present at about 4% (w / v) to about 5% (w / v). In some embodiments, sucrose is present at about 1% (w / v). In some embodiments, sucrose is present at about 2% (w / v). In some embodiments, sucrose is present at about 3% (w / v). In some embodiments, sucrose is present at about 4% (w / v). In some embodiments, sucrose is present at about 5% (w / v).
[0251] In some embodiments, sucrose is present at about 4% (w / v).
[0252] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 3% (w / v), or any value or range in-between. In some embodiments, the non-recombinant human serum albumin is present at about 0.2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.3% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.4% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.5% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.6% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.7% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.8% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.9% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1 % (w / v)to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.1% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.3% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.4% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.5% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.6% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.7% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.8% (w / v) to about 3% (w / v). In some embodiments, the non -recombinant human serum albumin is present at about 1.9% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.1% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.2% (w / v) to about 3% (w / v). In some embodiments, the non -recombinant human serum albumin is present at about 2.3% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.4% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.5% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.6% (w / v) to about 3% (w / v). In some embodiments, the non -recombin ant human serum albumin is present at about 2.7% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.8% (w / v) to about 3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.9% (w / v) to about 3% (w / v).
[0253] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 3.0% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.4% (w / v). In some embodiments, the non-recombinanthuman serum albumin is present at about 0.1% (w / v) to about 2.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 2.0% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.0% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1 % (w / v) to about 0.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0. 1 % (w / v) to about 0.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 0.2% (w / v).
[0254] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v), about 0.2% (w / v), about 0.3% (w / v), about 0.4% (w / v), about 0.5% (w / v), about 0.6% (w / v), about 0.7% (w / v), about 0.8% (w / v), about 0.9% (w / v), about 1% (w / v), about 1.1% (w / v), about 1.2% (w / v), about 1.3% (w / v), about 1.4% (w / v), about 1.5% (w / v), about 1.6% (w / v), about 1.7% (w / v), about 1.8% (w / v), about 1.9% (w / v), about2% (w / v), about 2.1% (w / v), about 2.2% (w / v), about 2.3% (w / v), about 2.4% (w / v), about 2.5% (w / v), about 2.6% (w / v), about 2.7% (w / v), about 2.8% (w / v), about 2.9% (w / v), or about 3% (w / v).
[0255] In some embodiments, the non-recombinant human serum albumin is present at about 0.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.4% (w / v). In some embodiments, the non- recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 0.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.6% (w / v). In some embodiments, the non- recombinant human serum albumin is present at about 1.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.1% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.2% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.3% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.4% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.6% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.7% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.8% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 2.9% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 3% (w / v).
[0256] In some embodiments, the non-recombinant human serum albumin is present at about 0.5% (w / v). In some embodiments, the non-recombinant human serum albumin is present at about 1% (w / v).
[0257] In some embodiments, the lentiviral vector is a VSV-G pseudotyped lentivirus. In some embodiments, the VSV-G pseudotyped lentivirus is as provided for herein. In some embodiments, the VSV-G pseudotyped lentivirus comprises a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2, as provided for herein. In some embodiments, the VSV-G pseudotyped lentivirus comprises a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2, as provided for herein. In some embodiments, the mutation at position 182 is as provided for herein. In some embodiments, the mutation at position 182 is 182A as provided for herein. In some embodiments, the mutation at position 182 is 182E as provided for herein. In some embodiments, the mutation at position 182 is 182D as provided for herein. In some embodiments, the mutation at position 214 is as provided for herein. In some embodiments, the mutation at position 214 is 214N as provided for herein. In some embodiments, the mutation at position 352 is as provided for herein. In some embodiments, the mutation at position 352 is 352A as provided for herein.
[0258] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0259] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2, wherein the mutation at position 182 corresponds to 182A, 182E, or 182D; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0260] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2, wherein the mutation at position 182 corresponds to 182E; L- Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v) ; and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0261] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2, wherein the mutation at position 182 corresponds to 182D; L- Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v) ; and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0262] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a I182E, T214N, and / or T352A mutation as compared to SEQ ID NO: 2; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0263] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a I182E, T214N, and T352A mutation as compared to SEQ ID NO:2; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v) ; and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0264] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lenti virus comprising a VSV- G polypeptide comprising a I182D, T214N, and / or T352A mutation as compared to SEQ ID NO: 2; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0265] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising a I182D, T214N, and T352A mutation as compared to SEQ ID NO: 2; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v) ; and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0266] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, or SEQ ID NO: 25; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0267] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, or SEQ ID NO: 25; a pharmaceutically acceptable buffer at a concentration of about5 mM to about 50 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0268] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, or SEQ ID NO: 25; a pharmaceutically acceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM ; a sugar in an amount of about 1 % (w / v) to about 5 % (w / v) ; and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0269] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, or SEQ ID NO: 25; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0270] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0271] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 50 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount ofabout 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0272] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22; a pharmaceutically acceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0273] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 22; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0274] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 23; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0275] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 23; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 50 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0276] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 23; a pharmaceuticallyacceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0277] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 23; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0278] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 24; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0279] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 24; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 50 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0280] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 24; a pharmaceutically acceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0281] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 24; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); and non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0282] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 25; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0283] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 25; a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 50 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1 % (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0. 1 % (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0.
[0284] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 25; a pharmaceutically acceptable buffer at a concentration of about 10 mM to about 30 mM; a pharmaceutically acceptable salt at a concentration of about 100 mM to about 400 mM; a sugar in an amount of about 1% (w / v) to about 5% (w / v); and a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
[0285] In some embodiments, a pharmaceutical composition is provided, the pharmaceutical composition comprising a VSV-G pseudotyped lentivirus comprising a VSV- G polypeptide comprising an amino acid sequence of SEQ ID NO: 25; L-Histidine buffer at a concentration of about 10 mM to about 30 mM; sodium chloride at a concentration of about 100 mM to about 400 mM; sucrose in an amount of about 1% (w / v) to about 5% (w / v); andnon-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5. In some embodiments, the non-recombinant human serum albumin is as provided for herein.
[0286] As provided for herein, the pharmaceutical composition can have a pH of about 5.5 to about 8.0, or about 6.0 to about 8.0, or any value or range in between. The composition can have a pharmaceutically acceptable buffer, such as those provided for herein, to maintain the pH. When preparing the composition, the pH of the composition can be adjusted to the selected pH by the addition of an acid or base as appropriate. For example, in some embodiments, HC1 or another appropriate acid can be added to adjust the pH to make it more acidic, and NaOH or another appropriate base can be added to adjust the pH to be more basic such that the composition has a final pH of about 5.5 to about 8.0. or about 6.0 to about 8.0, or any value or range therein as provided for herein. Appropriate acids are known in the art and include, but are not limited to, hydrochloric acid (HC1), acetic acid (C2H4O2), and sulfuric acid (H2SO4). Appropriate bases are known in the art and include, but are not limited to sodium hydroxide (NaOH), potassium hydroxide (KOH), trisodium phosphate (Na3PO4), potassium carbonate (K2CO3), and sodium carbonate (Na2CO3). The acids and bases provided herein are exemplary only and are not meant to be limiting in any way. Appropriate acids and bases are known in the art and any such acid or base is within the scope of the present disclosure. In some embodiments, the acid is hydrochloric acid. In some embodiments, the base is sodium hydroxide.VIRAL VECTORS
[0287] In some embodiments, the lentiviral vector of the present disclosure is a pseudotyped viral vector. In some embodiments, the pseudotyped viral vector is a VSV-G pseudotyped lentivirus. In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G polypeptide or protein.
[0288] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 1 or at position 182 as compared to SEQ ID NO: 2. SEQ ID NO: 1 is the full length protein and SEQ ID NO: 2 is the ectodomain of the VSV-G protein. The 16-mer signal peptide of MKCLLYLAFLFIGVNC (SEQ ID NO: 65) as shown at the N-terminus of SEQ ID NO: 1 is cleaved leaving a protein of SEQ ID NO: 2. Thus, although a mutation may be referred to in the context of SEQ ID NO: 2, it should be understood to also be made in the context of SEQ ID NO: 1, which contains the leader sequence, and thus would be a position number that is 16more than the position recited for SEQ ID NO: 2. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a I182D mutation as compared to SEQ ID NO: 2. In some embodiments, the mutation is a I182E mutation as compared to SEQ ID NO: 2.
[0289] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 10 or at position 182 as compared to SEQ ID NO: 11. SEQ ID NO: 10 is the full length protein and SEQ ID NO: 11 is the ectodomain of the VSV-G protein. The 16-mer signal peptide of MLSYLIFALVVSPILG (SEQ ID NO: 66) as shown at the N-terminus of SEQ ID NO: 10 is cleaved leaving a protein of SEQ ID NO: 11. Thus, although a mutation may be referred to in the context of SEQ ID NO: 11, it should be understood to also be made in the context of SEQ ID NO: 10, which contains the leader sequence, and thus would be a position number that is 16 more than the position recited for SEQ ID NO: 11. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a T182D mutation as compared to SEQ ID NO: 11. In some embodiments, the mutation is a T182E mutation as compared to SEQ ID NO: 11.
[0290] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 12 or at position 182 as compared to SEQ ID NO: 13. SEQ ID NO: 12 is the full length protein and SEQ ID NO: 13 is the ectodomain of the VSV-G protein. The 16-mer signal peptide of MLRLFLFCFLALGAHS (SEQ ID NO: 67) as shown at the N-terminus of SEQ ID NO: 12 is cleaved leaving a protein of SEQ ID NO: 13. Thus, although a mutation may be referred to in the context of SEQ ID NO: 13, it should be understood to also be made in the context of SEQ ID NO: 12, which contains the leader sequence, and thus would be a position number that is 16 more than the position recited for SEQ ID NO: 13. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a A182D mutation as compared to SEQ ID NO: 13. In some embodiments, the mutation is a A182E mutation as compared to SEQ ID NO: 13.
[0291] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 203 as compared to SEQ ID NO: 14 or at position 182 as compared to SEQ ID NO: 15. SEQ ID NO: 14 is the full length protein and SEQ ID NO: 15 is the ectodomain of the VSV-G protein. The 21-mer signal peptide of MKMKMVIAGLILCIGILPAIG (SEQ ID NO: 68) as shown at the N-terminus of SEQ ID NO: 14 is cleaved leaving a protein of SEQ ID NO: 15. Thus, although a mutation may be referredto in the context of SEQ ID NO: 15, it should be understood to also be made in the context of SEQ ID NO: 14, which contains the leader sequence, and thus would be a position number that is 21 more than the position recited for SEQ ID NO: 15. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a V182D mutation as compared to SEQ ID NO: 15. In some embodiments, the mutation is a V182E mutation as compared to SEQ ID NO: 15.
[0292] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 16 or at position 182 as compared to SEQ ID NO: 17. SEQ ID NO: 16 is the full length protein and SEQ ID NO: 17 is the ectodomain of the VSV-G protein. The 17-mer signal peptide of MTPAFILCMLLAGSSWA (SEQ ID NO: 69) as shown at the N-terminus of SEQ ID NO: 16 is cleaved leaving a protein of SEQ ID NO: 17. Thus, although a mutation may be referred to in the context of SEQ ID NO: 17, it should be understood to also be made in the context of SEQ ID NO: 16, which contains the leader sequence, and thus would be aposition number that is 17 more than the position recited for SEQ ID NO: 17. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a V182D mutation as compared to SEQ ID NO: 17. In some embodiments, the mutation is a V182E mutation as compared to SEQ ID NO: 17.
