Kallikrein antibodies and uses thereof

Abstract

Aspects of the application provide anti-KLK5 antibodies, anti-KLK7 antibodies, and anti-KLK5xKLK7 antibodies (e.g., bispecific antibodies) and methods of using the same for promoting barrier function and reducing inflammation, and treating conditions such as Netherton syndrome, eosinophilic esophagitis and atopic dermatitis.

Description

KALLIKREIN ANTIBODIES AND USES THEREOFRELATED APPLICATIONS

[0001] This application claims the benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application Serial No. 63 / 693,694, entitled “KALLIKREIN ANTIBODIES AND USES THEREOF,” filed on September 11, 2024, the entire content of which is incorporated herein by reference in its entirety for all purposes.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

[0002] The contents of the electronic sequence listing (A140770010WO00-SEQ-KGC.xml; Size: 687,528 bytes; and Date of Creation: September 4, 2025) is herein incorporated by reference in its entirety.BACKGROUND

[0003] Kallikrein (KLK) enzymes regulate desquamation and innate immunity to support skin homeostasis and wound healing. In a healthy skin, the outermost layer of the epidermis is regularly shed through a KLK driven proteolytic cascade resulting in the degradation of comeodesmosomes and desquamation. KLK5 is understood to be a main activator of this proteolytic cascade. Autoactivated KLK5 enzymatically converts proKLK7 and proKLK14 to active forms and stimulates a positive feedback loop that, via KLK14, leads to the production of more proKLK5. These KLK enzymes are kept in check by endogenous serine protease inhibitors, such as lymphoepithelial Kazal-type-related inhibitors. Dysregulation of KLKs, including KLK5 and KLK7, is associated with skin disorders, inflammatory diseases, and cancer. For example, hyperactive kallikrein 5 and 7 cause both genetic and spontaneous epidermal barrier disorders (e.g., Netherton syndrome, eosinophilic esophagitis, atopic dermatitis).SUMMARY

[0004] Certain aspects of the disclosure relate to a recognition that loss of balance between endogenous KLK proteases and associated protease inhibitors causes barrier dysfunction and induces inflammation (see, e.g., FIG. 1), which can result in inflammatory conditions, such as Netherton syndrome, eosinophilic esophagitis and atopic dermatitis. In some embodiments, methods and related compositions are provided that are useful for inhibition of KLK5 and / or KLK7 for purposes of improving barrier function and reducing inflammation, which ameliorates disease severity. Aspects of the disclosure provide anti-KLK5 antibodies that7107489have high binding affinity and specificity to KLK5 and that inhibit KLK5 activity. Further aspects of the disclosure provide anti-KLK7 antibodies that have high binding affinity and specificity to KLK7 and that inhibit KLK7 activity. Further aspects of the disclosure provide anti-KLK5xKLK7 antibodies (e.g., bispecific antibodies targeting KLK5 and KLK7) that have high binding affinity and specificity to both KLK5 and KLK7 and that inhibit KLK5 and KLK7 activity. Accordingly, in some embodiments, the disclosure provides methods, antibodies for use in methods, and related antibody compositions for treating conditions associated with KLK5 and KLK7 dysregulation, such as Netherton Syndrome, atopic dermatitis (with and without filaggrin mutations), eosinophilic esophagitis, prurigo nodularis, chronic pruritus of unknown origin (CPUO), hidradenitis suppurativa, pemphigus vulgaris, lichen planus, asthma (e.g., KLK5 related asthma), and ichthyosis vulgaris.

[0005] The foregoing and other aspects, implementations, acts, functionalities, features and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.BRIEF DESCRIPTION OF THE DRAWINGS

[0006] The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate certain embodiments, and together with the written description, serve to provide non-limiting examples of certain aspects of the compositions and methods disclosed herein.

[0007] FIG. 1 is a diagram showing aberrant protease activation (e.g., aberrant KLK5, KLK7, and KLK14) activation leading to skin barrier defect associated diseases.

[0008] FIGs. 2A-2J show relative response curves of anti-KLK5 antibodies binding to either the active form of human KLK5 (hKLK5) or the proform of hKLK5 (FIGs. 2A-2D) and anti- KLK7 antibodies binding to either the active form of human KLK7 (hKLK7) or the proform of hKLK7 (FIGs. 2F-2I). Anti-KLK5 antibodies KLK5-Ll-Ab2 (FIG. 2A), KLK5-L2-Ab3 (FIG. 2B), KLK5-L3-Ab5 (FIG. 2C), and KLK5-L2-Ab4 (FIG. 2D) bind only the active form of hKLK5, and anti-KLK7 antibodies KLK7-L2-Ab4 (FIG. 2F), KLK7-L2-Ab5 (FIG. 2G), KLK7-L5-Ab2 (FIG. 2H), and KLK7-Ll-Ab7 (FIG. 21) bind only the active form of hKLK7. The anti-KLK5 / anti-KLK7 bispecific antibody KLK5-L2-Ab2 x KLK7-Ll-Ab8 is shown binding only to the active forms of hKLK5 (FIG. 2E) and hKLK7 (FIG. 2J).

[0009] FIGs 3A-3B are SDS-PAGE results showing antibodies alone or following incubation with either hKLK5 (FIG. 3A) or hKLK7 (FIG. 3B). Anti-KLK5 antibody KLK5-L2-Ab2 is resistant to cleavage by hKLK5, while KLK5-L3-Ab7 and KLK-Ll-Ab5 undergo heavy7107489chain cleavage by hKLK5 (FIG. 3A). Anti-KLK7 antibodies KLK7-Ll-Ab8, KLK7-L2-Ab3, KLK7-L3-Ab2, KLK7-L4-Ab2, and KLK7-L5-Ab2 are resistant to cleavage by hKLK7 (FIG. 3B).

[0010] FIGs. 4A-4K show binding activity of anti-KLK5 antibodies, relative to an isotype control, of KLK1 (FIG. 4A), KLK2 (FIG. 4B), KLK4 (FIG. 4C), KLK6 (FIG. 4D), KLK12 (FIG. 4E), KLK14 (FIG. 4F), plasma KLK (FIG. 4G), trypsin (FIG. 4H), chymotrypsin (FIG. 41), urokinase (FIG. 4J), and KLK6 again in follow-up studies (FIG. 4K). The tested antibodies do not specifically inhibit non-KLK5 family members or related proteases, as the relative activity is not higher than the isotype control.

[0011] FIGs. 5A-5J show the binding activity of anti-KLK7 antibodies. Relative to an isotype control, of KLK1 (FIG. 5A), KLK2 (FIG. 5B), KLK4 (FIG. 5C), KLK6 (FIG. 5D), KLK12 (FIG. 5E), KLK14 (FIG. 5F), plasma KLK (FIG. 5G), trypsin (FIG. 5H), chymotrypsin (FIG. 51), and urokinase (FIG. 5J). The tested antibodies do not specifically inhibit non-KLK7 family members or related proteases, as the relative activity is not higher than the isotype control.

[0012] FIG. 6 shows binding activity of anti-KLK5 / anti-KLK7 bispecific antibodies, compared to an isotype control, of KLK 13 at various concentrations.

[0013] FIGs. 7A-7B show the relative response of anti-KLK5 antibody KLK5-L1- Ab5 binding hKLK5 alone or in the presence of inhibitors of serine proteases PMSF (FIG. 7A), leupeptin, or SPINK5 (FIG. 7B).

[0014] FIGs. 8A-8B show the relative response of anti-KLK5 antibody KLK5-L2- Ab2 binding hKLK5 alone or in the presence of inhibitors of serine proteases PMSF (FIG. 8A), leupeptin, or SPINK5 (FIG. 8B).

[0015] FIGs. 9A-9B show the relative response of anti-KLK5 antibody KLK5-L3- Ab7 binding hKLK5 alone or in the presence of inhibitors of serine proteases PMSF (FIG. 9A), leupeptin, or SPINK5 (FIG. 9B).

[0016] FIGs. 10A-10B show the relative response of anti-KLK5 / anti-KLK7 bispecific antibody KLK5-L2-Ab2 x KLK7-Ll-Ab8 binding hKLK5 alone or in the presence of inhibitors of serine proteases PMSF (FIG. 10A), leupeptin, or SPINK5 (FIG. 10B).

[0017] FIGs. 11A-11G show the relative response of anti-KLK7 antibodies KLK7- Ll-Ab8 (FIG. HA), KLK7-L2-Ab3 (FIG. 11B), KLK7-L3-Ab2 (FIG. 11C), KLK7-L4-Ab2 (FIG. HD), KLK7-L5-Ab2 (FIG. HE), KLK7-Ll-Ab8 (FIG. HF), and anti-KLK7 / anti- KLK5 bispecific antibody KLK5-L2-Ab2 x KLK7-Ll-Ab8 (FIG. 11G) binding hKLK7 alone or in the presence of inhibitors of serine proteases PMSF or SPINK5.7107489

[0018] FIGs. 12A-12F show competitive binding of KLK5 (FIGs. 12A-12D) and KLK7 (FIGs. 12E-12F) between anti-KLK5 or anti-KLK7 antibodies and SPINK5, which binds the active site of KLK5 and KLK7. Anti-KLK5 antibodies KLK5-Ll-Ab5 (FIG. 12A), KLK5-L2-Ab (FIG. 12B), or KLK5-L3-Ab7 (FIG. 12C) are bound to a chip and KLK5 is added, resulting in an increase in the binding curve. Addition of a second anti-KLK5 antibody (“mAb #2”) or SPINK5 does not increase binding. Anti-KLK7 antibody KLK7-L1- Ab5 (FIG. 12E) is bound to a chip and KLK7 is added, resulting in an increase in the binding curve. Addition of an isotype control or SPINK5 does not increase binding. Alternatively, SPINK5 is bound to the chip, and either KLK5 (FIG. 12D) or KLK7 (FIG. 12F) is added, resulting in an increase in the binding curve. Addition of an anti-KLK5 antibody (FIG. 12D) or an anti-KLK7 antibody (FIG. 12F) does not increase binding, as SPINK5 is already bound to the active site of KLK5 or KLK7.

[0019] FIG. 13 shows the effects of treatment with either anti-KLK5 / anti-KLK7 bispecific antibody KLK5-L2-Ab2 x KLK7-Ll-Ab8 or Comparator Antibody #1 at 30mg / kg on the stratum corneum thickness in an MC903 atopic dermatitis mouse model. Treatment with KLK5-L2-Ab2 x KLK7-Ll-Ab8 antibody led to a significant reduction in thickness. *** p<0.001; ** p<0.01; * p<0.05, via one-way ANOVA with Dunnett’s multiple comparisons.