[0293] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 18 or at position 182 as compared to SEQ ID NO: 19. SEQ ID NO: 18 is the full length protein and SEQ ID NO: 19 is the ectodomain of the VSV-G protein. The 17-mer signal peptide of MNFLLLTFIVLPLCSHA (SEQ ID NO: 70) as shown at the N-terminus of SEQ ID NO: 18 is cleaved leaving a protein of SEQ ID NO: 19. Thus, although a mutation may be referred to in the context of SEQ ID NO: 19, it should be understood to also be made in the context of SEQ ID NO: 18, which contains the leader sequence, and thus would be a position number that is 17 more than the position recited for SEQ ID NO: 19. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a V182D mutation as compared to SEQ ID NO: 19. In some embodiments, the mutation is a V182E mutation as compared to SEQ ID NO: 19.
[0294] In some embodiments, the VSV-G psuedotyped lentivirus comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 20 or at position 182 as compared to SEQ ID NO: 21. SEQ ID NO: 20 is the full length protein and SEQ ID NO: 21 is the ectodomain of the VSV-G protein. The 17-mer signal peptide ofMLVLYLLLSLLALGAQC (SEQ ID NO: 71) as shown at the N-terminus of SEQ ID NO: 20 is cleaved leaving a protein of SEQ ID NO: 21. Thus, although a mutation may be referred to in the context of SEQ ID NO: 21, it should be understood to also be made in the context of SEQ ID NO: 20, which contains the leader sequence, and thus would be a position number that is 17 more than the position recited for SEQ ID NO: 21. In some embodiments, the mutation inhibits or decreases the binding of the VSV-G protein to the LDL receptor (LDL-R). In some embodiments, the mutation is a I182D mutation as compared to SEQ ID NO: 21. In some embodiments, the mutation is a I182E mutation as compared to SEQ ID NO: 21.
[0295] As used herein, when a protein or polypeptide is said to have a mutation as compared to a reference sequence, such comparison is based on an alignment such as using BlastP or ClustalW or ClutalOmega alignment software using default parameters. For example, position 182 can be found in SEQ ID NO: 2 and also as compared to the other strains as illustrated in FIG. 3. FIG. 3 illustrates a clustal alignment of the wild- type sequences of the ectodomains of the various strains of the VSV-G protein. The residue that is bolded and underlined are the residues that align to position 182 of SEQ ID NO: 2 of the various strains. SEQ ID NO: 2 refers to ectodomain of the VSV-G protein of the Indiana strain. SEQ ID NO: 11 refers to ectodomain of the VSV-G protein of the New lersey strain. SEQ ID NO: 13 refers to ectodomain of the VSV-G protein of the Marraba strain. SEQ ID NO: 15 refers to ectodomain of the VSV-G protein of the Carajas strain. SEQ ID NO: 17 refers to ectodomain of the VSV-G protein of the Alagoa strain. SEQ ID NO: 19 refers to ectodomain of the VSV- G protein of the Cocal strain. SEQ ID NO: 21 refers to ectodomain of the VSV-G protein of the Morreton strain. Accordingly, the residue that aligns to residues 182 as compared to SEQ ID NO: 2 can also be mutated as provided for herein.
[0296] In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 2 is not an alanine. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 2 is not a valine.
[0297] In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 2 is I182S, I182H, I182T, I182Q, or I182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 11 is T182S, T182H, T182Q, or T182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 13 is A182S, A182H, A182T, A182Q, or A182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 15 is V182S, V182H, V182T, V182Q, or V182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 17 is V182S, V182H, V182T, V182Q, or V182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO:19 is V182S, V182H, V182T, V182Q, or V182N. In some embodiments, the mutation at position 182 as compared to SEQ ID NO: 21 is I182S, I182H, I182T, I182Q, or I182N. In some embodiments, the mutation at position 182 is not a hydrophobic residue. In some embodiments, the mutation at position 182 is a charged residue. In some embodiments, the mutation at position 182 is a negatively charged residue.
[0298] Although, the mutations may be described in reference to SEQ ID NO: 1 or SEQ ID NO: 2, which is the VSV-G protein from the Indiana strain, the mutation can also be used in other strains of the VSV-G protein. For example, the mutation can be made in the New Jersey Strain of VSV-G, the Marraba strain of VSV-G, the Carajas strain of VSV-G, the Alagoa strain of VSV-G, the Cocal strain of VSV-G, or the Morreton strain of VSV-G. In some embodiments, the sequences of each are as provided herein. Examples of these can be found, for example in U.S. Patent Application Publication No. 20200216502, which is hereby incorporated by reference. For example, the wild-type full length or ectodomain of the New Jersey Strain of VSV-G are SEQ ID NO: 10 and SEQ ID NO: 11, respectively, the wild-type full length or ectodomain of Marraba strain of VSV-G are SEQ ID NO: 12 and SEQ ID NO: 13, respectively, the wild-type full length or ectodomain of Carajas strain of VSV-G are SEQ ID NO: 14 and SEQ ID NO: 15, respectively, the wild-type full length or ectodomain of Alagoa strain of VSV-G are SEQ ID NO: 16 and SEQ ID NO: 17, respectively, the wild-type full length or ectodomain of Cocal strain of VSV-G are SEQ ID NO: 18 and SEQ ID NO: 19, respectively, or the wild-type full length or ectodomain of Morreton strain of VSV-G are SEQ ID NO: 20 and SEQ ID NO: 21 , respectively.
[0299] A VSV-G protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 can also comprise other mutations, such as those described in U.S. Patent Application Publication No. 20200216502, which is hereby incorporated by reference in its entirety. For example, the VSV-G protein can comprise a mutation at a position that corresponds to positions of 8, 47, 209 and / or 354 of SEQ ID NO: 2.
[0300] In some embodiments, the substitution at position 8 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except Y. In some embodiments, the substitution at position 209 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except H. In some embodiments, the substitution at position 47 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution at position 354 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R.
[0301] In some embodiments, the substitution is at position 47 or at position 354, or at both positions 47 and 354 are substituted by A, G, F or Q. In some embodiments, the substitution is A or Q.
[0302] In some embodiments, the substitution at position 8 is an alanine, i.e., H8A.
[0303] In some embodiments, the substitution at position 47 is Q or N, i.e., K47Q or K47N.
[0304] In some embodiments, the protein comprises a mutation (substitution) at position 10. In some embodiments, the substitution / mutation is Q10A, Q10R, or Q10K.
[0305] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 2 (or SEQ ID NO: 1 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or I182E mutation. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation.
[0306] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 11 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 1 1 (or SEQ ID NO: 10 if using the full length protein). In some embodiments, the polypeptide comprises a T182D or T182E mutation. In some embodiments, the VSV-G protein comprises a T182S, T182H, T182Q, or T182N mutation.
[0307] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 13 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 13 (or SEQ ID NO: 12 if using the full length protein). In some embodiments, the polypeptide comprises a A182D or A182E mutation. In some embodiments, the VSV-G protein comprises a A182S, A182H, A182T, A182Q, or A182N mutation.
[0308] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 15 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%,86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 15 (or SEQ ID NO: 14 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation.
[0309] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 17 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 17 (or SEQ ID NO: 16 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation. In some embodiments, the VSV-G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation.
[0310] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 19 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 19 (or SEQ ID NO: 18 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation. In some embodiments, the VSV-G protein comprises a VI82S, V182H, VI82T, V182Q, or V182N mutation.
[0311] In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 21 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 21 (or SEQ ID NO: 20 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or I182E mutation. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation.Viral Glycoproteins
[0312] The mutant VSV-G proteins can be used, for example, to pseudotype a virus, such as, but not limited to a lenti virus. Accordingly, in some embodiments, a viral vector comprising a mutant VSV-G protein as provided herein is provided. In some embodiments,the viral vector comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 1. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 2 (or SEQ ID NO: 1 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or I182E mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation.
[0313] In some embodiments, the viral vector comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 10. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 11 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 11 (or SEQ ID NO: 10 if using the full length protein). In some embodiments, the polypeptide comprises a T182D or T182E mutation as compared to SEQ ID NO: 11. In some embodiments, the VSV- G protein comprises a T182S, T182H, T182Q, or T182N mutation.
[0314] In some embodiments, the viral vector comprises a VSV-G protein comprising a mutation at position 198 as compared to SEQ ID NO: 12. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 13 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 13 (or SEQ ID NO: 12 if using the full length protein). In some embodiments, the polypeptide comprises a Al 82D or Al 82E mutation as compared to SEQ ID NO: 13. In some embodiments, the VSV- G protein comprises a A182S, A182H, A182T, A182Q, or A182N mutation.
[0315] In some embodiments, the viral vector comprises a VSV-G protein comprising a mutation at position 203 as compared to SEQ ID NO: 14. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 15 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 15 (or SEQ ID NO: 14 if using the full length protein). In some embodiments, the polypeptide comprisesa V182D or V182E mutation as compared to SEQ ID NO: 15. In some embodiments, the VSV- G protein comprises a VI 82S, V 182H, V 182T, V 182Q, or V 182N mutation.
[0316] In some embodiments, the viral vector comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 16. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 17 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 17 (or SEQ ID NO: 16 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation as compared to SEQ ID NO: 17. In some embodiments, the VSV- G protein comprises a VI 82S, V 182H, V 182T, V 182Q, or V 182N mutation.
[0317] In some embodiments, the viral vector comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 18. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 19 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 19 (or SEQ ID NO: 18 if using the full length protein). In some embodiments, the polypeptide comprises a V182D or V182E mutation as compared to SEQ ID NO: 19. In some embodiments, the VSV- G protein comprises a V182S, V182H, V182T, V182Q, or V182N mutation.
[0318] In some embodiments, the viral vector comprises a VSV-G protein comprising a mutation at position 199 as compared to SEQ ID NO: 20. In some embodiments, a protein comprising a mutation at position 182 as compared to SEQ ID NO: 21 comprises a mutation at position 182 and at least, or about, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical as compared to SEQ ID NO: 21 (or SEQ ID NO: 20 if using the full length protein). In some embodiments, the polypeptide comprises a I182D or I182E mutation as compared to SEQ ID NO: 21. In some embodiments, the VSV- G protein comprises a I182S, I182H, I182T, I182Q, or I182N mutation.
[0319] In some embodiments, the VSV-G protein further comprises a mutation at position that corresponds to positions 214 and / or 352 of SEQ ID NO: 2. In some embodiments, the residue that corresponds to position 214 of SEQ ID NO: 2 is T214. In some embodiments, the residue that corresponds to position 352 of SEQ ID NO: is T352. In some embodiments, the VSV-G protein comprises mutation that corresponds to T214N mutation ascompared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises mutation that corresponds to T352A mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises a T214N and T352A mutations as compared to SEQ ID NO: 2. These mutations can be combined with any other mutations as provided for herein. In some embodiments, the T214N and / or T352A mutations are combined with the I182E or I182D mutations. In some embodiments, a VSV-G protein comprises an amino acid sequence of SEQ ID NO: 22 and SEQ ID NO: 23, which combines the I182D or I182E, respectively, with the T214N and T352A mutations. The sequences are also illustrated below with the leader sequences, which are removed during protein processing.VSV-G Protein_ I196D, T230N and T368A mutations (with leader sequence and adjusted numbering)VSV-G Protein_I182D, T214N and T352A mutations (without leader sequence)VSV-G Protein with I196E, T230N and T368A mutations (with leader sequence and adjusted numbering)VSV-G Protein with I182E, T214N and T352A mutations (without leader sequences)
[0320] In some embodiments, the VSV-G protein comprising a mutation at position 182 as compared to SEQ ID NO: 2 further comprises a mutation at position that corresponds to positions 38 and / or 320 or SEQ ID NO: 2. In some embodiments, the residue that corresponds to position 38 of SEQ ID NO: 2 is T38. In some embodiments, the residue that corresponds to position 320 of SEQ ID NO: 2 is T320. In some embodiments, the VSV- G protein comprises mutation that corresponds to T38A mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises mutation that corresponds to T320A mutation as compared to SEQ ID NO: 2. In some embodiments, the VSV-G protein comprises a T38A and T320A mutations as compared to SEQ ID NO: 2. These mutations can be combined with any other mutations as provided for herein.
[0321] In some embodiments, the other strains of the VSV-G protein as described herein can further comprise one or more mutations corresponding to any of the other mutations as compared to SEQ ID NO: 2 and as provided for herein. For example, the other strains of the VSV-G protein as described herein can also comprises the mutations that correspond to T38A, T214N, T320A, and / or T352A in SEQ ID NO: 2. In some embodiments,the other strains of the VSV-G protein as described herein can also comprises the mutations that correspond to T214N and / or T352A in SEQ ID NO: 2 and as illustrated in SEQ ID NO: 22 and SEQ ID NO: 23.
[0322] In some embodiments, the composition comprises a mutation as described in Hwang et al., Gene Ther 2013 Aug;20(8):807-15. (Epub 2013 Jan 31), which is hereby incorporated by reference in its entirety. For example, the mutations can be. at positions 230, 368, 66, and / or 162 that corresponds to SEQ ID NO: 1. The positions will be 16 positions less as compared to SEQ ID NO: 2, when the leader sequence is removed. In some embodiments, the mutations at those positions are, for example, T230N, T368A, K66T, S 162T, or any combination thereof. In some embodiments, the VSV-G protein comprises a T230N and a T368A mutation. In some embodiments, the VSV-G polypeptide comprises a K66T, S162T, T230N, and a T368A. These positions are those that correspond to the positions in the full length protein (SEQ ID NO: 1). In some embodiments, the VSV-G protein comprises T230N mutation, a T368A mutation, a K66T mutation, a S162T mutation, or any combination thereof. In some embodiments, the VSV-G protein further comprises one or more mutations in addition to the mutation that corresponds to position 182 of SEQ ID NO: 2, such as those described in U.S. Patent Application Publication No. 20200216502, which is hereby incorporated by reference in its entirety. For example, the VSV-G protein can further comprise a mutation at a position that corresponds to positions of 8, 47, 209 and / or 354 of SEQ ID NO: 2.
[0323] In some embodiments, the substitution at position 8 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except Y. In some embodiments, the substitution at position 209 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except H. In some embodiments, the substitution at position 47 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution at position 354 is by any amino acid different from the amino acid indicated at that position in the sequence SEQ ID NO: 2, except K or R. In some embodiments, the substitution is at position 47 or at position 354, or at both positions 47 and 354 are substituted by A, G, F or Q. In some embodiments, the substitution is A or Q. In some embodiments, the substitution at position 8 is an alanine, i.e., H8A. In some embodiments, the substitution at position 47 is Q or N, i.e., K47Q or K47N. In some embodiments, the protein comprises a mutation (substitution) at position 10. In some embodiments, the substitution / mutation is Q10A, Q10R, or QlOK.Additional Viral Glycoproteins
[0324] The preceding embodiments are to be understood to be exemplary only and are not meant to be construed as limiting in any way. Additional or alternative VSV-G proteins and modified VSV-G proteins (i.e. those containing at least one mutation as compared to the parent strain) are known and any such VSV-G protein is within the scope of the present disclosure. Suitable examples of additional VSV-G proteins and modified VSV-G proteins may be found at least in WO2022 / 183072, WO2024 / 145593, WO2024 / 145599, WO2024 / 145605, WO2024 / 145622, US 2024 / 0150788 and US 2024 / 0218390, each of which are incorporated by reference in their entirety. The following embodiments provide exemplary additional or alternative VSV-G and modified VSV-G proteins that are within the scope of the present disclosure.
[0325] In some embodiments, a mutated VSV-G envelope protein comprises one or more of: one or more amino acid substitutions at H8, N9, Q10, K47, K50, A51, S183, S179, N180, 1182, Ml 84, Y209, 1347, T35O, T352, E353, and R354 (substitution with any amino acid; a conservation substitution; a disruptive substitution; substitution with D, E, A, G, F, or Q; or substitution with A, G, F, or Q); an insertion of TT between N9 and Q 10, an insertion of GGS between H8 and N9, an insertion of GGS between N9 and Q10, an insertion of TT between N208 and Y209, an insertion of GGS between P46 and K47, and an insertion of GGS between N208 and Y209; or a deletion of residues 1-8. In some embodiments, a VSV-G envelope protein comprises one or more amino acid substitutions at H8, K47, Y209, and R354. In some embodiments, a VSV-G envelope protein comprises one or more amino acid substitutions at H8, K47, Y209, and R354, wherein each substitution can be with A, G, F, or Q. Amino acid positions are with reference to a VSV-G envelope protein that lacks a signal peptide, e.g., SEQ ID NO: 2. In some embodiments, a mutated viral envelope glycoprotein is derived from a VSV-G polypeptide set forth in SEQ ID NO: 2 comprising L47I and / or H80Q amino acid substitutions, such substitutions present in naturally occurring variants of VSV.
[0326] In some embodiments, a mutated VSV-G polypeptide comprises one or more amino acid substitutions at K47, 1182, and / or R354 (substitution with any amino acid; a conservation substitution; a disruptive substitution; substitution with D, E, A, G, F, or Q; or substitution with A, G, F, or Q). In some embodiments, a mutated VSV-G polypeptide comprises amino acid substitutions at K47, 1182, or R354; K47 and 1182; K47 and R354; 1182 and R354; or at K47, 1182, and R354 of SEQ ID NO: 2.
[0327] In some embodiments, a mutated VSV-G polypeptide comprises one or more of the following amino acid substitutions: K47A, K47Q, I182E, I182D, R354A, and / or R354Q. In particular embodiments, a mutated VSV-G polypeptide comprises the following amino acid substitutions: K47A, K47Q, I182E, I182D, R354A, or R354Q; K47A and I182E; K47A and I182D; K47Q and I182E; K47Q and I182D; I182E and R354A; I182E and R354Q; I182D and R354A; I182D and R354Q; K47A and R354A; K47A and R354Q; K47Q and R354A; K47Q and R354Q; K47A, I182E, and R354A; K47A, I182D, and R354A; K47Q, I182E, and R354A; K47Q, I182D, and R354A; K47A, I182E, and R354Q; K47A, I182D, and R354Q; K47Q, I182E, and R354Q; or K47Q, I182D, and R354Q of SEQ ID NO: 2.
[0328] In some embodiments, a VSV-G envelope protein comprises one or more amino acid substitutions at H8, K47, Y209, and R354. In some embodiments, a VSV- G envelope protein comprises one or more amino acid substitutions at H8, K47, Y209, and R354, wherein each substitution can be with A, G, F, or Q. In some embodiments, a VSV-G envelope protein comprises one or more amino acid substitutions at K47 and R354 (with reference to a VSV-G envelope protein that lacks a signal peptide, e.g., SEQ ID NO: 2). In some embodiments, a VSV-G envelope protein comprises one or more amino acid substitutions selected from the group consisting of: K47A and R354A; K47A and R354G; K47A and R354F; K47A and R354Q; K47G and R354A; K47G and R354G; K47G and R354F; K47G and R354Q;K47F and R354A; K47F and R354G; K47F and R354F; K47F and R354Q; K47Q and R354A; K47Q and R354G; K47Q and R354F; and K47Q and R354Q. In some embodiments, a VSV-G envelope comprises the amino acid substitutions K47Q or K47A and R354A or R354Q. Amino acid positions are with reference to a VSV-G envelope protein that lacks a signal peptide.
[0329] In some In particular embodiments, a VSV-G envelope protein comprises an amino acid sequence set forth in SEQ ID NO: 159:wherein X1= I, X2= A, X3= Q, and X4= A; X1= I, X2= A, X3= Q, and X4= G; X1= I, X2=A, X3= Q, and X4=F; X1= I, X2=A, X3= Q, and X4= Q; X1= L, X2= A, X3= Q, and X4= A; X1= L, X2= A, X3= Q, and X4= G; X1= L, X2= A, X3= Q, and X4= F; X1= L, X2= A, X3= Q, and X = Q; X1= I, X2= A, X3= H, and X = A; X1= I, X2= A, X3= H, and X = G; X1= I, X2= A, X3= H, and X4= F; X1= I, X2= A, X3= H, and X4= Q; X1= L, X2= A, X3= H, and X4= A; X1= L, X2= A, X3= H, and X4= G; X1= L, X2= A, X3= H, and X4= F; X1= L, X2= A, X3= H, and X4= Q; X1= I, X2= G, X3= Q, and X4= A; X1= I, X2= G, X3= Q, and X4= G; X1= I, X2= G, X3= Q, and X4= F; X1= I, X2= G, X3= Q, and X4= Q; X1= L, X2= G, X3= Q, and X4= A; X1= L, X2= G, X3= Q, and X4= G; X1=L, X2= G, X3= Q, and X4= F; X1= L, X2= G, X3= Q, and X4= Q; X1= I, X2= G, X3= H, and X4= A; X1= I, X2= G, X3= H, and X4= G; X1= I, X2= G, X3= H, and X4= F; X1= I, X2= G, X3= H, and X4= Q; X1= L, X2= G, X3= H, and X4= A; X1= L, X2= G, X3= H, and X4= G; X1= L, X2= G, X3= H, and X4= F; X1= L, X2= G, X3= H, and X4= Q; X1= I, X2= F, X3= Q, and X4= A; X1= I, X2= F, X3= Q, and X4= G; X1= I, X2= F, X3= Q, and X4= F; X1= I, X2= F, X3= Q, and X4= Q; X1= L, X2= F, X3= Q, and X4= A; X1= L, X2= F, X3= Q, and X4= G; X1= L, X2= F, X3= Q, and X4= F; X1= L, X2= F, X3= Q, and X4= Q; X1= I, X2= F, X3= H, and X4= A; X1= I, X2= F, X3=H, and X4= G; X1= I, X2= F, X3= H, and X4= F; X1= I, X2= F, X3= H, and X4= Q; X1= L, X2= F, X3= H, and X4= A; X1= L, X2= F, X3= H, and X4= G; X1= L, X2= F, X3= H, and X4= F; X1= L, X2= F, X3= H, and X4= Q; X1= I, X2= Q, X3= Q, and X4= A; X1= I, X2= Q, X3= Q, and X4= G; X1= I, X2= Q, X3= Q, and X4=F; X1= I, X2= Q, X3= Q, and X4= Q; X1= L, X2= Q, X3= Q, and X4= A; X1= L, X2= Q, X3= Q, and X4= G; X1= L, X2= Q, X3= Q, and X4= F; X1= L, X2= Q, X3= Q, and X4= Q; X1= I, X2= Q, X3= H, and X4= A; X1= I, X2= Q, X3= H, and X4= G; X1= I, X2= Q, X3= H, and X4= F; X1= I, X2= Q, X3= H, and X4= Q; X1= L, X2= Q, X3= H, and X4= A; X1= L, X2= Q, X3= H, and X4= G; X1= L, X2= Q, X3= H, and X4= F; and X1= L, X2= Q, X3= H, and X4= Q; or an amino acid sequence at least 95%, 96%, 97%, 98%, or 99% identical thereto that mediates fusion of the viral particle and the target host cell but that does not bind its cognate receptor expressed on the target host cell, e.g., LDL-R.
[0330] In some embodiments, a mutated VSV-G envelope protein comprises an amino acid sequence set forth in any one of SEQ ID NOs: 160-230 or an amino acid sequence at least 95%, 96%, 97%, 98%, or 99% identical thereto that mediates fusion of the viral particle and a cell but that substantially ablates or ablates the polypeptide's ability to bind its cognate receptor expressed on a cell, e.g., LDL-R. In some embodiments, a mutated VSV-G envelope protein comprises an amino acid sequence set forth in any one of SEQ ID NOs: 208-223 or anamino acid sequence at least 95%, 96%, 97%, 98%, or 99% identical thereto that mediates fusion of the viral particle and a cell but that substantially ablates or ablates the polypeptide's ability to bind its cognate receptor expressed on a cell, e.g., LDL-R. In some embodiments, a mutated VSV-G envelope protein comprises an amino acid sequence set forth in any one of SEQ ID NOs: 208, 212, 216, and 220 or an amino acid sequence at least 95%, 96%, 97%, 98%, or 99% identical thereto that mediates fusion of the viral particle and a cell but that substantially ablates or ablates the polypeptide's ability to bind its cognate receptor expressed on a cell, e.g., LDL-R.