[0020] FIGs. 14A-14C represent the treatment efficacy of anti-KLK5 / anti-KLK7 bispecific antibody KLK5-L2-Ab2 x KLK7-Ll-Ab8 compared to the topical ointment tacrolimus and Comparator Antibody #1 on disease presentation in an Nc / Nga atopic dermatitis mouse model, as measured by clinical ear thickness (FIG. 14A), epidermal area (FIG. 14B), and itch (FIG. 14C). *** p<0.001; ** p<0.01; * p<0.05, via one-way ANOVA with Dunnett’s multiple comparisons.DETAILED DESCRIPTION

[0021] The present disclosure, at least in part, is based on the development of inhibitory anti-KLK5 antibodies and variants thereof that have high binding affinity and specificity to KLK5. Also provided are methods of using the anti-KLK5 antibodies and their variants in research, diagnostic / detection, therapeutic applications, and anti-KLK5 antibodies for use in such methods. The present disclosure is based in further part on the development of inhibitory anti-KLK7 antibodies and variants thereof that have high binding affinity and specificity to KLK7. Also provided are methods of using the anti-KLK7 antibodies and their variants in research, diagnostic / detection, therapeutic applications, and anti-KLK7 antibodies for use in such methods. The present disclosure is based in further part on the development7107489of inhibitory anti-KLK5xKLK7 antibodies (e.g., multi- specific antibodies, e.g., bispecific antibodies) and variants thereof that have high binding affinity and specificity to both KLK5 and KLK7. Also provided are methods of using the anti-KLK5xKLK7 antibodies and their variants in research, diagnostic / detection, and therapeutic applications.

[0022] The foregoing and other aspects, implementations, acts, functionalities, features and embodiments of the present teachings can be more fully understood from the following description in conjunction with the accompanying drawings.I. Definitions

[0023] Administering: As used herein, the terms “administering” or “administration” means to provide an antibody or a composition thereof to a subject in a manner that is physiologically and / or pharmacologically useful (e.g., to treat a condition in the subject).

[0024] Affinity Matured Antibody: “Affinity Matured Antibody” is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an improvement in the affinity (e.g., KD, kd or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s). Exemplary affinity matured antibodies may have nanomolar or even picomolar affinities for the target antigen in some embodiments. A variety of procedures for producing affinity matured antibodies are available, including the screening of a combinatory antibody library that has been prepared using bio-display. For example, Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and / or framework residues is described by Barbas et al., Proc. Nat. Acad. Sci. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169: 147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson et al., J. Immunol., 154(7): 3310-3319 (1995); and Hawkins et al, J. Mol. Biol., 226: 889-896 (1992). Selective mutation at selective mutagenesis positions and at contact or hypermutation positions with an activity-enhancing amino acid residue is described in U.S. Pat. No. 6,914,128 Bl.

[0025] Antibody: As used herein, the term “antibody” refers to a polypeptide that comprises at least one immunoglobulin variable domain, which comprises at least one distinct antigen- specific binding site, or a portion of an immunoglobulin variable domain (such as a paratope or portion thereof) that comprises at least one distinct antigen- specific binding site. In some embodiments, an antibody comprises at least one distinct antigenspecific binding site that specifically binds to the active site of an enzyme. In some embodiments, an antibody is a full-length antibody. In some embodiments, an antibody is a7107489chimeric antibody. In some embodiments, an antibody is a humanized antibody. However, in some embodiments, an antibody is a Fab fragment, a F(ab')2 fragment, a Fv fragment or a scFv fragment. In some embodiments, an antibody is a multi- specific antibody (e.g., a bispecific antibody). In some embodiments, an antibody is a nanobody derived from a camelid antibody or a nanobody derived from shark antibody. In some embodiments, an antibody is a diabody. In some embodiments, an antibody comprises a framework having a human germline sequence. In another embodiment, an antibody comprises a heavy chain constant domain selected from the group consisting of IgG, IgGl, IgG2, IgG2A, IgG2B, IgG2C, IgG3, IgG4, IgAl, IgA2, IgD, IgM, and IgE constant domains. In some embodiments, an antibody comprises a heavy (H) chain variable region (abbreviated herein as VH), and / or a light (L) chain variable region (abbreviated herein as VL). In some embodiments, an antibody comprises a constant domain, e.g., an Fc region. An immunoglobulin constant domain refers to a heavy or light chain constant domain. Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known. With respect to the heavy chain, in some embodiments, the heavy chain of an antibody described herein can be an alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In some embodiments, the heavy chain of an antibody described herein can comprise a human alpha (a), delta (A), epsilon (e), gamma (y) or mu (p) heavy chain. In a particular embodiment, an antibody described herein comprises a human gamma 1 CHI, CH2, and / or CH3 domain. In some embodiments, the amino acid sequence of the VH domain comprises the amino acid sequence of a human gamma (y) heavy chain constant region, such as any known in the art. Non-limiting examples of human constant region sequences have been described in the art, e.g., see U.S. Pat. No. 5,693,780 and Kabat E A et al., (1991) supra. In some embodiments, the VH domain comprises an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or at least 99% identical to any of the variable chain constant regions provided herein. In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C-glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecule are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or7107489carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, or a phospholipid unit. In some embodiments, an antibody is a construct that comprises a polypeptide comprising one or more antigen binding fragments of the disclosure linked to a linker polypeptide or an immunoglobulin constant domain. Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Examples of linker polypeptides have been reported (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123). Still further, an antibody may be part of a larger immunoadhesion molecule, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides. Examples of such immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol. 31:1047-1058).

[0026] Approximately: As used herein, the term “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).

[0027] Bispecific Antibody: As used herein, the term “bispecific antibody” refers to an antibody that comprises two distinct antigen- specific binding sites or two linked (covalently or non-covalently) antibodies that, combined, comprise two distinct antigenspecific binding sites. Non-limiting examples of bispecific antibody formats or architectures are provided in Labrijn, AF, et al., Bispecific antibodies: a mechanistic review of the pipeline, Nature Reviews Drug Discovery volume 18, pages 585-608 (2019) and Brinkmann U and Kontermann EE, The making of bispecific antibodies, MAbs. 2017 Feb / Mar;9(2):182- 212, the entire contents of each of which are incorporated herein by reference in their entireties.

[0028] CDR: As used herein, the term "CDR" refers to the complementarity determining region within antibody variable sequences. A typical antibody molecule7107489comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding. The VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Kabat definition, the IM GT definition, the Chothia definition, the AbM definition, and / or the contact definition, all of which are well known in the art. See, e.g., Kabat, E.A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; IMGT®, the international ImMunoGeneTics information system® http: / / www.imgt.org, Lefranc, M.-P. et al., Nucleic Acids Res., 27:209-212 (1999); Ruiz, M. et al., Nucleic Acids Res., 28:219-221 (2000); Lefranc, M.-P, Nucleic Acids Res., 29:207-209 (2001); Lefranc, M.-P, Nucleic Acids Res., 31:307-310 (2003); Lefranc, M.-P. et al., In Silico Biol., 5, 0006 (2004) [[Epub]], 5:45-60 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 33:D593-597 (2005); Lefranc, M.-P. et al., Nucleic Acids Res., 37:D1006-1012 (2009); Lefranc, M.-P. et al., Nucleic Acids Res., 43:D413-422 (2015); Chothia et al., (1989) Nature 342:877; Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917, Al-lazikani et al (1997) J. Molec. Biol. 273:927-948; and Almagro, J. Mol. Recognit. 17: 132-143 (2004). ee also hgmp.mrc.ac.uk and bioinf.org.uk / abs. As used herein, a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method, for example, the IMGT definition.

[0029] In certain embodiments, there are three CDRs in each of the variable regions of a heavy chain and a light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions. The term "CDR set" as used herein refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991)) not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs may be referred to as Kabat CDRs. Sub-portions of CDRs may be designated as LI, L2 and L3 or Hl, H2 and H3 where7107489the "L" and the "H" designates the light chain and the heavy chains regions, respectively. These regions may be referred to as Chothia CDRs, which have boundaries that overlap with Kabat CDRs. Other boundaries defining CDRs overlapping with the Kabat CDRs have been described by Padlan (FASEB J. 9:133-139 (1995)) and MacCallum (J Mol Biol 262(5):732- 45 (1996)). Still other CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. The methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use Kabat or Chothia defined CDRs.

[0030] CDR-grafted antibody: As used herein, the term "CDR-grafted antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and / or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.

[0031] Chimeric antibody: As used herein, the term "chimeric antibody" refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.

[0032] Complementary: As used herein, the term “complementary” refers to the capacity for precise pairing between two nucleotides or two sets of nucleotides. In particular, complementary is a term that characterizes an extent of hydrogen bond pairing that brings about binding between two nucleotides or two sets of nucleotides. For example, if a base at one position of an oligonucleotide is capable of hydrogen bonding with a base at the corresponding position of a target nucleic acid (e.g., an mRNA), then the bases are considered to be complementary to each other at that position. Base pairings may include both canonical Watson-Crick base pairing and non- Watson-Crick base pairing (e.g., Wobble base pairing and Hoogsteen base pairing). For example, in some embodiments, for complementary base pairings, adenosine-type bases (A) are complementary to thymidine- type bases (T) or uracil-type bases (U), that cytosine-type bases (C) are complementary to guanosine-type bases (G), and that universal bases such as 3-nitropyrrole or 5-nitroindole can hybridize to and are considered complementary to any A, C, U, or T. Inosine (I) has also been considered in the art to be a universal base and is considered complementary to any A,7107489C, U or T.

[0033] Conservative amino acid substitution: As used herein, a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Fourth Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 2012, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.

[0034] Cross-reactive: As used herein, the term “cross-reactive,” refers to a property of the agent being capable of specifically binding to more than one antigen of a similar type or class (e.g., antigens of multiple homologs, paralogs, or orthologs) with similar affinity or avidity. For example, in some embodiments, an antibody that is cross-reactive against human and non-human primate antigens of a similar type or class (e.g., a human KLK5 and nonhuman primate KLK5, a human KLK7 and non-human primate KLK7) is capable of binding to the human antigen and non-human primate antigens with a similar affinity or avidity. In some embodiments, an antibody is cross-reactive against a human antigen and a rodent antigen of a similar type or class. In some embodiments, an antibody is cross -reactive against a rodent antigen and a non-human primate antigen of a similar type or class. In some embodiments, an antibody is cross -reactive against a human antigen, a non-human primate antigen, and a rodent antigen of a similar type or class.

[0035] Effective Amount: As used herein, “an effective amount” refers to the amount of each active agent (e.g., anti-KLK5 antibody, anti-KLK7 antibody, anti- KLK5xKLK7 antibody) required to confer a desired effect (e.g., a therapeutic effect on the subject), either alone or in combination with one or more other active agents. In some embodiments, the therapeutic effect is reduced KLK5 and / or KLK7 activity and / or alleviated disease (e.g., Netherton syndrome, eosinophilic esophagitis and atopic dermatitis) or related symptoms, e.g., improved barrier function.

[0036] F ramework : As used herein, the term "framework" or "framework sequence" refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a7107489framework sequence is subject to correspondingly different interpretations. The six CDRs (CDR-L1, CDR-L2, and CDR-L3 of light chain and CDR-H1, CDR-H2, and CDR-H3 of heavy chain) also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4. Without specifying the particular sub-regions as FR1, FR2, FR3 or FR4, a framework region, as referred by others, represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain. As used herein, a FR represents one of the four sub-regions, and FRs represents two or more of the four sub-regions constituting a framework region. Human heavy chain and light chain acceptor sequences are known in the art. In one embodiment, the acceptor sequences known in the art may be used in the antibodies disclosed herein.

[0037] Human antibody: The term "human antibody", as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term "human antibody", as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.

[0038] Humanized antibody: As used herein, the term "humanized antibody" refers to antibodies which comprise heavy and light chain variable region sequences from a nonhuman species (e.g., a mouse) but in which at least a portion of the VH and / or VL sequence has been altered to be more "human-like", i.e., more similar to human germline variable sequences. One type of humanized antibody is a CDR- grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences. In one embodiment, humanized antibodies are provided. Such antibodies may be generated by obtaining murine monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT publication No. WO 2005 / 123126 A2.