[0331] Additionally, in some embodiments, instead of the VSV-G protein or mutant thereof, the viruses can be pseudotyped with other viral structural proteins. Suitable examples of alternate viral structural proteins may be found at least in WO2023 / 064884, WO2023 / 114698, WO2023 / 114884, and WO2023 / 154858, each of which are incorporated by reference in their entirety.Targeting Moieties
[0332] In some embodiments, the viral vector comprises a targeting moiety. The targeting moiety can be used to target the viral vector comprising the mutant VSV-Gprotein to a cell that expresses the target to which the targeting moiety binds to. In some embodiments, the targeting moiety is an antibody, a scFv antibody, an antigen binding domain, an ankyrin repeat (e.g., DARPIN), a VHH domain antibody, a nanobody, single domain antibody, a FN3 domain, or any combination thereof. The targeting moiety can be attached to the viral surface through an IgG Fc stalk. In some embodiments, the stalk comprises a transmembrane domain. In some embodiments, the transmembrane domain comprises the CD28 transmembrane domain. In some embodiments, the targeting moiety is attached (fused or linked) an envelope glycoprotein G or H of a virus of the Paramyxoviridae family, such as a morbillivirus, such as Measles virus, or a henipavirus, such as Nipah virus, Cedar virus, or Hendra virus. In some embodiments, the targeting moiety can be attached (fused or linked) to a glycoprotein of a virus of the Rhabdoviridae family, such as a vesicular stomatitis New Jersey virus, a vesicular stomatitis Indiana virus, a vesicular stomatitis Alagoas virus, a vesicular stromatitis Maraba virus, a vesicular stomatitis Carajas virus, Parainfluenza virus, Spodoptera frugiperda rhabdovirus isolate Sf G, Drosophila obscura sigmavirus 10A, Wuhan insect virus 7, Perch virus, or Spring viremia of carp virus. In some embodiments, the VSV protein is the mutated proteins, such as those provided for herein. In some embodiments, the targeting moiety is attached to a glycoprotein of a virus of the Filoviridae family, such as Ebola virus or a glycoprotein of a virus of the Arenaviridae family, such as Machupo virus.
[0333] In some embodiments, the targeting moiety is a scFv. In some embodiments, the targeting moiety is a single domain antibody. In some embodiments, the targeting moiety is a VHH.
[0334] In some embodiments, the targeting moiety binds to CD7, CD8, cKit (CD 117), CD4, CD3, CD5, CD6, CD2, TCR alpha, TCR beta, TCR gamma, TCR delta, CD 10, CD34, CD110, CD33, CD14, CD68, CCR7, CD62L, CD25, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, or CXCR3, A glycosylated CD43 epitope expressed on acute leukemia or lymphoma but not on hematopoietic progenitors; A glycosylated CD43 epitope expressed on non-hematopoietic cancers; A kinase anchor protein 4 (AKAP-4); Adrenoceptor beta 3 (ADRB3); AFP; Anaplastic lymphoma kinase (ALK); Androgen receptor; Angiopoietin- binding cell surface receptor 2 (Tie 2); Asialoglycoprotein receptor (ASGPR); Auto antibody to desmoglein 1 (Dsgl); Auto antibody to desmoglein 3 (Dsg3); B7H3 (CD276); Biotin; Bone marrow stromal cell antigen 2 (BST2); BST1 / CD157; Cancer / testis antigen 1 (NY-ESO-1); Cancer / testis antigen 2 (LAGE-la); Carbonic anhydrase IX (CA1X); Carcinoembryonic antigen (CEA); CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS or Brother of the Regulator of Imprinted Sites); CCR4; CD5; CD19; CD20; CD22; CD24; CD30; CD32(FCGR2A); CD33; CD34; CD38; CD44v6; CD72; CD79a; CD79b; CD97; CD99; CD123; CD171; CD179a; CD179b-IGLll; CD200R; CD276 / B7H3; CD300 molecule-like family member f (CD300LF); CDH1-CD324; CDH6; CDH17; CDH19; Chromosome X open reading frame 61 (CXORF61); Claudin 6 (CLDN6); Claudinl8.2 (CLD18A2 or CLDN18A.2); CMV pp65; C-MYC epitope Tag; Cripto; CS1 (also referred to as CD2 subset 1 or CRACC or SLAMF7 or CD319 or 19A24); CSF2RA (GM-CSFR-alpha); C-type lectin domain family 12 member A (CLEC12A); C-type lectin-like molecule-1 (CLL-1 or CLECL1); Cyclin Bl; Cytochrome P450 IB 1 (CYP1B 1); DLL3; EBV-EBNA3c; EGF-bke module- containing mucin- like hormone receptor- like 2 (EMR2); Elongation factor 2 mutated (ELF2M); Ephrin B2; Ephrin type-A receptor 2 (EphA2); Epidermal growth factor receptor (EGFR); Epidermal growth factor receptor variant III (EGFRviii); Epithelial cell adhesion molecule (EPCAM); ERG; ETS translocation-variant gene 6 located on chromosome 12p (ETV6-AML); Fc fragment of IgA receptor (FCAR or CD89); Fc receptor-like 5 (FCRL5); Fibroblast activation protein alpha (FAP); FITC; Fms Like Tyrosine Kinase 3 (FLT3); Folate receptor alpha (FRa or FR1); Folate receptor beta (FRb); Follicle stimulating hormone receptor (FSHR); Fos- related antigen 1; Fucosyl-GMl; G protein coupled receptor class C group 5 member D (GPRC5D); G protein-coupled receptor 20 (GPR20); GAD; Ganglioside G2 (GD2) ; Ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(l-4 )bDGlcp(l-l)Cer); Ganglioside GM3 (aNeu5Ac(2-3)bDClalp(l- 4)bDGlcp(l-l)Cer); GD3; GFRalpha4; Glycoprotein 100 (gplOO); Glypican-3 (GPC3); Gonadotropin Hormone receptor (CGHR or GR); GpA33; GpNMB; GPRC5D; Guanylyl cyclase C (GCC); Heat shock protein 70-2 mutated (mut hsp70- 2); Hepatitis A virus cellular receptor 1 (HAVCR1); Hexasaccharide portion of globoH glycoceramide (GloboH); High molecular weight- melanoma associated antigen (HMWMAA); HIV1 envelope glycoprotein; HLA; HLA-DOA; HLA-A; HLA-A2; HLA-B; HLA-C; HLA- DM; HLA-DOB; HLA-DP; HLA-DQ; HLA-DR; HLA-G; HTLVl-Tax; Human papilloma virus E6 (HPV E6); Human papilloma virus E7 (HPV E7); Human Telomerase reverse transcriptase (hTERT); IgE; IL13Ra2; IL1 IRa; Immunoglobulin lambda- like polypeptide 1 (IGLL1); Influenza A hemagglutinin (HA); Insulin-like growth factor 1 receptor (IGF-I receptor); Interleukin 11 receptor alpha (IL-llRa); Interleukin- 13 receptor subunit alpha-2 (IL- 13Ra2 or CD213A2); Intestinal carboxyl esterase; KIT (CD117); KSHV K8.1; KSHV-gH; LAMP1 ; Legumain; Leukocyte immunoglobulin- like receptor subfamily A member 2 (LILRA2); Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Leutenizing hormone receptor (LHR); Lewis(Y) antigen; Lews Ag; Livl; Locus K 9 (LY6K); Low conductance chloride channel; Lymphocyte antigen 6 complex; Lymphocyte antigen 75(LY75); Lymphocyte- specific protein tyrosine kinase (LCK); Mammary gland differentiation antigen (NY-BR-1); Melanoma antigen recognized by T cells 1 (MelanA or MARTI); Melanoma- associated antigen 1 (MAGE-A1); Melanoma cancer testis antigen-1 (MAD-CT- 1); Melanoma cancer testis antigen-2 (MAD-CT-2); Melanoma inhibitor of apoptosis (ML- IAP); Mesothelin; MPL; Mucin 1 cell surface associated (MUC1); N-Acetyl glucosaminyl- transferase V (NA17); Nectin-4; Neural cell adhesion molecule (NCAM); NKG2D; NYBR1; O-acetyl-GD2 ganglioside (OAcGD2); Olfactory receptor 51E2 (OR51E2); Oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (Abl) (bcr-abl); P53 mutant; Paired box protein Pax-3 (PAX3); Paired box protein Pax-5 (PAX5); Pannexin 3 (PANX3); PDL1; P-glycoprotein; Placenta- specific 1 (PLAC1); Platelet-derived growth factor receptor beta (PDGFR-beta); Polysialic acid; Proacrosin binding protein sp32 (OY-TES1); Prostase; Prostate carcinoma tumor antigen- 1 (PCT A-l or Galectin 8); Prostate stem cell antigen (PSCA); Prostate-specific membrane antigen (PSMA); Prostatic acid phosphatase (PAP); Prostein; Protease Serine 21 (Testisin or PRSS21); Proteasome (Prosome Macropain) Subunit Beta Type 9 (LMP2); PTK7; Ras G12V; Ras Homolog Family Member C (RhoC); Rat sarcoma (Ras) mutant; Receptor for Advanced Gly cation Endproducts (RAGE-1); Receptor tyrosine kinase-like orphan receptor 1 (ROR1); Receptor tyrosine-protein kinase ERBB2 or Her-22 / neu; Renal ubiquitous 1 (RU1); Renal ubiquitous 2 (RU2); Sarcoma translocation breakpoints; Serine 2 (TMPRSS2) ETS fusion gene; Sialyl Lewis adhesion molecule (sLe); SLAMF4; SLAMF6; Slea (CA19.9 or Sialyl Lewis Antigen); Sperm protein 17 (SPA17); Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3); Stage-specific embryonic antigen-4 (SSEA-4); STEAP1; Survivin; Synovial sarcoma X breakpoint 2 (SSX2); TCR Gamma Alternate Reading Frame Protein (TARP); TCR-betal chain; TCR-beta2 chain; TCR-delta chain; TCR-gamma chain; TCRgamma-delta; Telomerase; TGFbetaR2; The antigen recognized by TNT antibody; Thyroid stimulating hormone receptor (TSHR); TimL / HVCRl ; Tissue Factor 1 (TF1); Tn ag; Tn antigen ((Tn Ag) or (GalNAca-Ser / Thr)); TNF receptor family member B cell maturation (BCMA); Transglutaminase 5 (TGS5); Transmembrane protease; TROP2; Tumor endothelial marker 1 (TEM1 / CD248); Tumor endothelial marker 7-related (TEM7R); Tumor protein p53 (p53); Tumor-associated glycoprotein 72 (TAG72); Tyrosinase; Tyrosinase-related protein 2 (TRP-2); Uroplakin 2 (UPK2); Vascular endothelial growth factor receptor 2 (VEGFR2); V- myc avian myelocy tomatosis viral oncogene neuroblastoma derived homolog (MY CN) ; Wilms tumor protein (WTl); or X Antigen Family Member 1 A (XAGE1). In some embodiments, the targeting moiety binds to CD7. In some embodiments, the targeting moiety binds to CD8.
[0335] In some embodiments, the targeting moiety binds to a target that is present on a cell, such as an immune cell. In some embodiments, the cell is an immune cell, such as, but not limited to, T cell, B cell; NK cell, dendritic cell, neutrophils, macrophages, a cancer cell; or, for example, CD3+ T cell; CD4+ T cell; CD7+ T cell, CD8+ T cell; CD19+ B cell; CD 19+ cancer cell; CD20+ B cell; CD20+ cancer cell; CD30+ lung epithelial cell; CD34+ haematopoietic stem cell; CD105+ endothelial cell; CD105+ haematopoietic stem cell; CD117+ haematopoietic stem cell; CD133+ cancer cell; EpCAM+ cancer cell; GluA2+ neuron; GluA4+ neuron; Haematopoietic stem cell; Hepatocyte; Her2 / Neu+ cancer cell; NKG2D+ natural killer cell; SLC1A3+ astrocyte; SLC7A10+ adipocyte. In some embodiments, the cell is a T cell. In some embodiments, the cell is a B cell. In some embodiments, the cell is a CD7+ T cell and / or CD8+ T cell.
[0336] In some embodiments, the targeting moiety (a polypeptide) can bind to CD7.
[0337] In some embodiments, the polypeptide binds to CD7. In some embodiments, the polypeptide that binds to CD7 is an antibody which binds to non-human primate CD7. In some embodiments, the polypeptide that binds to CD7 is an antibody which binds to human CD7. The sequence of human CD7 (UniProtKB P09564) is as follows (SEQ ID NO: 29):
[0338] In some embodiments, the CD7 antibody comprises a Fc region. The Fc region can be linked to the heavy or light chain of the antibody. The Fc region may be fused directly to the heavy or light chain of the antibody or may be fused indirectly to the heavy or light chain of the antibody via, for example, a peptide linker as provided for herein. In some embodiments, the Fc region is an IgG Fc. In some embodiments, the IgG is selected from IgG 1 , IgG2, lgG3, or lgG4. In some embodiments, the IgG fc is IgGl Fc. In some embodiments, the antibody comprises an Fc constant region of SEQ ID NO: 26 as set forth below:
[0339] In some embodiments, the IgG fc is IgG2 Fc. In some embodiments, the antibody comprises an Fc constant region of SEQ ID NO: 27 as set forth below:
[0340] In some embodiments, the IgG fc is IgG4 Fc. In some embodiments, the antibody comprises an Fc constant region of SEQ ID NO: 28 as set forth below:
[0341] In some embodiments, the IgG Fc is a variant of an IgGl Fc protein (SEQ ID NO: 26). In some embodiments, the variant IgGl Fc protein comprises one or more of the mutations that corresponds to those selected from the group consisting of: L234A, L235A, N297 A, P329G, 1253 A, H310A, and H43 A of SEQ ID NO: 26. Any of the mutations L234A, L235A, N297A, P329G, I253A, H310A, and H435A of SEQ ID NO: 26 may be present or absent and the mutations may be combined in any combination. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to L234A and L235A of SEQ ID NO: 26. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to N297A of SEQ ID NO: 26. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to P329G of SEQ ID NO: 26. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to L234A, L235A, N297A,and P329G of SEQ ID N: 83. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to I253A of SEQ ID NO: 26. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to H310A of SEQ ID NO: 26. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to H435A of SEQ ID NO: 26. In some embodiments, the variant IgGl Fc protein comprises a mutation that corresponds to I253A, H310A, and H435A of SEQ ID NO: 26.
[0342] In some embodiments, the IgG Fc is a variant of an IgG2 Fc protein (SEQ ID NO: 27). In some embodiments, the variant IgG2 Fc protein comprises one or more mutations selected from the group consisting of: N297A, P329G, 1253 A, H310A, and H435A as those position correspond to SEQ ID NO: 27. Any of the mutations N297A, P329G, I253A, H310A, and H435A of SEQ ID NO: 27 may be present or absent and the mutations may be combined in any combination. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to N297A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to P329G of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to N297A and P329G of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to I253A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to H310A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to H435A of SEQ ID NO: 27. In some embodiments, the variant IgG2 Fc protein comprises a mutation that corresponds to 1253 A, H310A, and H435A of SEQ ID NO: 27.
[0343] In some embodiments, the IgG Fc protein is a variant of an IgG4 Fc protein (SEQ ID NO: 28). In some embodiments, the variant IgG4 Fc protein comprises one or more mutations selected from the group consisting of: S228P, L235E, N297A, P329G, I253A, H310A, and H435A as those positions correspond to SEQ ID NO: 28. Any of the mutations S228P, L235E, N297A, P329G, 1253 A, H310A, and H435A of SEQ ID NO: 28 may be present or absent and the mutations may be combined in any combination. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to S228P of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to L235E of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to N297A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to P329G of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to S228P, L235E, N297A, and P329G of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fcprotein comprises a mutation that corresponds to I253A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to H310A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to H435A of SEQ ID NO: 28. In some embodiments, the variant IgG4 Fc protein comprises a mutation that corresponds to I253A, H310A, and H435A of SEQ ID NO: 28.
[0344] In some embodiments, the Fc region comprises a variant Fc polypeptide. In some embodiments, the variant Fc polypeptide is a variant Fc polypeptide as provided for in PCT Publication No. WO2024026284 which is hereby incorporated by reference in its entirety. In some embodiments, the variant Fc polypeptide comprises an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 82:
[0345] In some embodiments, the variant Fc polypeptide comprises an amino acid sequence of SEQ ID NO: 82.
[0346] In some embodiments, the targeting moiety binds to CD7 and comprises an HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3, VH, and VL as recited in Table 1 and Table 2 below:Table 1 - CD7 targeting moiety CD7AB1 CDR sequencesTable 2 - CD7 targeting moiety CD7AB1 Variable Regions
[0347] The VH and the VL sequences can be in any format, including, but not limited to an scFv format where the VH and VL regions are linked with a peptide linker. Examples of peptide linkers that can be used to link various peptides provided for herein include, but are not limited to: (GGGGS)n (SEQ ID NO: 64), wherein each n is independently 1-4. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, the variable regions are not linked with a peptide linker. In some embodiments, the polypeptide comprises SEQ ID NO: 42 and SEQ ID NO: 43. In some embodiments, the targeting moiety comprises a linked peptide represented by a formula of VL-Z-VH, wherein Z is a peptide linker. In some embodiments, the targeting moiety comprises a heavy chain variable region as set forth in SEQ ID NO: 42 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a light chain variable region as set forth in SEQ ID NO: 43. In some embodiments, a targeting moiety comprising a VL linked via a peptide linker to a Vnhas the sequence as set forth below:
[0348] In some embodiments, the targeting moiety comprises a linked peptide represented by a formula of VH-Z-VL, wherein Z is a peptide linker. In some embodiments, the targeting moiety comprises a heavy chain variable region as set forth in SEQ ID NO: 42 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a light chain variable region as set forth in SEQ ID NO: 43. In some embodiments, a targeting moiety comprising a Vn linked via a peptide linker to a Vrhas the sequence as set forth below:
[0349] In some embodiments, the targeting moiety (a polypeptide) can bind toCD8.
[0350] In some embodiments, the polypeptide binds to CD8. In some embodiments, the polypeptide binds to CD8-alpha. In some embodiments, the polypeptide binds to CD8-beta. In some embodiments, the polypeptide binds to CD8 heterodimer. In some embodiments, the CD8 heterodimer comprises CD8-alpha and CD8-beta subunits. In some embodiments, the polypeptide binds to CD8-alpha homodimer. In some embodiments, the polypeptide that binds to CD8 is an antibody which binds to non-human primate CD8. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8-alpha. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8-beta. In some embodiments, the antibody that binds to non-human primate CD8 is an antibody which binds to non-human primate CD8-alpha homodimer. In some embodiments, the antibody that binds to non-human primate CD 8 is an antibody which binds to non-human primate CD 8 heterodimer. In some embodiments, the polypeptide that binds to CD8 is an antibody which binds to human CD8. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8-alpha. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8-beta. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8-alpha homodimer. In some embodiments, the antibody that binds to human CD8 is an antibody which binds to human CD8 heterodimer. The sequence of human CD8-alpha (UniProtKB Q8TAW8) is as follows (SEQ ID NO: 46):
[0351] The sequence of human CD8-beta (UniProtKB Q8TD28) is as follows (SEQ ID NO: 47):
[0352] In some embodiments, the CD8 antibody comprises a Fc region. The Fc region can be linked to the heavy or light chain of the antibody. The Fc region may be fused directly to the heavy or light chain of the antibody or may be fused indirectly to the heavy or light chain of the antibody via, for example, a peptide linker as provided for herein. In some embodiments, the Fc region is an IgG Fc as provided for herein. In some embodiments, the IgG is selected from IgGl, IgG2, IgG3, or IgG4. In some embodiments, the IgG fc is IgGl Fc as provided for herein. In some embodiments, the antibody comprises an Fc constant region of SEQ ID NO: 26. In some embodiments, the IgG fc is IgG2 Fc as provided for herein. In some embodiments, the antibody comprises an Fc constant region of SEQ ID NO: 27. In some embodiments, the IgG fc is IgG4 Fc as provided for herein. In some embodiments, the antibody comprises an Fc constant region of SEQ ID NO: 28.
[0353] In some embodiments, the targeting moiety binds to CD8 and comprises an HCDR1, HCDR2, HCDR3, LCDRI, LCDR2, LCDR3, VH, and VL as recited in Table 3 and Table 4 below:Table 3 - CD8 targeting moiety CD8AB1 CDR sequencesTable 4 - CD8 targeting moiety CD8AB1 Variable Regions
[0354] The VH and the VL sequences can be in any format, including, but not limited to an scFv format where the VH and VL regions are linked with a peptide linker. Examples of peptide linkers that can be used to link various peptides provided for herein include, but are not limited to: (GGGGS)n (SEQ ID NO: 64), wherein each n is independently 1-4. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, the variable regions are not linked with a peptide linker. In some embodiments, the polypeptide comprises SEQ ID NO: 60 and SEQ ID NO: 61.
[0355] In some embodiments, the targeting moiety comprises a linked peptide represented by a formula of VL-Z-VH, wherein Z is a peptide linker. In some embodiments, the targeting moiety comprises a heavy chain variable region as set forth in SEQ ID NO: 60 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a light chain variable region as set forth in SEQ ID NO: 61. In some embodiments, a targeting moiety comprising a VL linked via a peptide linker to a Vnhas the sequence as set forth below:
[0356] In some embodiments, the targeting moiety comprises a linked peptide represented by a formula of VH-Z-VL, wherein Z is a peptide linker. In some embodiments, the targeting moiety comprises a heavy chain variable region as set forth in SEQ ID NO: 60 linked via a linker sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 72) to a light chain variable region as set forth in SEQ ID NO: 61 . In some embodiments, a targeting moiety comprising a Vn linked via a peptide linker to a VL. has the sequence as set forth below:
[0357] In some embodiments, the targeting moiety comprises an amino acid sequence having at least 70% identity to SEQ ID NO: 44, or is substantially similar to SEQ ID NO: 44, or is an active fragment of SEQ ID NO: 44. In some embodiments, the targeting moiety comprises an amino acid sequence having least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 44. In some embodiments, the targeting moiety comprises an amino acid sequence of SEQ ID NO: 44.
[0358] In some embodiments, the targeting moiety comprises an amino acid sequence having at least 70% identity to SEQ ID NO: 45, or is substantially similar to SEQ ID NO: 45, or is an active fragment of SEQ ID NO: 45. In some embodiments, the targeting moiety comprises an amino acid sequence having least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 45. In some embodiments, the targeting moiety comprises an amino acid sequence of SEQ ID NO: 45.
[0359] In some embodiments, the targeting moiety comprises an amino acid sequence having at least 70% identity to SEQ ID NO: 62, or is substantially similar to SEQ ID NO: 62, or is an active fragment of SEQ ID NO: 62. In some embodiments, the targeting moiety comprises an amino acid sequence having least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 62. In some embodiments, the targeting moiety comprises an amino acid sequence of SEQ ID NO: 62.
[0360] In some embodiments, the targeting moiety comprises an amino acid sequence having at least 70% identity to SEQ ID NO: 63, or is substantially similar to SEQ ID NO: 63, or is an active fragment of SEQ ID NO: 63. In some embodiments, the targeting moiety comprises an amino acid sequence having least 70%, at least 75%, at least 80%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 63. In some embodiments, the targeting moiety comprises an amino acid sequence of SEQ ID NO: 63.