[0039] Humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced7107489by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity. In some embodiments, Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Antibodies may have Fc regions modified as described in WO 99 / 58572. Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs derived from one or more CDRs from the original antibody. Humanized antibodies may also involve affinity maturation.

[0040] In some embodiments, humanization is achieved by grafting the CDRs (e.g., as shown in Tables la, lb, 2a, or 2b) into the human variable domains (e.g., IGKV1-NL1*O1 and IGHVl-3*01 human variable domain). In some embodiments, an antibody of the present disclosure is a humanized variant comprising one or more amino acid substitutions (e.g., in the VH framework region) as compared with any one of the VHs listed in Tables la, lb, 2a, or 2b , and / or one or more amino acid substitutions (e.g., in the VL framework region) as compared with any one of the VLs listed in Tables la, lb, 2a, or 2b .

[0041] Isolated antibody: An "isolated antibody", as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds KLK5 is substantially free of antibodies that specifically bind antigens other than KLK5, an isolated antibody that specifically binds KLK7 is substantially free of antibodies that specifically bind antigens other than KLK7, an isolated antibody that specifically binds KLK5 and KLK7 is substantially free of antibodies that specifically bind antigens other than KLK5 and KLK7). An isolated antibody may, however, have cross-reactivity to other antigens, in some embodiments. Moreover, an isolated antibody may be substantially free of other cellular material and / or chemicals.

[0042] Kabat numbering: As used herein, the terms "Kabat numbering", "Kabat7107489definitions and "Kabat labeling" are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). For the heavy chain variable region, the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3. For the light chain variable region, the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.

[0043] Multi-Specific Antigen Binding Molecule: As used herein, the term “multispecific antigen binding molecule” refers to a molecule that comprises two or more antigenspecific binding sites. In some embodiments, a multi- specific antigen binding molecule is a multi- specific antibody (e.g., a bispecific antibody).

[0044] Multi- Specific Antibody: As used herein, the term “multi- specific antibody” refers to an antibody that comprises at least two distinct antigen- specific binding sites or at least two linked (covalently or non-covalently) antibodies that, combined, comprise at least two distinct antigen- specific binding sites. In some embodiments, a multi- specific antibody is a bispecific antibody. Non-limiting examples of multi- specific specific antibody formats or architectures are provided in Sawant MS, et al., Toward Drug-Eike Multispecific Antibodies by Design, Int J Mol Sci. 2020 Oct 12;21(20):7496; Klein C, et al., The use of CrossMAb technology for the generation of bi- and multispecific antibodies, MAbs 2016 Aug-Sep;8(6): 1010-20; and Brinkmann U and Kontermann EE, The making of bispecific antibodies, MAbs. 2017 Feb / Mar;9(2): 182-212, the entire contents of each of which are incorporated herein by reference in their entireties.

[0045] Recombinant antibody: As used herein, the term "recombinant antibody", as used herein, is intended to include all antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), including, for example, antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29: 128- 145; Hoogenboom H., and Chames P. (2000) Immunology Today 21 :371-378), antibodies7107489isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21:364-370) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. In some embodiments, recombinant human antibodies are provided herein. In certain embodiments, such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo. One embodiment of the disclosure provides fully human antibodies, e.g., capable of binding human KLK5 or KLK7, which can be generated using appropriate techniques, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO 2005 / 007699 A2.

[0046] Selective: As used herein, the term “selective” or “selectively” refers to the ability of a molecule to produce an effect (e.g., inhibit, antagonize, agonize, etc) in relation to its target molecule compared to a reference molecule. For example, a molecule that selectively inhibits its target molecule means that this molecule is capable of inhibiting its target molecule with a degree that is distinguishable from a reference molecule in an inhibition assay or other inhibitory context. For example, with respect to an inhibitor, the term, “selectively inhibits”, refers to the ability of the inhibitor to inhibit its target molecule with a degree that is distinguishable from a reference molecule that is not substantially inhibited in an inhibition assay, e.g., to an extent that permit selective inhibition of the target molecule, as described herein. Once the reaction is terminated, the signal produced by inhibiting the target molecule can be measured. The half maximal inhibitor concentration for the target molecule and the reference molecule can be calculated.

[0047] Specifically binds: As used herein, the term “specifically binds” refers to the ability of a molecule to bind to a binding partner with a degree of affinity or avidity that enables the molecule to be used to distinguish the binding partner from an appropriate control in a binding assay or other binding context. With respect to an antibody, the term, “specifically binds”, refers to the ability of the antibody to bind to a specific antigen with a7107489degree of affinity or avidity, compared with an appropriate reference antigen or antigens, that enables the antibody to be used to distinguish the specific antigen from others, as described herein. In some embodiments, an antibody specifically binds to a target if the antibody has a KD for binding the target of at least about 10'4M, 10'5M, 10'6M, 10'7M, 10'8M, 10'9M, 10’10M, 10'11M, 10'12M, IO’13M, or less. In some embodiments, an antibody specifically binds KLK5 or KLK7.

[0048] Subject: As used herein, the term “subject” refers to a mammal. In some embodiments, a subject is non-human primate, or rodent. In some embodiments, a subject is a human. In some embodiments, a subject is a patient, e.g., a human patient that has or is suspected of having a disease.

[0049] Treatment: As used herein, the term “treating” or “treatment” refers to the application or administration of a composition including one or more active agents (e.g., anti- KLK5 antibodies, anti-KLK7 antibodies, anti-KLK5xKLK7 antibodies) to a subject, who has a target disease or disorder, a symptom of the disease / disorder, or a predisposition toward the disease / disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease or disorder. Alleviating a target disease / disorder includes delaying or preventing the development or progression of the disease, or reducing disease severity. It will be understood that references to treating or treatment may also refer to antibodies.II. Anti-KLK5 Antibodies, Anti-KLK7 Antibodies and Anti-KLK5xKLK7 Antibodies(a) Anti-KLK5 Antibodies

[0050] In some embodiments, an antibody targeting KLK5 (referred to as an anti- KLK5 antibody) is an antibody specific for Kallikrein-5 (KLK5). Provided herein, in some aspects, are antibodies that bind to KLK5 (e.g., human KLK5, or mouse KLK5) with high specificity and affinity. In some embodiments, the anti-KLK5 antibody described herein specifically binds to an epitope of KLK5 that is exposed or becomes exposed to an antibody. In some embodiments, anti-KLK5 antibodies provided herein bind specifically to KLK5 from human, non-human primates, mouse, rat, etc. In some embodiments, anti-KLK5 antibodies provided herein specifically bind to human KLK5. In some embodiments, anti-KLK5 antibodies provided herein specifically bind to mouse KLK5.

[0051] Kallikrein-5, also known as stratum corneum tryptic enzyme (SCTE), is a serine protease expressed in the epidermis, is encoded by the KLK5 gene. The KLK5 gene is7107489one of the fifteen kallikrein subfamily members located in a cluster on chromosome. Its expression is up-regulated by estrogens and progestins. KLK5 is expressed in the stratum granulosum and stratum comeum. In some embodiments, KLK5 regulates epidermal desquamation. In some embodiments, KLK5 regulates epidermal desquamation in conjunction with another member of the Kallikrein family proteases (e.g., KLK7 and / or KLK14). In some embodiments, KLK5 degrades proteins which form the epidermis (e.g., stratum corneum, stratum lucidum, stratum granulosum, stratum spinosum, or stratum basale). In some embodiments, KLK5 degrades proteins which form the stratum comeum and / or stratum granulosum (e.g., Corneodesmosin (CDSN), desmoglein 1 (DSG1), and desmocollin 1 (DSC1), etc). In the epidermis (e.g., stratum granulosum and stratum corneum) KLK5 is expressed in an inactive form (sometimes referred to as the proform or pro-form), proKLK5, and can autoactivate itself. When activated, KLK5 can, through a proteolytic cleavage, convert both proKLK7 and proKLK14 to active forms. Active KLK14 is then able to activate newly produced proKLK5, thus creating a positive feedback loop (see, e.g., Nauroy et al., Kallikreins: Essential epidermal messengers for regulation of the skin microenvironment during homeostasis, repair and disease, Matrix Biol Plus. 2019;6- 7:100019).

[0052] KLK7 and KLK14 also degrade proteins which form the stratum comeum and / or stratum granulosum (e.g., Corneodesmosin (CDSN), desmoglein 1 (DSG1), and desmocollin 1 (DSC1), etc). Structural proteins, such as CDSN, DSG1, DSC1, are adhesive proteins of the extracellular part of the corneodesmosomes, the junctional stmctures that mediate corneocyte cohesion. The degradation of these proteins at the epidermis surface lead to desquamation, which may lead to skin barrier defects (e.g., stratum corneum detachment, decreased permeability barrier, allergy and inflammation, etc). KLK5 and KLK7 have been implicated in this process (see, e.g., Caubet et al., Degradation of Comeodesmosome Proteins by Two Serine Proteases of the Kallikrein Family, SCTE / KLK5 / hK5 and SCCE / KLK7 / hK7, Journal of Investigative Dermatology, Volume 122, Issue 5, May 2004, Pages 1235-1244). Inhibition of KLK5 and / or KLK7 promotes improved skin barrier integrity and reduced inflammation (e.g., Chavarria-Smith et al., Dual antibody inhibition of KLK5 and KLK7 for Netherton syndrome and atopic dermatitis, SCIENCE TRANSLATIONAL MEDICINE, 14 Dec 2022, Vol 14, Issue 675).

[0053] In some embodiments, an anti-KLK5 antibody described herein specifically binds to an epitope on human KLK5. Exemplary amino acid sequences of human KLK5 are set forth in NCBI Accession Numbers NP_001070959.1, NP_001070960.1, or NP_036559.1,7107489and UniProt Accession Numbers: Q8IU55, Q6S9W8, M0QXX2, Q9P0G3, A0A2I2MP48, or A0A2I2MP49, the entire sequences of which are incorporated herein by reference.

[0054] In some embodiments, an anti-KLK5 antibody described herein specifically binds to an epitope on mouse KLK5. Exemplary amino acid sequences of mouse KLK5 are set forth in NCBI Accession Numbers NP_081082.1, XP_006541213.1, XP_006541214.1, XP_006541215.1, XP_036009294.1, or XP_036009295.1, and UniProt Accession Numbers P15945, or Q9D140, the entire sequences of which are incorporated herein by reference.

[0055] In some embodiments, an anti-KLK5 antibody described herein specifically binds to an epitope on KLK5 (e.g., the catalytic domain / pocket of human KLK5 or mouse KLK5). In some embodiments, an anti-KLK5 antibody described herein prevents KLK5 (e.g., human or mouse KLK5) from cleaving its substrates. In some embodiments, an anti-KLK5 antibody described herein bind to a fragment of a KLK5 (e.g., human or mouse KLK5). The fragment of KLK5 (e.g., human or mouse) may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, between about 75 and about 150 amino acids, between about 25 and about 100 amino acids, between about 10 and about 30 amino acids in length. Not wishing to be bound to any particular theory, and in some embodiments, a heavy chain (HC) complementarity-determining region 3 (CDR3) of any one of the anti-KLK5 antibodies described herein inhibits KLK5 (e.g., human or mouse KLK5) by binding to the catalytic domain / pocket of KLK5.