[0361] In some embodiments, the targeting moiety as provided for herein is attached to the surface of the virus through a stalk portion, Si. In some embodiments, thetargeting moiety is represented by the formula T-S i , wherein T is a targeting moiety as provided for herein and S i is the stalk portion. In some embodiments, the stalk portion, S i , is as provided in PCT Publication No. WO2024026284, which is hereby incorporated by reference in its entirety. In some embodiments , the stalk portion, S i , comprises a variant Fc protein as provided for herein and is given by the formula L1-FC-L2-X1, wherein Li is a linker or absent; Fc is the variant Fc protein; L2 is a linker or absent; and X1is a polypeptide comprising a transmembrane domain. Thus, in some embodiments, the formula representing the targeting moiety may also be written T-L1-FC-L2-X1. In some embodiments, the stalk portion, Si, does not comprise a variant Fc region and is given by the formula L3-X1, wherein L3 is a flexible polypeptide linker and X1is a polypeptide comprising a transmembrane domain. Thus, in some embodiments, the formula representing the targeting moiety may also be written T-L3-X1. In some embodiments, the polypeptide comprising a transmembrane domain, X1, comprises a polypeptide having a formula of ECD-TM-ICD, wherein ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or is absent, TM is a transmembrane domain of a transmembrane protein, and ICD is an intracellular domain of a protein or is a protein that facilitates the incorporation of the targeting moiety into the envelope of the viral particle, or is absent. Accordingly, the formulas representing the targeting moieties linked to the stalk portions may also be written as T-LI-FC-L2-ECD-TM-ICD or T-L3-ECD-TM-ICD. Exemplary identities for Li, L2, L3, Fc, ECD, TM, and ICD may be found in PCT Publication No. WO2024026284, which is hereby incorporated by reference in its entirety.
[0362] In some embodiments, the targeting moiety comprises a formula of T- LI-FC-L2-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 62, or SEQ ID NO: 63. In some embodiments, Li is present and comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, Fc comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 82. In some embodiments, L2 is absent. In some embodiments, ECD comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 83:KIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 83)In some embodiments, T comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 84:FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 84)In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85:NRVRQGYS (SEQ ID NO: 85)
[0363] In some embodiments, the targeting moiety comprises a formula of T- LI-FC-L2-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence of SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 62, or SEQ ID NO: 63. In some embodiments, Li is present and comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, Fc comprises an amino acid sequence of SEQ ID NO: 82. In some embodiments, L2 is absent. In some embodiments, ECD comprises an amino acid sequence of SEQ ID NO: 83. In some embodiments, TM comprises an amino acid sequence of SEQ ID NO: 84. In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85.
[0364] In some embodiments, the targeting moiety comprises a formula of T- LI-FC-L2-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence of SEQ ID NO: 44 or SEQ ID NO: 45. In some embodiments, Li is present and comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, Fc comprises an amino acid sequence of SEQ ID NO: 82. In some embodiments, L2 is absent. In some embodiments, ECD comprises an amino acid sequence of SEQ ID NO: 83. In some embodiments, TM comprises an amino acid sequence of SEQ ID NO: 84. In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85.
[0365] In some embodiments, the targeting moiety comprises a formula of T- LI-FC-L2-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence of SEQ ID NO: 45. In some embodiments, Li is present and comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, Fc comprises an amino acid sequence of SEQ ID NO: 82. In some embodiments, L2 is absent. In some embodiments, ECD comprises an amino acid sequence of SEQ ID NO: 83. In some embodiments, TM comprises an amino acid sequence of SEQ ID NO: 84. In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85.
[0366] In some embodiments, the targeting moiety comprises a formula of T- L3-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 62, or SEQ ID NO: 63. In some embodiments, L3 comprises an amino acid sequence of SEQ ID NO: 64, wherein n is 1, 2, or 4. In some embodiments, ECD comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 86:FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 86)In some embodiments, TM comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 87:IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 87)In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85 or SEQ ID NO: 88:GGTETSQVAPA (SEQ ID NO: 88).
[0367] In some embodiments, the targeting moiety comprises a formula of T- L3-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence of SEQ ID NO:44, SEQ ID NO: 45, SEQ ID NO: 62, or SEQ ID NO: 63. In some embodiments, L3 comprises an amino acid sequence of SEQ ID NO: 64, wherein n is 1, 2, or 4. In some embodiments, ECD comprises an amino acid sequence of SEQ ID NO: 86. In some embodiments, TM comprises an amino acid sequence of SEQ ID NO: 87. In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85 or SEQ ID NO: 88.
[0368] In some embodiments, the targeting moiety comprises a formula of T- LB-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence of SEQ ID NO: 44 or SEQ ID NO: 45. In some embodiments, L3 comprises an amino acid sequence of SEQ ID NO: 64, wherein n is 1 , 2, or 4. In some embodiments, ECD comprises an amino acid sequence of SEQ ID NO: 86. In some embodiments, TM comprises an amino acid sequence of SEQ ID NO: 87. In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85 or SEQ ID NO: 88.
[0369] In some embodiments, the targeting moiety comprises a formula of T- L3-ECD-TM-ICD. In some embodiments, T comprises an amino acid sequence of SEQ ID NO:45. In some embodiments, L3 comprises an amino acid sequence of SEQ ID NO: 64, wherein n is 1, 2, or 4. In some embodiments, ECD comprises an amino acid sequence of SEQ ID NO: 86. In some embodiments, TM comprises an amino acid sequence of SEQ ID NO: 87. In some embodiments, ICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85 or SEQ ID NO: 88.
[0370] In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 89:In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 90% identity to SEQ ID NO: 89. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 95% identity to SEQ ID NO: 89. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 98% identity to SEQ ID NO: 89. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence of SEQ ID NO: 89.
[0371] In some embodiments, the targeting moiety comprising a formula of T- Si comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 90:In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 90% identity to SEQ ID NO: 90. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 95% identity to SEQ ID NO: 90. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 98% identity to SEQ ID NO: 90. In someembodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence of SEQ ID NO: 90.
[0372] In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 91:In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 90% identity to SEQ ID NO: 91. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 95% identity to SEQ ID NO: 91. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having 98% identity to SEQ ID NO: 91. In some embodiments, the targeting moiety comprising a formula of T-Si comprises an amino acid sequence of SEQ ID NO: 91.
[0373] In some embodiments, the viral vector comprising a mutant VSV-G protein as provided for herein and comprising a targeting moiety as provided for herein further comprises a nucleic acid molecule encoding for a heterologous molecule of interest or “cargo.” For example, heterologous molecule of interest is meant to refer to any product that may be encoded by a nucleic acid molecule. As non-limiting examples, “cargo” or “heterologous molecule of interest” may refer to an siRNA, an shRNA, a peptide, a polypeptide, a protein, a viral pay load, a viral genome, or a combination thereof. In some embodiments, the polypeptide is a chimeric antigen receptor (“CAR”).
[0374] A “chimeric antigen receptor” or “CAR” as used herein refers to an antigen-binding domain that is fused, directly, or indirectly (e.g. via a hinge or transmembrane domain to an intracellular signaling domain capable of activating or stimulating an immune cell. Most commonly, the CAR’s extracellular binding domain is composed of a single chain variable fragment (scFv) derived from fusing the variable heavy and light regions of a murine or humanized monoclonal antibody. Alternatively, scFvs may be used that are derived fromFab's (instead of from an antibody, e.g., obtained from Fab libraries). In various embodiments, this scFv is fused to a transmembrane domain and then to an intracellular signaling domain. However, the antigen binding domain can be any molecule that can bind to the to target on the cell. For example, the antigen binding domain of a CAR can be an antibody, a scFv antibody, an antigen binding domain, an ankyrin repeat (e.g. DARPIN), a VHH domain antibody, a nanobody, single domain antibody, a FN3 domain, or any combination thereof. In some embodiments, a CAR includes those that solely provide CD3(^ signals upon antigen binding. In some embodiments, the CAR includes those that provide both costimulation (e.g. CD28 or CD137) and activation (CD3 . In some embodiments, the CARs include those that provide multiple costimulation (e.g. CD28 and CD137) and activation (CD3Q. In various embodiments, the CAR is selected to have high affinity or avidity for the antigen. In some embodiments, the antigen-binding domain binds to CD 19. In some embodiments, the antigen- binding domain comprises a CD 19 antibody, or fragment thereof. In some embodiments, antibody fragments are as provided for herein, such as but not limited to a scFv antibody, an antigen binding domain, an ankyrin repeat (e.g. DARPIN), a VHH domain antibody, a nanobody, single domain antibody, a FN3 domain, or any combination thereof. In some embodiments, the CAR comprises the 4- IBB domain as well. These are merely illustrative in nature and are not limiting to the present embodiments and any chimeric antigen receptor can be delivered in conjunction with the viral particles and vectors provided for herein. These are non-limiting examples of CARs and any CAR construct could be encoded for by the nucleic acid molecule.
[0375] In some embodiments, the antigen-binding domain of the CAR comprises an antibody, or antigen binding fragment thereof, wherein the antibody or antigen binding fragment comprises a peptide selected from the following table, which illustrates the CDRs based on Chothia numbering.
[0376] In some embodiments, the antigen-binding domain of the CAR comprises a heavy or light chain CDR as provided in the tables above. In some embodiments, the antigen-binding domain of the CAR comprises a heavy or light chain CDR as provided in the tables above and binds to non-human primate CD 19. In some embodiments, the antigen-binding domain of the CAR comprises a heavy or light chain CDR as provided in the tables above and binds to human CD 19. In some embodiments, a polypeptide, the antigen-binding domain of the CAR comprises a light chain CDR having a sequence selected from SEQ ID NO: 95-97. In some embodiments, the antigen-binding domain of the CAR, comprises a light chain CDR having a sequence of SEQ ID NO: 95. In some embodiments, the antigen-binding domain of the CAR comprises a light chain CDR having a sequence of SEQ ID NO: 96. In some embodiments, the antigen-binding domain of the CAR comprises a light chain CDR having a sequence of SEQ ID NO: 97. In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain CDR having a sequence selected from SEQ ID NO: 92-94. In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain CDR having a sequence of SEQ ID NO: 92. In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain CDR having a sequence of SEQ ID NO: 93. In some embodiments, the antigen-binding domain of the CAR, comprises a heavy chain CDR having a sequence of SEQ ID NO: 94. The CDRs referenced in the embodiments throughout the present specification can be interchanged with the CDRs that are characterized by different formats, such as Kabat and IMGT.
[0377] In some embodiments, the antigen-binding domain of the CAR comprises a light chain variable region having a LCDR1, a LCDR2, and a LCDR3, wherein the LCDR1 has a sequence of SEQ ID NO: 95, the LCDR2 has a sequence of SEQ ID NO: 96, and the LCDR3 has a sequence of SEQ ID NO: 97.
[0378] In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain variable region having a HCDR1, a HCDR2, and a HCDR3, wherein the HCDR1 has a sequence of SEQ ID NO: 92, the HCDR2 has a sequence of SEQ ID NO: 93, and the HCDR3 has a sequence of SEQ ID NO: 94.
[0379] In some embodiments, the antigen-binding domain of the CAR comprises: (i) a light chain having any one of the foregoing recited combinations of LCDR1, LCDR2, and LCDR3 sequences; and (ii) a heavy chain having any one of the foregoing recited combinations of HCDR1, HCDR2, and HCDR3 sequences.
[0380] The different CDR motifs can be combined in any combination including those not depicted in the table above. For example, the following embodiments are provided as non-limiting examples of such combinations.