[0056] In some embodiments, an anti-KLK5 antibody described herein inhibits KLK5 protease activity. In some embodiments the anti-KLK5 antibody inhibits KLK5 cleavage of BOC-Val-Pro-Arg-AMC with an IC50 of less than 30nM, less than 25 nM, less than 20 nM, less than 15 nM, less than 10 nM, less than 5 nM, less than 3 nM, less than 2.5 nM, less than 2 nM, or less than 1.5 nM, less than InM, less than 0.5nM, less than 0.3nM, less than 0.25nM, less than 0.2 nM, less than 0.1 nM, or less than 0.05nM.

[0057] In some embodiments, an anti-KLK5 antibody described herein binds specifically to the active form of KLK5. In some embodiments, the anti-KLK5 antibody described herein does not bind to the inactive form of KLK5. In some embodiments, an anti- KLK5 antibody described herein binds specifically to the active site of KLK5. The active site of KLK5 is the site at which the KLK5 substrate molecules bind to undergo cleavage. The active site may also be known as the catalytic domain, or catalytic triad. In some embodiments, the active site (i.e., catalytic domain or catalytic triad) of KLK5 consists of7107489amino acids Serl95, His57, and Aspl02 of KLK5 (see, e.g., Goettig et al., Natural and synthetic inhibitors of kallikrein-related peptidases (KLKs), Biochimie. 2010 Nov; 92(11): 1546-1567).

[0058] In some embodiments, antibodies described herein are optimized versions (e.g., affinity matured) of the parental antibody. In some embodiments, an antibody described herein specifically binds a KLK5 (e.g., a human or mouse KLK5) with binding affinity (e.g., as indicated by KD) of at least about 10'4M, 10'5M, 10'6M, 10'7M, 10'8M, 10'9M, 10'10M, 10'11M, 10'12M, IO’13M, or less. In some embodiments, an antibody described herein specifically binds a KLK5 (e.g., a human or mouse KLK5) with binding affinity (e.g., as indicated by KD) of between IxlO'10M and 5xl0'9M, between IxlO'10M and IxlO'9M, between 5xlO'10and IxlO'9M, between 5xl0'nand IxlO'10M, between IxlO'11and 5xlO'10M, or between 5xl0'13and IxlO'12M. For example, an antibody of the present disclosure can bind to a KLK5 protein (e.g., human or mouse KLK5) with an affinity between 1 pM and 500 nM, e.g., between 50 pM and 100 nM, between 500 pM and 50 nM, between 1 pM and 100 pM, between 10 pM and 100 pM, between 50 pM and 100 pM, between 100 pM and 500 pM, between 500 pM and 1 nM, between 1 nM and 5 nM, between 1 nM and 10 nM, between 5 nM and 25 nM, between 10 nM and 50 nM between 50 nM and 100 nM, between 100 nM and 500 nM. The disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a KLK5 protein (e.g., human or mouse KLK5) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 1 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of an antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, antibodies described herein binds to KLK5 with a KD of sub-nanomolar range.

[0059] Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance (SPR), florescent activated cell sorting (FACS) or spectroscopy (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS- P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v / v) surfactant P20) and PBS buffer (lOmM PO4-3, 137mM NaCl, and 2.7mM KC1). These techniques can be used to measure the concentration of bound proteins as a function of target protein concentration. The concentration of bound protein ([[Bound]]) is generally related to the concentration of free target protein ([[Free]]) by the following equation:

[0060] [[Bound]] = [[Free]] / (Kd+[[Free]])7107489

[0061] It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.

[0062] Exemplary anti-KLK5 antibody sequences (e.g., the heavy chain (HC) and light chain (LC) sequences, heavy chain variable domain (VH) and light chain variable domain (VL), CDR sequences are provided in Tables la and lb.Table la. Examples of anti-KLK5 antibodies7107489710748971074897107489710748971074897107489

[0063] In some embodiments, certain amino acid positions in an antibody described herein (e.g., amino acids in the VH / VL regions and / or CDR regions) are substitutable and the substitution results in an antibody with substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, protease activity inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody. In order to identify a substitutable position of an antibody, the amino acid sequence of that7107489antibody is compared to the sequences of other antibodies belonging to the same group as that antibody. If the identity of that amino acid varies between the different related antibodies of a group at any particular position, that position is a substitutable position of the antibody. In other words, a substitutable position is a position in which the identity of the amino acid varies between the related antibodies. Positions that contain a constant amino acid are not substitutable positions.

[0064] In some embodiments, the above method may be employed to provide a consensus antibody sequence. In such a consensus sequence, a non-substitutable position is indicated by the amino acid present at that position, and a substitutable position is indicated as an "X".

[0065] Depending on how the antibodies are to be employed, X may be a) any amino acid, b) any amino acid present at that position in any of the related antibodies in the group or a conservatively substituted variant thereof or c) any amino acid present at that position in any of the related antibodies in the group. Any antibody having a sequence that is encompassed by the consensus should bind to the same antigen as any of the related antibodies.

[0066] In some embodiments, the method described above may be employed in methods of designing and making a variant of a parental antibody that at least maintains (e.g., maintains or increases) the antigen binding activity of the parental antibody. Because antibodies containing substitutions at substitutable positions have already been produced and tested, substitutions at those positions can be made in the knowledge that they should not significantly decrease the binding activity of the antibody. In general, an antibody variant of a parental antibody has an antigen binding affinity that is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 100% (e.g., at least 150%, at least 200%, at least 500%, at least 1000%, usually up to at least 10,000%) of the binding affinity of the parental antibody to a particular antigen.

[0067] In some embodiments, a substitutable position of a parental antibody may be substituted by a) any of the 20 naturally occurring amino acids to produce random substitutions, b) an amino acid having biochemical properties similar to the amino acid already present at the substitutable position to produce conservative substitutions, c) an amino acid that is present at the same position in a related antibody to produce a directed substitution, or d) an amino acid that is present at the same position in a similar human antibody to produce a humanizing substitution. A substitution may be made at any part of an antibody variable region, including any framework region or CDR. In certain embodiments, a7107489single substitutable amino acid may be substituted. However, in other embodiments, a plurality of substitutable amino acids (e.g., up to about 5 or 10 or more) may be substituted. In particular embodiments, the type of substitution that can be made at each substitutable position may be indicated by the types of amino acids present at that position in the related antibodies. For example, if unrelated amino acids (e.g., Ala, Gly, Cys, Glu and Thr) are present at a certain position of a group of related antibodies, then any amino acid could be substituted at that position without significantly reducing binding activity of the antibody. Exemplary amino acids substitutions of an anti-KLK5 antibody described herein are set forth in Table lb:Table lb. Exemplary Anti-KLK5 Antibody Amino Acid Substitutions7107489

[0068] In some embodiments, an antibody of the present disclosure comprises a HCCDR1 comprising the amino acid sequence of FTFX1X2YX3MN (SEQ ID NO: 253), in which Xi is S, G, E, or N, X2 is S, H, or D, or X3 is S or A; a HC CDR2 comprising the amino acid sequence of YISSSSSX4IX5YADSVKG (SEQ ID NO: 254), in which X4 is T, F, or Y, X5 is Y or D; a HC CDR3 comprising the amino acid sequence of ARDLTX6X7QSESYYYYGMDV (SEQ ID NO: 255), in which X6is S or D, or X7is M or R; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 4; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 6.

[0069] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 comprising the amino acid sequence of GSIXISSSYYWX2 (SEQ ID NO: 256), in which Xi is S or P, or X2 is G, A, or S; a HC CDR2 comprising the amino acid sequence of X3IX4YSGSTYYNPSLKS (SEQ ID NO: 257), X3is S or N, or X4is S or Y; a HC CDR3 comprising the amino acid sequence of ARGEYDRSXsXeX^sGXgDV (SEQ ID NO: 258), in which X5 is Y or A, Xf> is Y or L, X7is Y or F, Xs is Y or W, or X9 is M or L; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 22; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 23; and / or a LC CDR3 comprising the amino acid sequence of QQAFSSPX9 (SEQ ID NO: 259), in which X9 is T or S.

[0070] In some embodiments, an antibody of the present disclosure comprises a HC7107489CDR1 comprising the amino acid sequence of X1TFX2X3YX4X5X6 (SEQ ID NO: 260), in which Xi is Y or G, X2 is T, S, or N, X3 is G or N, X4 is Y, S, H, or V, X5 is M or I, or Xf> is H or S; a HC CDR2 comprising the amino acid sequence of X7IX8PX9X10GX11AX12YAQKFQG (SEQ ID NO: 261), in which X7is G or L, X8is I or F, X9 is I, P or T, X10 is S or F, Xu is T or Y, or X12 is N, H or V; a HC CDR3 comprising the amino acid sequence of ARX13X14ASGYYDRSYYX15X16GX17DV (SEQ ID NO: 262), in which X13 is G, Q or A, X14 is S or E, X15 is Y or R, Xi6 is Y or D, or X17 is M or L; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 4; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 comprising the amino acid sequence of QQVX18SFPX19T (SEQ ID NO: 263), in which Xis is S or I, or X19 is Y or Q.

[0071] In some embodiments, an antibody of the present disclosure comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-KLK5 antibodies selected from Tables la and lb. In some embodiments, an antibody of the present disclosure comprises the HC CDR3 amino acid sequences from any one of the anti-KLK5 antibodies selected from Tables la and lb. In some embodiments, an antibody of the present disclosure comprise the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Tables la and lb. In some embodiments, an antibody of the present disclosure comprises the LC CDR3 amino acid sequences from any one of the anti-KLK5 antibodies selected from Tables la and lb. In some embodiments, an antibody of the present disclosure comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-KLK5 antibodies selected from Tables la and lb. In some embodiments, an antibody of the present disclosure comprise the LC CDR1, LC CDR2, and LC CDR3 s provided for any one of the anti-KLK5 antibodies selected from Tables la and lb.

[0072] In some embodiments, an antibody of the present disclosure comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-KLK5 antibodies selected from Tables la and lb. In some embodiments, antibody heavy and / or light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for an antigen. Accordingly, an antibody of the disclosure may include at least the heavy and / or light chain CDR3s of any one of the anti-KLK5 antibodies selected from Tables la and lb.

[0073] Also within the scope of the present disclosure are variants of any of the exemplary anti-KLK5 antibodies as disclosed herein. A variant may contain one or more amino acid residue variations in the VH and / or VL, or in one or more of the HC CDRs and / or7107489one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, protease activity inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody.

[0074] In some embodiments, an antibody of the disclosure have one or more CDRs (e.g., HC CDR or LC CDR) sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 sequences from one of the anti- KLK5 antibodies selected from Tables la and lb. In some embodiments, the position of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). For example, in some embodiments, the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and / or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). In another embodiment, the length of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immuno specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived).

[0075] Accordingly, in some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK5 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR37107489described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK5 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK5 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK5 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK5 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). Any method can be used to ascertain whether immuno specific binding to KLK5 (e.g., human or mouse KLK5) is7107489maintained, for example, using binding assays and conditions described in the art.