[0381] In some embodiments, the antigen-binding domain of the CAR comprises: (i) a light chain variable region comprising light chain CDR1, CDR2, and CDR3 sequences, wherein the light chain CDR1 sequence has the amino acid sequence of SEQ IDNO: 95; the light chain CDR2 has the amino acid sequence of SEQ ID NO: 96; and the light chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 97; and (ii) a heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 sequences, wherein the heavy chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 92; the heavy chain CDR2 sequence has the amino acid sequence of SEQ ID NO: 93; and the heavy chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 94; or variants of any of the foregoing.
[0382] Although the preceding paragraphs may make reference to CDRs under the Chothia system the equivalent CDR sequences can be used from the IMGT and Kabat designations.
[0383] In some embodiments, the light chain variable region CDR1 is replaced with any of the other light chain CDR1 sequences. In some embodiments, the light chain variable region CDR2 is replaced with any of the other light chain CDR2 sequences. In some embodiments, the light chain variable region CDR3 is replaced with any of the other light chain CDR3 sequences. In some embodiments, the heavy chain variable region CDR1 is replaced with any of the other heavy chain CDR1 sequences. In some embodiments, the heavy chain variable region CDR2 is replaced with any of the other heavy chain CDR2 sequences. In some embodiments, the heavy chain variable region CDR3 is replaced with any of the other heavy chain CDR3 sequences.
[0384] In some embodiments, the antigen-binding domain of the CAR comprises a VH domain, a VL domain, or a VH and a VL domain. In some embodiments, the VH domain comprises an amino acid sequence having at least 75%, 80%, 85%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 73, or any value or range in-between.In some embodiments, the VH domain comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 73. In some embodiments, the VH domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO: 73. In some embodiments, the VH domain comprises an amino acid sequence having at least 98% identity to SEQ ID NO: 73. In some embodiments, the VH domain comprises an amino acid sequence having at least 99% identity to SEQ ID NO: 73. In some embodiments, the VH domain comprises an amino acid sequence having the sequence of SEQ ID NO: 73.
[0385] In some embodiments, the VL domain comprises an amino acid sequence having at least 75%, 80%, 85%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 74, or any value or range in- between.In some embodiments, the VL domain comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 74. In some embodiments, the VL domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO: 74. In some embodiments, the VL domain comprises an amino acid sequence having at least 98% identity to SEQ ID NO: 74. In some embodiments, the VL domain comprises an amino acid sequence having at least 99% identity to SEQ ID NO: 74. In some embodiments, the VL domain comprises an amino acid sequence having the sequence of SEQ ID NO: 74.
[0386] In some embodiments, the antigen-binding domain of the CAR comprises a VH domain and a VL domain. In some embodiments, the VH and VL domain are not linked by a linker peptide. In some embodiments, the VH and VL domain are linked by a linker peptide, such as those as provided for herein, including but not limited to: (GGGGS)n (SEQ ID NO: 64), wherein each n is independently 1-5. In some embodiment n is 1. In some embodiment n is 2. In some embodiment n is 3. In some embodiment n is 4. In some embodiment n is 5.
[0387] In some embodiments, the antigen-binding domain of the CAR comprising a VH domain and a VL domain, wherein the VH domain comprises an amino acid sequence having at least 75%, 80%, 85%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 73, and the VL domain comprises an amino acid sequence having at least 75%, 80%, 85%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO: 74. In some embodiments, the antigen-binding domain of the CAR comprising a VH domain and a VL domain, wherein the VH domain comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 73, and the VL domain comprises an amino acid sequence having at least 85% identity to SEQ ID NO: 74. In some embodiments, the antigen-binding domain of the CAR comprising a VH domain and a VL domain, wherein the VH domain comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 73, and the VL domain comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 74. In some embodiments,the antigen-binding domain of the CAR comprising a VH domain and a VL domain, wherein the VH domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO: 73, and the VL domain comprises an amino acid sequence having at least 95% identity to SEQ ID NO: 74. In some embodiments, the antigen-binding domain of the CAR comprising a VH domain and a VL domain, wherein the VH domain comprises an amino acid sequence having at least 98% identity to SEQ ID NO: 73, and the VL domain comprises an amino acid sequence having at least 98% identity to SEQ ID NO: 74. In some embodiments, the antigen-binding domain of the CAR comprising a VH domain and a VL domain, wherein the VH domain comprises the amino acid sequence of SEQ ID NO: 73, and the VL domain comprises the amino acid sequence of SEQ ID NO: 74.
[0388] In some embodiments, the antigen-binding domain of the CAR comprises a formula of VH-Z-VL, wherein VH is a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 73, Z is a linker comprising the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 77), and VL is a light chain variable region comprising the amino acid sequence of SEQ ID NO: 74. In some embodiments, the antigen-binding domain of the CAR comprising a formula of VH-Z-VL has an amino acid sequence as set forth below:In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a sequence of SEQ ID NO: 75. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 90% identity to a sequence of SEQ ID NO: 75. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 95% identity to a sequence of SEQ ID NO: 75. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 98% identity to a sequence of SEQ ID NO: 75. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 99% identity to a sequence of SEQ ID NO: 75. In some embodiments, the antigen-binding domain of the CAR comprises the amino acid sequence of SEQ ID NO: 75.
[0389] In some embodiments, the antigen-binding domain of the CAR comprises a formula of VL-Z-VH, wherein VL is a light chain variable region comprising the amino acid sequence of SEQ ID NO: 74, Z is a linker comprising the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 77), and Vn is a light chain variable region comprising the amino acid sequence of SEQ ID NO: 73. In some embodiments, the antigen-binding domain of the CAR comprising a formula of VL-Z-VH has an amino acid sequence as set forth below:In some embodiments, the antigen -binding domain of the CAR comprises an amino acid sequence having at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a sequence of SEQ ID NO: 76. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 90% identity to a sequence of SEQ ID NO: 76. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 95% identity to a sequence of SEQ ID NO: 76. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 98% identity to a sequence of SEQ ID NO: 76. In some embodiments, the antigen-binding domain of the CAR comprises an amino acid sequence having at least 99% identity to a sequence of SEQ ID NO: 76. In some embodiments, the antigen-binding domain of the CAR comprises the amino acid sequence of SEQ ID NO: 76.
[0390] In some embodiments, the antigen-binding domain of the CAR comprises an antibody, or antigen binding fragment thereof, wherein the antibody or antigen binding fragment comprises a peptide selected from the following table, which illustrates the CDRs based on Chothia numbering.
[0391] In some embodiments, the antigen-binding domain of the CAR comprises a heavy or light chain CDR as provided in the tables above. In some embodiments,the antigen-binding domain of the CAR comprises a heavy or light chain CDR as provided in the tables above and binds to non-human primate CD 19. In some embodiments, the antigen- binding domain of the CAR comprises a heavy or light chain CDR as provided in the tables above and binds to human CD 19. In some embodiments, a polypeptide, the antigen-binding domain of the CAR comprises a light chain CDR having a sequence selected from SEQ ID NO: 101-103. In some embodiments, the antigen-binding domain of the CAR, comprises a light chain CDR having a sequence of SEQ ID NO: 101. In some embodiments, the antigen- binding domain of the CAR comprises a light chain CDR having a sequence of SEQ ID NO: 102. In some embodiments, the antigen-binding domain of the CAR comprises a light chain CDR having a sequence of SEQ ID NO: 103. In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain CDR having a sequence selected from SEQ ID NO: 98-100. In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain CDR having a sequence of SEQ ID NO: 98. In some embodiments, the antigen-binding domain of the CAR comprises a heavy chain CDR having a sequence of SEQ ID NO: 99. In some embodiments, the antigen-binding domain of the CAR, comprises a heavy chain CDR having a sequence of SEQ ID NO: 100. The CDRs referenced in the embodiments throughout...
Claims
What is Claimed:
1. A pharmaceutical composition comprising:(i) a lentiviral vector;(ii) a pharmaceutically acceptable buffer at a concentration of about 5 mM to about 100 mM ;(iii) a pharmaceutically acceptable salt at a concentration of about 100 mM to about 800 mM;(iv) a sugar in an amount of about 1% (w / v) to about 5% (w / v); and(v) a protein excipient in an amount of about 0.1% (w / v) to about 3% (w / v), wherein the pharmaceutical composition has a pH of about 6.0 to about 8.0; wherein the lentiviral vector comprises a nucleic acid molecule encoding for a chimeric antigen receptor (“CAR”) comprising an antigen binding domain that binds to CD19.
2. The pharmaceutical composition of claim 1, wherein the lentiviral vector is present at a concentration of about 1.0E+05to about l.OE+09TUs / mL.
3. The pharmaceutical composition of claim 1, wherein the pharmaceutically acceptable buffer is histidine buffer, HEPES, phosphoric acid buffer, citric acid buffer, acetic acid buffer, succinic acid buffer, phosphate buffer, acetate buffer, citrate buffer, succinate buffer, ascorbic acid buffer, glutamic acid buffer, lactic acid buffer, maleic acid buffer, trometamol buffer, or gluconic acid buffer, or any combination thereof; optionally wherein the pharmaceutically acceptable buffer is a histidine buffer, optionally wherein the histidine buffer is present at a concentration of about 10 mM to about 30 mM4. The pharmaceutical composition of claim 1 , wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
5. The pharmaceutical composition of claim 1, wherein the pharmaceutically acceptable salt is sodium chloride, potassium chloride, magnesium chloride, or calcium chloride, or any combination thereof; optionally wherein the pharmaceutically acceptable salt is sodium chloride, optionally wherein the sodium chloride is present at a concentration of about 100 mM to about 250 mM.
6. The pharmaceutical composition of claim 1 , wherein the sugar is sucrose or trehalose, or a combination thereof; optionally wherein the sugar is sucrose, optionally wherein the sucrose is present at about 2% (w / v) to about 4% (w / v).
7. The pharmaceutical composition of claim 1, wherein the protein excipient is recombinant human serum albumin, non-recombinant human serum albumin, or a combination thereof; optionally wherein the protein excipient is non-recombinant human serum albumin, optionally wherein the non-recombinant human serum albumin is USP grade non- recombinant human serum albumin, optionally wherein the non-recombinant human serum albumin is present at an amount of about 0.1% (w / v), about 0.2% (w / v), about 0.3% (w / v), about 0.4% (w / v), about 0.5% (w / v), about 0.6% (w / v), about 0.7% (w / v), about 0.8% (w / v), about 0.9% (w / v), about 1% (w / v), about 1.1% (w / v), about 1.2% (w / v), about 1.3% (w / v), about 1.4% (w / v), about 1.5% (w / v), about 1.6% (w / v), about 1.7% (w / v), about 1.8% (w / v), about 1.9% (w / v), about 2.0% (w / v), about 2.1% (w / v), about 2.2% (w / v), about 2.3% (w / v), about 2.4% (w / v), about 2.5% (w / v), about 2.6% (w / v), about 2.7% (w / v), about 2.8% (w / v), about 2.9% (w / v), or about 3.0% (w / v).
8. The pharmaceutical composition of claim 1, wherein the lentiviral vector is a VSV-G pseudo typed lentivirus.
9. The pharmaceutical composition of claim 8, wherein the VSV-G pseudotyped lentivirus comprises a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
10. A pharmaceutical composition comprising:(i) a VSV-G pseudotyped lentivirus comprising a nucleic acid molecule encoding for a chimeric antigen receptor (“CAR”) comprising an antigen binding domain that binds to CD19;(ii) about 10 mM to about 30 mM of a L- Histidine buffer;(iii) about 100 mM to about 400 mM of sodium chloride;(iv) about 1% (w / v) to about 5% (w / v) of sucrose; and(v) about 0.1% (w / v) to about 2% (w / v) of a non-recombinant human serum albumin, wherein the pharmaceutical composition has a pH of about 5.5 to about 8.0.
11. The pharmaceutical composition of claim 10, wherein the VSV-G pseudotyped lentivirus is present at a concentration of about 1 ,0E+toto l.OE+09TUs / mL.