[0076] In some examples, an antibody of the disclosure have one or more CDR (e.g., HC CDR or LC CDR) sequences substantially similar to any one of the anti-KLK5 antibodies selected from Tables la and lb. For example, an antibody described herein may include one or more CDR sequence(s) from any of the anti-KLK5 antibodies selected from Tables la and lb containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-KLK5 antibodies selected from Tables la and lb) so long as specific binding to KLK5 (e.g., human or mouse KLK5) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, any of the amino acid variations in any of the CDRs provided herein may be conservative variations. Conservative variations can be introduced into the CDRs at positions where the residues are not likely to be involved in interacting with a KLK5 (e.g., human or mouse KLK5), for example, as determined based on a crystal structure. Some aspects of the disclosure provide antibodies that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the HC CDR sequences (e.g., HC CDR1, HC CDR2, and HC CDR3) provided herein, for example, any of the HC CDR sequences provided in any one of the anti-KLK5 selected from Tables la and lb. In some embodiments, any of the VL domains provided herein include one or more of the LC CDR sequences (e.g., LC CDR1, LC CDR2, and LC CDR3) provided herein, for example, any of the LC CDR sequences provided in any one of the anti-KLK5 antibodies selected from Tables la and lb.

[0077] In some embodiments, an antibody of the disclosure include any antibody that includes a heavy chain variable domain and / or a light chain variable domain of any one of the anti-KLK5 antibodies selected from Tables la and lb, and variants thereof. In some embodiments, an antibody of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of any anti-KLK5 antibodies selected from Tables la and lb.

[0078] Aspects of the disclosure provide antibodies having a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein. In some embodiments, an antibody comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% e.g., at least 80%, at least710748985%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the heavy chain variable sequence and / or any light chain variable sequence of any one of the anti-KLK5 antibodies selected from Tables la and lb. In some embodiments, the homologous heavy chain variable and / or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) may occur within a heavy chain variable and / or a light chain variable sequence excluding any of the CDR sequences provided herein. In some embodiments, an antibody provided herein comprise a heavy chain variable sequence and a light chain variable sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-KLK5 antibodies selected from Tables la and lb.

[0079] In some embodiments, an antibody of the present disclosure is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Tables la and lb). In some embodiments, an antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 that are the same as the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 shown in Tables la and lb, and comprises a humanized heavy chain variable region and / or a humanized light chain variable region.

[0080] In some embodiments, an antibody of the present disclosure is a humanized antibody comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-KLK5 antibodies listed in Tables la and lb. Alternatively or in addition, the antibody of the present disclosure is a humanized antibody comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-KLK5 antibodies listed in Tables la and lb.

[0081] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.

[0082] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid7107489sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0083] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. “Collectively,” as used anywhere in the present disclosure, means that the total number of amino acid variations in all of the three heavy chain CDRs is within the defined range. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0084] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 1, HC CDR2 having the amino acid sequence of SEQ ID NO: 2, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0085] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 1; a HC CDR2 having no more than 3 amino acid variations (e.g., no more7107489than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 2; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0086]

[0087] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 3. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 11. In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 3. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 11.

[0088] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 3. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 11.

[0089] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having7107489the amino acid sequence of SEQ ID NO: 10. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.

[0090] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 7, a HC CDR2 having the amino acid sequence of SEQ ID NO: 8, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0091] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 7, HC CDR2 having the amino acid sequence of SEQ ID NO: 8, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0092] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 7, HC CDR2 having the amino acid sequence of SEQ ID NO: 8, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0093] In some embodiments, an anti-KLK5 antibody of the present disclosure7107489comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 7; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 8; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0094] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 10. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 11.

[0095] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 10. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 11.

[0096] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 10. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 11.7107489

[0097] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 14. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.

[0098] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 12, a HC CDR2 having the amino acid sequence of SEQ ID NO: 13, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.

[0099] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 12, HC CDR2 having the amino acid sequence of SEQ ID NO: 13, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000100] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 12, HC CDR2 having the amino acid sequence of SEQ ID NO: 13, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of7107489SEQ ID NO: 6.[000101] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 12; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 13; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6. [000102] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 14. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 11.[000103] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 11.[000104] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 14. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at7107489least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 11.[000105] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 16. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.[000106] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 15, a HC CDR2 having the amino acid sequence of SEQ ID NO: 13, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000107] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 15, HC CDR2 having the amino acid sequence of SEQ ID NO: 13, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000108] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 15, HC CDR2 having the amino acid sequence of SEQ ID NO: 13, and HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the7107489to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000109] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 15; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 13; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 9. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6. [000110] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 16. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 11.[000111] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 16. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 11.[000112] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 16. Alternatively or in addition, the anti-KLK5 antibody of the present7107489disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 11.[000113] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 18. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.[000114] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 12, a HC CDR2 having the amino acid sequence of SEQ ID NO: 13, a HC CDR3 having the amino acid sequence of SEQ ID NO: 17, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000115] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 12, HC CDR2 having the amino acid sequence of SEQ ID NO: 13, and HC CDR3 having the amino acid sequence of SEQ ID NO: 17. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000116] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 12, HC CDR2 having the amino acid sequence of SEQ ID NO: 13, and HC CDR3 having the amino acid sequence of SEQ ID NO: 17. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g.,7107489at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 6.[000117] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 12; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 13; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 17. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 6. [000118] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 18. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 11.[000119] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 18. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 11.[000120] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at7107489least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 18. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 11.[000121] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 24. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29.[000122] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 19, a HC CDR2 having the amino acid sequence of SEQ ID NO: 20, a HC CDR3 having the amino acid sequence of SEQ ID NO: 21, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000123] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 19, HC CDR2 having the amino acid sequence of SEQ ID NO: 20, and HC CDR3 having the amino acid sequence of SEQ ID NO: 21. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000124] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 19, HC CDR2 having the amino acid sequence of SEQ ID NO: 20, and HC CDR3 having the amino acid sequence of SEQ ID7107489NO: 21. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO:22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000125] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 19; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 20; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 21. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 23; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000126] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 24. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 29.[000127] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 24. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 29.7107489[000128] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 24. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 29.[000129] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 28. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29.[000130] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 25, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 27, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000131] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 25, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 27. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000132] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%,7107489at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 25, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 27. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000133] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 25; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 26; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 27. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 23; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000134] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 28. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 29.[000135] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 28. Alternatively or in addition, the anti-KLK57107489antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 29.[000136] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 28. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 29.[000137] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 32. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 37.[000138] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 30, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 31, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 35.[000139] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 30, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 35.7107489[000140] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 30, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 35.[000141] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 30; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 26; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 31. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 23; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 35.[000142] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 32. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 37.[000143] In some embodiments, an anti-KLK5 antibody of the present disclosure7107489comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 32. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 37.[000144] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 32. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 37.[000145] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 36. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29.[000146] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 30, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 33, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000147] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 30, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 33. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid7107489variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000148] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 30, HC CDR2 having the amino acid sequence of SEQ ID NO: 26, and HC CDR3 having the amino acid sequence of SEQ ID NO: 33. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 22, LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000149] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 30; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 26; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 33. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 22; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 23; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 34.[000150] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 36. Alternatively or in7107489addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 29.[000151] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 36. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 29.[000152] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 36. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 29.[000153] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43.[000154] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 38, a HC CDR2 having the amino acid sequence of SEQ ID NO: 39, a HC CDR3 having the amino acid sequence of SEQ ID NO: 40, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000155] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 38, HC CDR2 having the amino acid sequence of SEQ ID NO: 39, and HC CDR3 having the amino acid7107489sequence of SEQ ID NO: 40. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000156] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 38, HC CDR2 having the amino acid sequence of SEQ ID NO: 39, and HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000157] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 38; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 39; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO:710748941.[000158] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 42. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 43.[000159] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 42. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 43.[000160] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 42. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 43.[000161] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 46. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43.[000162] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 44, a HC CDR2 having the amino acid sequence of SEQ ID NO: 45, a HC CDR3 having the amino acid sequence of SEQ ID NO: 40, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000163] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more7107489than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 44, HC CDR2 having the amino acid sequence of SEQ ID NO: 45, and HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000164] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 44, HC CDR2 having the amino acid sequence of SEQ ID NO: 45, and HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000165] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 44; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 45; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as7107489compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000166] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 46. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 43.[000167] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 46. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 43.[000168] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 46. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 43.[000169] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 49. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43.[000170] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 47, a HC CDR2 having the amino acid sequence of SEQ ID NO: 48, a HC CDR3 having the amino acid sequence of SEQ ID NO: 40, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence7107489of SEQ ID NO: 41.[000171] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 47, HC CDR2 having the amino acid sequence of SEQ ID NO: 48, and HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000172] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 47, HC CDR2 having the amino acid sequence of SEQ ID NO: 48, and HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000173] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 47; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 48; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 40. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 37107489amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000174] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 49. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 43.[000175] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 49. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 43.[000176] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 49. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 43.[000177] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43.[000178] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 47, a HC CDR2 having the amino7107489acid sequence of SEQ ID NO: 48, a HC CDR3 having the amino acid sequence of SEQ ID NO: 50, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000179] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 47, HC CDR2 having the amino acid sequence of SEQ ID NO: 48, and HC CDR3 having the amino acid sequence of SEQ ID NO: 50. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000180] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 47, HC CDR2 having the amino acid sequence of SEQ ID NO: 48, and HC CDR3 having the amino acid sequence of SEQ ID NO: 50. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000181] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 47; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 48; and / or a HC CDR3 having no more than 3 amino acid7107489variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 50. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000182] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 51. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 43.[000183] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 43.[000184] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 51. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 43.[000185] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 53. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light7107489chain variable domain having the amino acid sequence of SEQ ID NO: 43.[000186] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 44, a HC CDR2 having the amino acid sequence of SEQ ID NO: 45, a HC CDR3 having the amino acid sequence of SEQ ID NO: 52, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000187] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 44, HC CDR2 having the amino acid sequence of SEQ ID NO: 45, and HC CDR3 having the amino acid sequence of SEQ ID NO: 52. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000188] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 44, HC CDR2 having the amino acid sequence of SEQ ID NO: 45, and HC CDR3 having the amino acid sequence of SEQ ID NO: 52. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000189] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence7107489of SEQ ID NO: 44; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 45; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 52. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 41.[000190] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 53. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 43.[000191] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 53. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 43.[000192] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 53. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 43.[000193] In some embodiments, an anti-KLK5 antibody of the present disclosure7107489comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 58. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 59.[000194] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 54, a HC CDR2 having the amino acid sequence of SEQ ID NO: 55, a HC CDR3 having the amino acid sequence of SEQ ID NO: 56, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 57.[000195] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 54, HC CDR2 having the amino acid sequence of SEQ ID NO: 55, and HC CDR3 having the amino acid sequence of SEQ ID NO: 56. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 57.[000196] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 54, HC CDR2 having the amino acid sequence of SEQ ID NO: 55, and HC CDR3 having the amino acid sequence of SEQ ID NO: 56. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 57.7107489[000197] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 54; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 55; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 56. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 57.[000198] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 58. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 59.[000199] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 58. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 59.[000200] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 58. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at7107489least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 59.[000201] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 64. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 65.[000202] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 60, a HC CDR2 having the amino acid sequence of SEQ ID NO: 61, a HC CDR3 having the amino acid sequence of SEQ ID NO: 62, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 63.[000203] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 60, HC CDR2 having the amino acid sequence of SEQ ID NO: 61, and HC CDR3 having the amino acid sequence of SEQ ID NO: 62. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 63.[000204] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 60, HC CDR2 having the amino acid sequence of SEQ ID NO: 61, and HC CDR3 having the amino acid sequence of SEQ ID NO: 62. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the7107489to the LC CDR1 having the amino acid sequence of SEQ ID NO: 4, LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and LC CDR3 having the amino acid sequence of SEQ ID NO: 63.[000205] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 60; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 61; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 62. Alternatively or in addition, the anti- KLK5 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 4; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 63.[000206] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 64. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 65.[000207] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 64. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 65.[000208] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth7107489in SEQ ID NO: 64. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 65.[000209] The antibodies described herein can be in any antibody form, including, but not limited to, intact (i.e., full-length) antibodies, antigen-binding fragments thereof (such as Fab, F(ab'), F(ab')2, Fv), single chain antibodies, bi-specific antibodies, or nanobodies. In some embodiments, the anti-KLK5 antibody described herein is a scFv. In some embodiments, the anti-KLK5 antibody described herein is a scFv-Fab (e.g., scFv fused to a portion of a constant region).