12. The pharmaceutical composition of claim 10, wherein the L-Histidine is present at a concentration of about 15-25 mM and the pharmaceutical composition has a pH of about 6 to about 7.
13. The pharmaceutical composition of claim 10, wherein sodium chloride is present at a concentration of about 125 mM to about 175 mM.
14. The pharmaceutical composition of claim 10, wherein sucrose is present in an amount of about 2% (w / v) to about 5% (w / v).
15. The pharmaceutical composition of claim 10, wherein the non-recombinant human serum albumin is present at about 0.1% (w / v) to about 1.5% (w / v).
16. The pharmaceutical composition of claim 10, wherein the non-recombinant human serum albumin is USP grade non-recombinant human serum albumin.
17. The pharmaceutical composition of claim 10, wherein the VSV-G pseudotyped lentivirus comprises a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
18. The pharmaceutical composition of claims 17, wherein the VSV-G polypeptide comprises a I182A, I182D, or I182E mutation as compared to SEQ ID NO: 2.
19. The pharmaceutical composition of claim 17, wherein the VSV-G polypeptide comprises a sequence at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% to a sequence of SEQ ID NO: 4.
20. The pharmaceutical composition of claim 17, wherein the VSV-G polypeptide comprises a sequence at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% to a sequence of SEQ ID NO: 5.
21. The pharmaceutical composition of claim 17, wherein the VSV-G polypeptide, further comprises a mutation that corresponds to a mutation at positions 214 and / or 352 of SEQ ID NO: 2.
22. The pharmaceutical composition of claim 21, wherein the VSV-G polypeptide comprises substitutions at positions 1182, T214, and T352 of SEQ ID NO: 2.
23. The pharmaceutical composition of claim 21, wherein the substitution at position 182 of the VSV-G polypeptide is I182D or I182E, the substitution at position 214 of the VSV-G polypeptide is T214N, and the substitution at position 352 of the VSV-G polypeptide is T352A.
24. The pharmaceutical composition of claim 21, wherein the VSV-G polypeptide comprises a sequence of SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO:25.
25. A pharmaceutical composition comprising:(i) a VSV-G pseudotyped lentivirus comprising a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182, 214, and / or 352 of SEQ ID NO: 2, wherein the lentivirus comprises a nucleic acid molecule encoding for a chimeric antigen receptor (“CAR”) comprising an antigen binding domain that binds to CD19;(ii) L-Histidine buffer at a concentration of about 10 mM to about 30 mM;(iii) sodium chloride at a concentration of about 100 mM to about 400 mM;(iv) sucrose in amount of about 1% (w / v) to about 5% (w / v); and(v) non-recombinant human serum albumin in an amount of about 0.1% (w / v) to about 2% (w / v), wherein the pharmaceutical composition has a pH of about 6.5 to about 7.5.
26. The pharmaceutical composition of any one of claims 1-25, wherein the lenti viral vector further comprises a targeting moiety.
27. The pharmaceutical composition of claim 26, wherein the targeting moiety binds toCD7.
28. The pharmaceutical composition of claim 27, wherein the targeting moiety comprises a polypeptide comprising: (i) a heavy chain variable region comprising heavy chain CDR1, CDR2, and CDR3 sequences, wherein the heavy chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 30; the heavy chain CDR2 has the amino acid sequence of SEQ ID NO: 31; and the heavy chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 32, or variants of any of the foregoing; and (ii) a light chain variable region comprising light chain CDR1, CDR2, and CDR3 sequences, wherein the light chain CDR1 sequence has the amino acid sequence of SEQ ID NO: 33; the light chain CDR2 sequence has the amino acid sequence of SEQ ID NO: 34; and the light chain CDR3 sequence has the amino acid sequence of SEQ ID NO: 35; or variants of any of the foregoing.
29. The pharmaceutical composition of claim 27, wherein the targeting moiety comprises a heavy chain variable region (VH) comprising an amino acid sequence of SEQ ID NO: 42 and a light chain variable region (VL) comprising an amino acid sequence of SEQ ID NO: 43.
30. The pharmaceutical composition of claim 27, wherein the targeting moiety comprises an antigen binding domain comprising an amino acid sequence of SEQ ID NO: 44 or SEQ ID NO: 45.
31. The pharmaceutical composition of claim 26, wherein the targeting moiety comprises a formula of T-S1, wherein T is a target binding domain and Si is a stalk portion, wherein the targeting moiety is attached to the surface of the viral vector through a stalk portion, Si,.
32. The pharmaceutical composition of claim 31, wherein the stalk portion, Si, comprises a formula of L1-FC-L2-X1, wherein:Li is a linker or absent;Fc is a variant Fc protein;L2 is a linker or absent; and X1is a polypeptide comprising the transmembrane domain, wherein the targeting moiety having the formula T-Si has a formula of T-L1-FC-L2-X1.
33. The pharmaceutical composition of claim 32, wherein X1comprises a polypeptidehaving a formula of ECD-TM-ICD, wherein:ECD is an extracellular domain, or a fragment thereof, of a cell surface protein, or absent;TM is a transmembrane domain of a transmembrane protein; andICD is an intracellular domain or a protein that facilitates incorporation of the targeting moiety into the envelope of the viral particle, or absent, wherein the targeting moiety having the formula of T-L1-FC-L2-X1 has a formula of T-Li-Fc- L2-ECD-TM-ICD.
34. The pharmaceutical composition of claim 33, wherein:T comprises an amino acid sequence of SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 62, or SEQ ID NO: 63;Li comprises the amino acid sequence of SEQ ID NO: 72;Fc comprises the amino acid sequence of SEQ ID NO: 82;L2 is absent;ECD comprises the amino acid sequence of SEQ ID NO: 83;TM comprises the amino acid sequence of SEQ ID NO: 84; andICD comprises an amino acid sequence comprising an env incorporation motif, wherein the env incorporation motif comprises an amino acid sequence of SEQ ID NO: 85.
35. The pharmaceutical composition of claim 1 , wherein the targeting moiety comprising a formula of T-Si comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 89, SEQ ID NO: 90, or SEQ ID NO: 91.
36. The pharmaceutical composition of any one of claims 1-35, wherein the antigen binding domain that binds to CD 19 comprises a polypeptide comprising a light chain and a heavy chain comprising: a heavy chain variable region of the heavy chain having at least 90% identity to an amino acid sequence of SEQ ID NO: 73; and a light chain variable region of the light chain having at least 90% identity to an amino acid sequence of SEQ ID NO: 74.
37. The pharmaceutical composition of claim 36, wherein the antigen binding domain that binds to CD19 comprises an amino acid sequence of SEQ ID NO: 75 or SEQ ID NO: 76.
38. The pharmaceutical composition of claim 36, wherein the CAR comprises an aminoacid sequence having at least 90% identity to SEQ ID NO: 120, SEQ ID NO: 121, or SEQ ID NO: 122.
39. A method of infecting a cell, the method comprising contacting the cell with the pharmaceutical composition of any one of claims 1-38.
40. A method of delivering a heterologous molecule of interest to a cell, the method comprising contacting the cell with the pharmaceutical composition of any one of claims 1-38, wherein the lentiviral vector of the pharmaceutical composition comprises a nucleic acid molecule encoding the heterologous molecule of interest.
41. A method of delivering a heterologous molecule of interest to a subject, the method comprising administering to the subject the viral particle of any one of claims 1-38, wherein the lentiviral vector of the pharmaceutical composition comprises a nucleic acid molecule encoding the heterologous molecule of interest.
42. A method of treating a disease or disorder in a subject, the method comprising administering to the subject the pharmaceutical composition of any one of claims 1-38, wherein the lentiviral vector of the pharmaceutical composition comprises a nucleic acid molecule encoding a heterologous molecule of interest to treat the disease or disorder.
43. A method of delivering a heterologous molecule to a target cell, the method comprising contacting the cell with the pharmaceutical composition of any one of claims 1-38, wherein the lentiviral vector of the pharmaceutical composition comprises a nucleic acid molecule encoding the heterologous molecule.
44. The pharmaceutical composition of any one of claims 1-38, for use in the treatment of a cancer, an immune disorder, an auto-immune disorder, or a metabolic disorder.
45. Use of the pharmaceutical composition of any one of claims 1-38, for the manufacture of a medicament for treatment of a cancer, an immune disorder, an auto-immune disorder, or a metabolic disorder.
46. A method of producing a concentrated sterilized solution comprising a viral vector, the method comprising the steps of: clarifying a solution comprising cell culture media and the viral vector; filtering the clarified solution comprising the viral vector through a first chromatographic filter to produce a filtered clarified solution comprising the viral vector; passing the filtered clarified solution comprising the viral vector through a protein coated sterile membrane to produce a sterilized solution comprising the viral vector; and concentrating the sterilized solution comprising the viral vector to produce the concentrated sterilized solution comprising the viral vector; wherein the viral vector comprises a nucleic acid molecule encoding for a chimeric antigen receptor (“CAR”) comprising an antigen binding domain that binds to CD19.
47. The method of claim 46, further comprising: prior to clarifying the solution: i) obtaining a solution comprising cell culture media and the viral vector; and ii) digesting DNA in the solution comprising cell culture media and the viral vector to produce a first digested solution comprising the viral vector; wherein clarifying the solution comprises clarifying the first digested solution comprising the viral vector to produce a clarified, digested solution comprising the viral vector; subsequent to filtering the clarified solution and prior to passing the filtered clarified solution through a protein coated sterile membrane: i) digesting DNA in the filtered, clarified, digested solution comprising the viral vector to produce a filtered, clarified, twice-digested solution comprising the viral vector; and ii) filtering the filtered, clarified, twice-digested solution comprising the viral vector through a second chromatographic filter to produce a twice- filtered, clarified, twice-digested solution comprising the viral vector; wherein the protein coated sterile membrane comprises a membrane pre-flushed with a protein solution, wherein the protein solution comprises about 0.1% w / v to 2.0% w / v of a protein, about 10 mM to about 30 mM 2-Amino-2-(hydroxymethyl)propane-l,3-diol (TRIS), about 100 mM to about 400 mM sodium chloride, and a pH of about 6.0 to about 8.0 .
48. A method of producing a concentrated sterilized solution comprising a viral vector, the method comprising the steps of: digesting DNA in a solution comprising the viral vector to produce a first digested solution comprising the viral vector; clarifying the digested solution comprising the viral vector to produce a clarified, digested solution comprising the viral vector; filtering the clarified, digested solution comprising the viral vector through a first chromatographic filter to produce a filtered, clarified, digested solution comprising the viral vector; digesting DNA in the filtered, clarified, digested solution comprising the viral vector to produce a filtered, clarified, twice-digested solution comprising viral vector; filtering the filtered, clarified, twice-digested solution comprising the viral vector through a second chromatographic filter to produce a twice-filtered, clarified, twice-digested solution comprising viral vector; passing the twice-filtered, clarified, twice-digested solution comprising the viral vector through a protein coated sterile membrane to produce a sterilized solution comprising the viral vector; and concentrating the sterilized solution comprising the viral vector to produce the concentrated sterilized solution comprising the viral vector; wherein the viral vector comprises a nucleic acid molecule encoding for a chimeric antigen receptor (“CAR”) comprising an antigen binding domain that binds to CD19.
49. The method of claim 46, wherein the viral vector is a lentiviral vector pseudotyped with a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
50. The method of claim 48, wherein the viral vector is a lentiviral vector pseudotyped with a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
51. The method of any one of claims 46 or 47, wherein the viral vector, such as a lentiviral vector, is pseudo typed with a VSV-G polypeptide comprising a mutation that corresponds to a mutation at position 182 of SEQ ID NO: 2.
52. The method of any one of claims 46-51, wherein the CAR comprises an amino acid sequence having at least 90% identity to an amino acid sequence of SEQ ID NO: 120, SEQ ID NO: 121, or SEQ ID NO: 122.