[000210] In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising a signal peptide (e.g., an N-terminal signal peptide) in the heavy chain and / or a light chain comprising a signal peptide (e.g., an N-terminal signal peptide). A signal peptide of a protein is a short tag of amino acids at the N- or C-terminal that predestinates the protein location extracellularly or within the cell to the organelles. Known organelle targeting SPs include the nucleus localization or export signal, mitochondria signals, endoplasmic reticulum secretion or retention signal, or peroxisome signals. In some embodiments, an antibody chain (e.g., heavy chain and / or light chain) is tagged with an ER secretion signal peptide at the N-terminal and translocated into the ER lumen before being passed to the Golgi apparatus and sorted into secretory vesicles for extracellular secretion. In some embodiments, during or after translocation of the antibody chain, the signal peptide is cleaved (e.g., by a signal peptidase) thereby generating a free signal peptide and a mature protein. In some embodiments, a signal peptide is completely cleaved during or after translocation. In some embodiments, a signal peptide is partially cleaved during or after translocation and the mature protein comprises a few amino acids overhang (e.g., at the N- terminal) in addition to the mature heavy chain and / or light chain amino acid sequence. Exemplary signal peptide amino acid sequences include MGWSCIILFLVATATGAHS (SEQ ID NO: 327).[000211] In some embodiments, an anti-KLK5 antibody comprises a heavy chain comprising a signal peptide is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 327. In some embodiments, an anti-KLK5 antibody comprises a light chain comprising a signal peptide is at least 75% (e.g.,7107489at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 327. In some embodiments, an anti-KLK5 antibody comprises a heavy chain comprising a heavy chain amino acid sequence set forth in Table la and a signal peptide that comprises the amino acid sequence of SEQ ID NO: 327, and / or a light chain comprising a light chain amino acid sequence set forth in Table la and a signal peptide that comprises the amino acid sequence of SEQ ID NO: 327.[000212] In some embodiments, an anti-KLK5 antibody of the present disclosure is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. Chimeric antibodies refer to antibodies having a variable region or part of variable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a nonhuman mammal such as mouse, rabbit, and rat), while the constant portions are homologous to the sequences in antibodies derived from another mammal such as human. In some embodiments, amino acid modifications can be made in the variable region and / or the constant region.[000213] In some embodiments, an antibody of the present disclosure comprises a VL domain and / or VH domain of any one of the anti-KLK5 antibodies selected from Tables la and lb, and comprises a constant region comprising the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule. Non-limiting examples of human constant regions are described in the art, e.g., see Kabat E A et al., (1991) supra.[000214] In some embodiments, the light chain of any of the anti-KLK5 antibodies described herein may further comprise a light chain constant region (CL), which can be any CL known in the art. In some examples, the CL is a kappa light chain. In other examples, the CL is a lambda light chain. In some embodiments, the CL is a kappa light chain.[000215] In some embodiments, an antibody of the present disclosure comprises a VL domain and / or VH domain of any one of the anti-KLK5 antibodies selected from Tables la and lb, and comprises a constant region comprising the amino acid sequences of the constant regions of an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule. Non-limiting examples of human constant regions are described7107489in the art, e.g., see Kabat E A et al., (1991) supra.[000216] An exemplary wild-type human IgGl constant region is set forth in SEQ ID NO: 523 below: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKALPAP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGK (SEQ ID NO: 523)[000217] In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises a mutant human IgGl constant region (e.g., a mutant human IgGl constant region with reduced Fey receptor binding). In some embodiments, the heavy chain of an anti- KLK5 antibody described herein comprises a mutant human IgGl constant region with reduced Fey receptor binding and thus exhibits reduced effector functions. For example, the introduction of LALA mutations (a mutant derived from mAb bl2 that has been mutated to replace the lower hinge residues Leu234 Leu235 with Ala234 and Ala235 based on EU numbering) in the CH2 domain of human IgGl is known to reduce Fey receptor binding (Bruhns, P., et al. (2009) and Xu, D. et al. (2000)). In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises a mutant human IgGl constant region that comprises L234A and L235A substitutions according to EU numbering. In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises a mutant human IgGl constant region that comprises a P329A substitution according to EU numbering (see, e.g., P329A as described in US6528624 Bl, entitled “Polypeptide variants”, granted on March 4, 2003; US8674083B2, entitled “Polypeptide variants with altered effector function”, granted on March 18, 2014, the contents regarding P328A substitution in each of which are incorporated herein by reference). In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises a mutant human IgGl constant region that comprises L234A, L235A and P329A substitutions according to EU numbering.[000218] In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises a mutant human IgGl constant region with enhanced FcPv receptor binding and thus exhibits prolonged serum half-life). Any suitable serum half-life extension mutations can be introduced to the heavy chain constant region of an anti-KLK5 antibody described herein, (e.g., T250Q / M428Q (QL) substitutions, M252Y / S254T / T256E (YTE) substitutions, M428L / N434S (LS) substitutions, or M428L / N434A (LA) substitutions). In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises a7107489mutant human IgGl constant region that comprises M428L and N434A substitutions according to EU numbering.[000219] In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises mutations that reduces effector function (e.g., L234A / L235A, P329A, or L234A / L235A / P329A), and mutations that increases serum half-life (e.g., T250Q / M428Q (QL), M252Y / S254T / T256E (YTE), M428L / N434S (LS), or M428L / N434A (LA)). In some embodiments, the heavy chain of an anti-KLK5 antibody described herein comprises L234A / L235A / P329A and M428L / N434A (LA) substitutions according to EU numbering. An exemplary mutant human IgGl constant region that comprises L234A / L235A / P329A and M428L / N434A (LA) substitutions is set forth in SEQ ID NO: 521: ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVF LFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRW SVLTVLHQDWLNGKEYKCKVSNKALAAP IEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV LHEALHAHYTQKSLSLSPGK (SEQ ID NO: 521)[000220] In some embodiments, the light chain of any of the anti-KLK5 antibodies described herein may further comprise a light chain constant region (CL), which can be any CL known in the art. In some examples, the light chain constant region is a kappa light chain constant region. In other examples, the light chain constant region is a lambda light chain constant region. An exemplary amino acid sequence for a human kappa light chain constant region is set forth in SEQ ID NO: 520: RTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 520) [000221] Other antibody heavy and light chain constant regions are well known in the art, e.g., those provided in the IMGT database (imgt.org) or at vbase2.org / vbstat.php., both of which are incorporated by reference herein.[000222] In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising a heavy chain constant region that comprises an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 521. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising any one of the VH as listed in Tables la and lb or any variants thereof and a heavy chain constant region that comprises an amino acid sequence that contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared7107489with SEQ ID NO: 521. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising any one of the VH as listed in Tables la and lb or any variants thereof and a heavy chain constant region that comprises an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 521. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising any one of the VH as listed in Tables la and lb or any variants thereof and a heavy chain constant region set forth in SEQ ID NO: 521.[000223] Alternatively or in addition, in some embodiments, an anti-KLK5 antibody described herein comprises a light chain comprising a light chain constant region that comprises an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 520. In some embodiments, the anti- KLK5 antibody described herein comprises a light chain comprising any one of the VL as listed in Tables la and lb or any variants thereof and a light chain constant region contains no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with SEQ ID NO: 520. In some embodiments, an anti-KLK5 antibody described herein comprises a light chain comprising any one of the VL as listed in Tables la and lb or any variants thereof and a light chain constant region that comprises an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 520. In some embodiments, the anti- KLK5 antibody described herein comprises a light chain comprising any one of the VL as listed in Tables la and lb or any variants thereof and a light chain constant region that comprises the amino acid sequence set forth in SEQ ID NO: 520. Examples of IgG heavy chain and light chain amino acid sequences of the anti- KLK5 antibodies described are provided in Table la above.[000224] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 154. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18,710748917, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 155. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 154. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 155. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 154. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 155.[000225] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 156. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 157. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 156. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 157. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 156. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 157.[000226] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more7107489than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 158. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 159. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 158. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 159. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 158. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 159.[000227] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 160. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 161. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 160. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 161. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID7107489NO: 160. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 161.[000228] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 162. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 163. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 162. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 163. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 162. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 163.[000229] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 164. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 165. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 164. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence7107489that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 165. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 164. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 165.[000230] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 166. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 167. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 166. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 167. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 166. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 167.[000231] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 168. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 169. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid7107489sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 168. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 169. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 168. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 169.[000232] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 170. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 171. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 170. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 171. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 170. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 171.[000233] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 172. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a7107489light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 173. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 172. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 173. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 172. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 173.[000234] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 174. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 175. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 174. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 175. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 174. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 175.[000235] In some embodiments, an anti-KLK5 antibody of the present disclosure7107489comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 176. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 177. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 176. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 177. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 176. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 177.[000236] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 178. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 179. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 178. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 179. In some embodiments, an anti-KLK5 antibody7107489described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 178. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 179.[000237] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 180. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 181. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 180. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 181. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 180. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 181.[000238] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 182. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 183. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 182. Alternatively or in addition, the anti-7107489KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 183. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 182. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 183.[000239] In some embodiments, an anti-KLK5 antibody of the present disclosure comprises a heavy chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the heavy chain amino acid sequence as set forth in SEQ ID NO: 184. Alternatively or in addition, the anti-KLK5 antibody of the present disclosure comprises a light chain containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the light chain amino acid sequence as set forth in SEQ ID NO: 185. In some embodiments, the anti-KLK5 antibody described herein comprises a heavy chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 184. Alternatively or in addition, the anti- KLK5 antibody described herein comprises a light chain comprising an amino acid sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 185. In some embodiments, an anti-KLK5 antibody described herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 184. Alternatively or in addition, the anti-KLK5 antibody described herein comprises a light chain comprising the amino acid sequence of SEQ ID NO: 185.[000240] In some embodiments, conservative mutations can be introduced into antibody sequences (e.g., CDRs or framework sequences) at positions where the residues are not likely to be involved in interacting with a target antigen (e.g., human or mouse KLK5), for example, as determined based on a crystal structure. In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the Fc region of an anti-KLK5 antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgGl) and / or CH3 domain (residues 341-447 of human IgGl) and / or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to alter one or more7107489functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding and / or antigen-dependent cellular cytotoxicity.[000241] In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the hinge region of the Fc region (CHI domain) such that the number of cysteine residues in the hinge region are altered (e.g., increased or decreased) as described in, e.g., U.S. Pat. No. 5,677,425. The number of cysteine residues in the hinge region of the CHI domain can be altered to, e.g., facilitate assembly of the light and heavy chains, or to alter (e.g., increase or decrease) the stability of the antibody or to facilitate linker conjugation.[000242] In some embodiments, one, two or more mutations (e.g., amino acid substitutions) are introduced into the Fc region of an antibody described herein (e.g., in a CH2 domain (residues 231-340 of human IgGl) and / or CH3 domain (residues 341-447 of human IgGl) and / or the hinge region, with numbering according to the Kabat numbering system (e.g., the EU index in Kabat)) to increase or decrease the affinity of the antibody for an Fc receptor (e.g., an activated Fc receptor) on the surface of an effector cell. Mutations in the Fc region of an antibody that decrease or increase the affinity of an antibody for an Fc receptor and techniques for introducing such mutations into the Fc receptor or fragment thereof are known to one of skill in the art. Examples of mutations in the Fc receptor of an antibody that can be made to alter the affinity of the antibody for an Fc receptor are described in, e.g., Smith P et al., (2012) PNAS 109: 6181-6186, U.S. Pat. No. 6,737,056, and International Publication Nos. WO 02 / 060919; WO 98 / 23289; and WO 97 / 34631, which are incorporated herein by reference.[000243] In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn- binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to alter (e.g., decrease or increase) half-life of the antibody in vivo. See, e.g., International Publication Nos. WO 02 / 060919; WO 98 / 23289; and WO 97 / 34631; and U.S. Pat. Nos. 5,869,046, 6,121,022, 6,277,375 and 6,165,745 for examples of mutations that will alter (e.g., decrease or increase) the half-life of an antibody in vivo.[000244] In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant domain, or FcRn- binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to decrease the half-life of the anti-KLK5 antibody in vivo. In some embodiments, one, two or more amino acid mutations (i.e., substitutions, insertions or deletions) are introduced into an IgG constant7107489domain, or FcRn-binding fragment thereof (preferably an Fc or hinge-Fc domain fragment) to increase the half-life of the antibody in vivo. In some embodiments, the antibodies can have one or more amino acid mutations (e.g., substitutions) in the second constant (CH2) domain (residues 231-340 of human IgGl) and / or the third constant (CH3) domain (residues 341-447 of human IgGl), with numbering according to the EU index in Kabat (Kabat E A et al., (1991) supra). In some embodiments, the constant region of the IgGl of an antibody described herein comprises a methionine (M) to tyrosine (Y) substitution in position 252, a serine (S) to threonine (T) substitution in position 254, and a threonine (T) to glutamic acid (E) substitution in position 256, numbered according to the EU index as in Kabat. See U.S. Pat. No. 7,658,921, which is incorporated herein by reference. This type of mutant IgG, referred to as "YTE mutant" has been shown to display fourfold increased half-life as compared to wild-type versions of the same antibody (see Dall'Acqua W F et al., (2006) J Biol Chem 281: 23514-24). In some embodiments, an antibody comprises an IgG constant domain comprising one, two, three or more amino acid substitutions of amino acid residues at positions 251-257, 285-290, 308-314, 385-389, and 428-436, numbered according to the EU index as in Kabat.[000245] In some embodiments, an antibody comprises an Fc region that has been engineered for half-life extension purposes, e.g., by introducing M428L and / or N434A substitutions. Non-limiting examples of such Fc variants effecting half-life in circulation are provided in Saunders KO, Conceptual Approaches to Modulating Antibody Effector Functions and Circulation Half-Life, Front Immunol. 2019; 10: 1296, the contents of which are incorporated herein by reference.[000246] In some embodiments, one, two or more amino acid substitutions are introduced into an IgG constant domain Fc region to alter the effector function(s) of the anti- KLK5 antibody, e.g., by introducing Leu234Ala and Leu235Ala mutations (commonly called LALA mutations). The effector ligand to which affinity is altered can be, for example, an Fc receptor or the Cl component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260. In some embodiments, the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating antibody thereby increasing tumor localization. See, e.g., U.S. Pat. Nos. 5,585,097 and 8,591,886 for a description of mutations that delete or inactivate the constant domain and thereby increase tumor localization. In some embodiments, one or more amino acid substitutions may be introduced into the Fc region of an antibody described herein to remove potential glycosylation sites on Fc region, which may reduce Fc receptor binding7107489(see, e.g., Shields R L et al., (2001) J Biol Chem 276: 6591-604).[000247] In some embodiments, one or more amino in the constant region of an anti- KLK5 antibody described herein can be replaced with a different amino acid residue such that the antibody has altered Clq binding and / or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551 (Idusogie et al). In some embodiments, one or more amino acid residues in the N-terminal region of the CH2 domain of an antibody described herein are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in International Publication No. WO 94 / 29351. In some embodiments, the Fc region of an antibody described herein is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and / or to increase the affinity of the antibody for an Fey receptor. This approach is described further in International Publication No. WO 00 / 42072.[000248] In some embodiments, an antibody comprises an Fc variant comprising amino acid substitutions L234A, L235E, and P329G, wherein numbering is according to the EU index. In some embodiments, the antibody comprising the Fc variant exhibits reduced affinity to one or more or each of FcyRJ, FcyRIIA, FcyRIIIA, and Clq as compared to an antibody comprising the wild- type human Fc region. Examples of such Fc variants are provided in International Patent Application Publication No.: WO 2021 / 055669 entitled, FC VARIANTS WITH REDUCED EFFECTOR FUNCTION, published on March 25, 2021; and US Patent Application Publication No.: US 2021-0087271 entitled, FC VARIANTS WITH REDUCED EFFECTOR FUNCTION, published on March 25, 2021, the contents of which are incorporated herein by reference.[000249] In some embodiments, the heavy and / or light chain variable domain(s) sequence(s) of the antibodies provided herein can be used to generate, for example, CDR- grafted, chimeric, humanized, or composite human antibodies or antigen-binding fragments, as described elsewhere herein. As understood by one of ordinary skill in the art, any variant, CDR-grafted, chimeric, humanized, or composite antibodies derived from any of the antibodies provided herein may be useful in the compositions and methods described herein and will maintain the ability to specifically bind KLK5, such that the variant, CDR-grafted, chimeric, humanized, or composite antibody has at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or more binding to KLK5 relative to the original antibody from which it is derived.[000250] In some embodiments, the antibodies provided herein comprise mutations that confer desirable properties to the antibodies. For example, to avoid potential complications7107489due to Fab-arm exchange, which is known to occur with native IgG4 mAbs, the antibodies provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse / human (IgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an IgGl-like hinge sequence. Accordingly, any of the antibodies may include a stabilizing ‘Adair’ mutation.[000251] In some embodiments, an antibody is modified, e.g., modified via glycosylation, phosphorylation, sumoylation, and / or methylation. In some embodiments, an antibody is a glycosylated antibody, which is conjugated to one or more sugar or carbohydrate molecules. In some embodiments, the one or more sugar or carbohydrate molecule are conjugated to the antibody via N-glycosylation, O-glycosylation, C- glycosylation, glypiation (GPI anchor attachment), and / or phosphoglycosylation. In some embodiments, the one or more sugar or carbohydrate molecules are monosaccharides, disaccharides, oligosaccharides, or glycans. In some embodiments, the one or more sugar or carbohydrate molecule is a branched oligosaccharide or a branched glycan. In some embodiments, the one or more sugar or carbohydrate molecule includes a mannose unit, a glucose unit, an N-acetylglucosamine unit, an N- acetylgalactosamine unit, a galactose unit, a fucose unit, or a phospholipid unit. In some embodiments, there are about 1-10, about 1-5, about 5-10, about 1-4, about 1-3, or about 2 sugar molecules. In some embodiments, a glycosylated antibody is fully or partially glycosylated. In some embodiments, an antibody is glycosylated by chemical reactions or by enzymatic means. In some embodiments, an antibody is glycosylated in vitro or inside a cell, which may optionally be deficient in an enzyme in the N- or O- glycosylation pathway, e.g. a glycosyltransferase. In some embodiments, an antibody is functionalized with sugar or carbohydrate molecules as described in International Patent Application Publication WO2014065661, published on May 1, 2014, entitled, “Modified antibody, antibody-conjugate and process for the preparation thereof’.(b) Anti-KLK7 antibodies[000252] In some embodiments, an antibody targeting KLK7 (referred to as an anti- KLK7 antibody) is an antibody specific for Kallikrein-5 (KLK7). Provided herein, in some aspects, are antibodies that bind to KLK7 (e.g., human KLK7, or mouse KLK7) with high specificity and affinity. In some embodiments, an antibody described herein specifically binds to an epitope of KLK7 that is exposed or becomes exposed to an antibody. In some embodiments, anti-KLK7 antibodies provided herein bind specifically to KLK7 from human,7107489non-human primates, mouse, rat, etc. In some embodiments, anti-KLK7 antibodies provided herein specifically bind to human KLK7. In some embodiments, anti-KLK7 antibodies provided herein specifically bind to mouse KLK7.[000253] Kallikrein-7 is a serine protease that in humans is encoded by the KLK7 gene. KLK7 is characterized as stratum corneum chymotryptic enzyme (SCCE). [It is the seventh member of the human kallikrein family, which includes fifteen homologous serine proteases located on chromosome 19.[000254] KLK7 is secreted as an inactive zymogen (e.g., in the stratum granulosum layer of the epidermis), requiring proteolytic cleavage to be activated. In some embodiments, KLK5 or matriptase activates KLK7. Once active, KLK7 is able to cleave proteins which form the stratum corneum and / or stratum granulosum (e.g., Comeodesmosin (CDSN), desmoglein 1 (DSG1), and desmocollin 1 (DSC1), etc.) (see, e.g., Caubet et al. (May 2004). Degradation of corneodesmosome proteins by two serine proteases of the kallikrein family, SCTE / KLK5 / hK5 and SCCE / KLK7 / hK7. The Journal of Investigative Dermatology. 122 (5): 1235-1244). These proteins constitute the extracellular component of comeodesmosomes, intercellular cohesive structures which link the intermediate filaments of adjacent cells in the stratum corneum. In some embodiments, proteolysis of comeodesmosomes leads to desquamation of the epidermis (i.e., the shedding of comeocytes from the outer layer of the epidermis).[000255] In some embodiments, the combined role of KLK5 and KLK7 suggests that KLK skin cascade is responsible for coordinating desquamation. KLK7 is a chymotrypsin- like serine protease, which cleave proteins at the residues tyrosine, phenylalanine or leucine. In some embodiments, dysregulation of KLK7 has been linked to several skin disorders including atopic dermatitis, psoriasis and Netherton syndrome. These diseases are characterized by excessively dry, scaly, and inflamed skin, due to a disruption of skin homeostasis and correct barrier function. In some embodiments, KLK7 is also associated with peripheral sensory neuron activity, e.g., in the skin. KLK7 activity has been found to mediate activation and sensitization of certain peripheral sensory neurons, including itchsensing c-fiber dorsal root ganglion neurons (e.g., see: Guo, Changxiong J., et al. "Kallikrein 7 promotes atopic dermatitis-associated itch independently of skin inflammation." Journal of Investigative Dermatology 140.6 (2020): 1244-1252). In some embodiments, KLK7 activity in peripheral sensory neurons is associated with itch. In some embodiments, KLK7 mediates itch-sensing by sensory neuron by cleaving pro-IL-33 to its active form IL-33, which is a known driver of inch-sensing by sensory neurons (see, e.g., Trier et al., IL-33 Signaling in7107489Sensory Neurons Promotes Dry Skin Itch, J Allergy Clin Immunol. 2021 Sep21; 149(4): 1473-1480.e6.).[000256] In some embodiments, an anti-KLK7 antibody reduces activity of peripheral sensory neurons, e.g., in the skin. In some embodiments, an anti-KLK7 antibody reduces activity of itch-sensing c-fiber dorsal root ganglion neurons, e.g., in the skin. In some embodiments, an anti-KLK7 antibody reduces itch, e.g. itch associated with KLK7- expressing peripheral sensory neurons.[000257] In some embodiments, an anti-KLK7 antibody described herein specifically binds to an epitope on human KLK7. Exemplary amino acid sequences of human KLK7 are set forth in NCBI Accession Numbers NP_001193982.1, NP_001230055.1, NP_005037.1, NP_644806.1, and UniProt Accession Numbers: M0QYU8, Q6DTY1, X2J289, X2J4X7, A0A024R4H6, P49862, A0A2H4GDB2, and A0A2H4GDB6, the entire sequences of which are incorporated herein by reference.[000258] In some embodiments, an anti-KLK7 antibody described herein specifically binds to an epitope on mouse KLK7. Exemplary amino acid sequences of mouse KLK7 are set forth in NCBI Accession Numbers NP_036002.1, and UniProt Accession Numbers Q91VE3, the entire sequences of which are incorporated herein by reference.[000259] In some embodiments, an anti-KLK7 antibody described herein specifically binds to an epitope on KLK7 (e.g., the catalytic domain / pocket of human KLK7 or mouse KLK7). In some embodiments, an anti-KLK7 antibody described herein prevents KLK7 (e.g., human or mouse KLK7) from cleaving its substrates. In some embodiments, an anti-KLK7 antibody described herein bind to a fragment of a KLK7 (e.g., human or mouse KLK7). The fragment of KLK7 (e.g., human or mouse) may be between about 5 and about 425 amino acids, between about 10 and about 400 amino acids, between about 50 and about 350 amino acids, between about 100 and about 300 amino acids, between about 150 and about 250 amino acids, between about 200 and about 300 amino acids, between about 75 and about 150 amino acids, between about 25 and about 100 amino acids, between about 10 and about 30 amino acids in length. Not wishing to be bound to any particular theory, and in some embodiments, a heavy chain (HC) complementarity-determining region 3 (CDR3) of any one of the anti-KLK7 antibodies described herein inhibits KLK7 (e.g., human or mouse KLK7) by binding to the catalytic domain / pocket of KLK7.[000260] In some embodiments, an anti-KLK7 antibody described herein inhibits KLK7 protease activity. In some embodiments the anti-KLK7 antibody inhibits KLK7 cleavage of KHLF-AMC with an IC50 of less than 6 nM, less than 5 nM, less than 4 nM, less than 3 nM,7107489less than 2.5 nM, less than 2 nM, or less than 1.5 nM, less than 1 nM, less than 0.5 nM, less than 0.4nM, less than 0.3nM, less than 0.2nM, less than 0.16 nM, less than 0.1 nM or less than 0.05 nM.[000261] In some embodiments, an anti-KLK7 antibody described herein binds specifically to the active form of KLK7. In some embodiments, the anti-KLK7 antibody described herein does not bind to the inactive form of KLK7. In some embodiments, an anti- KLK7 antibody described herein binds specifically to the active site of KLK7. The active site of KLK7 is the site at which the KLK7 substrate molecules bind to undergo cleavage. The active site may also be known as the catalytic domain, or catalytic triad. In some embodiments, the active site (i.e., catalytic domain or catalytic triad) of KLK7 consists of amino acids Serl95, His57, and Aspl02 of KLK7 (see, e.g., Goettig et al., Natural and synthetic inhibitors of kallikrein-related peptidases (KLKs), Biochimie. 2010 Nov; 92(11): 1546-1567).[000262] In some embodiments, antibodies described herein are optimized versions (e.g., affinity matured) of the parental antibody. In some embodiments, an antibody described herein specifically binds a KLK7 (e.g., a human or mouse KLK7) with binding affinity (e.g., as indicated by KD) of at least about 10'4M, 10'5M, 10'6M, 10'7M, 10'8M, 10'9M, 10'10M, 10'11M, 10'12M, IO’13M, or less. In some embodiments, an antibody described herein specifically binds a KLK7 (e.g., a human or mouse KLK7) with binding affinity (e.g., as indicated by KD) of between IxlO'10M and 5xl0'9M, between IxlO'10M and IxlO'9M, between 5xl0'10and IxlO'9M, between 5xl0'nand IxlO'10M, between IxlO'11and 5xl0'10M, or between 5xl0'13and IxlO'12M. For example, an antibody of the present disclosure can bind to a KLK7 protein (e.g., human or mouse KLK7) with an affinity between 1 pM and 500 nM, e.g., between 50 pM and 100 nM, between 500 pM and 50 nM, between 1 pM and 100 pM, between 10 pM and 100 pM, between 50 pM and 100 pM, between 100 pM and 500 pM, between 500 pM and 1 nM, between 1 nM and 5 nM, between 1 nM and 10 nM, between 5 nM and 25 nM, between 10 nM and 50 nM between 50 nM and 100 nM, between 100 nM and 500 nM. The disclosure also includes antibodies that compete with any of the antibodies described herein for binding to a KLK7 protein (e.g., human or mouse KLK7) and that have an affinity of 100 nM or lower (e.g., 80 nM or lower, 50 nM or lower, 20 nM or lower, 10 nM or lower, 1 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower). The affinity and binding kinetics of an antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). In some embodiments, antibodies described herein binds to KLK7 with a KD of sub-nanomolar range.7107489[000263] Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance (SPR), florescent activated cell sorting (FACS) or spectroscopy (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS- P buffer (10 mM HEPES pH7.4, 150 mM NaCl, 0.005% (v / v) surfactant P20) and PBS buffer (lOmM PO4-3, 137mM NaCl, and 2.7mM KC1). These techniques can be used to measure the concentration of bound proteins as a function of target protein concentration. The concentration of bound protein ([[Bound]]) is generally related to the concentration of free target protein ([[Free]]) by the following equation:[000264] [[Bound]] = [[Free]] / (Kd+[[Free]])[000265] It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay.[000266] Exemplary anti-KLK7 antibody sequences (e.g., the heavy chain (HC) and light chain (LC) sequences, heavy chain variable domain (VH) and light chain variable domain (VL), CDR sequences are provided in Table 2a.Table 2a. Examples of anti-KLK7 antibodies7107489710748971074897107489710748971074897107489710748971074897107489[000267] In some embodiments, certain amino acid positions in an antibody described herein (e.g., amino acids in the VH / VL regions and / or CDR regions) are substitutable and the substitution results in an antibody with substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, protease activity inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody. In order to identify a substitutable position of an antibody, the amino acid sequence of that antibody is compared to the sequences of other antibodies belonging to the same group as that antibody. If the identity of that amino acid varies between the different related antibodies of a group at any particular position, that position is a substitutable position of the antibody. In other words, a substitutable position is a position in which the identity of the amino acid varies between the related antibodies. Positions that contain a constant amino acid are not substitutable positions.[000268] In some embodiments, the above method may be employed to provide a consensus antibody sequence. In such a consensus sequence, a non-substitutable position is indicated by the amino acid present at that position, and a substitutable position is indicated as an "X".[000269] Depending on how the antibodies are to be employed, X may be a) any amino acid, b) any amino acid present at that position in any of the related antibodies in the group or a conservatively substituted variant thereof or c) any amino acid present at that position in any of the related antibodies in the group. Any antibody having a sequence that is encompassed by the consensus should bind to the same antigen as any of the related antibodies.[000270] In some embodiments, the method described above may be employed in methods of designing and making a variant of a parental antibody that at least maintains (i.e. maintains or increases) the antigen binding activity of the parental antibody. Because antibodies containing substitutions at substitutable positions have already been produced and tested, substitutions at those positions can be made in the knowledge that they should not significantly decrease the binding activity of the antibody. In general, an antibody variant of a parental antibody has an antigen binding affinity that is at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 100% (e.g., at least 150%, at least 200%, at least 500%, at least 1000%, usually up to at least 10,000%) of the binding affinity of the parental antibody to a particular antigen.7107489[000271] In some embodiments, a substitutable position of a parental antibody may be substituted by a) any of the 20 naturally occurring amino acids to produce random substitutions, b) an amino acid having biochemical properties similar to the amino acid already present at the substitutable position to produce conservative substitutions, c) an amino acid that is present at the same position in a related antibody to produce a directed substitution, or d) an amino acid that is present at the same position in a similar human antibody to produce a humanizing substitution. A substitution may be made at any part of an antibody variable region, including any framework region or CDR. In certain embodiments, a single substitutable amino acid may be substituted. However, in other embodiments, a plurality of substitutable amino acids (e.g., up to about 5 or 10 or more) may be substituted. In particular embodiments, the type of substitution that can be made at each substitutable position may be indicated by the types of amino acids present at that position in the related antibodies. For example, if unrelated amino acids (e.g., Ala, Gly, Cys, Glu and Thr) are present at a certain position of a group of related antibodies, then any amino acid could be substituted at that position without significantly reducing binding activity of the antibody. Exemplary amino acids substations of an anti-KLK7 antibody described herein are set forth in Table lb:Table 2b. Exemplary Amino Acids Substitutions in anti-KLK7 antibodies71074897107489[000272] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 comprising the amino acid sequence of X1TFX2X3X4X5IX6 (SEQ ID NO: 264), in which Xi is G or Y, X2 is S, G, or T, X3 is N, P or S, X4 is Y or E, X5 is A or G, or Xi> is S or H; a HC CDR2 comprising the amino acid sequence of X7ISAX8SGDTNYAQX9LQG (SEQ ID NO: 265), in which X7 is W or S, Xs is Y or S, or X9 is K or E; a HC CDR3 comprising the ARX10AGYGARX11WYFDL (SEQ ID NO: 266), in which X10 is A, G, or S, or Xu is H, W, S, or D; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 69; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 comprising the amino acid sequence of DX12X13YSTPPIT (SEQ ID NO: 267), in which X12 is Q or G, or X13 is S, F, W, or R.[000273] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 comprising the amino acid sequence of GSISSGGYX1WX2 (SEQ ID NO: 268), Xi is Y or S, or X2 is S, H or N; a HC CDR2 comprising the amino acid sequence of X3IYX4SGX5TYYNPSLKS (SEQ ID NO: 269), in which X3is S or Y, X4is Y or R, or X5is S or Y; a HC CDR3 comprising the amino acid sequence of ARAKX6LTX7X8RYX9DY (SEQ ID NO: 270), in which Xi> is Q or A, X7 is T or L, Xs is H, T or S, or X9 is F or V; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 93; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 94; and / or a LC CDR3 comprising the amino acid sequence of QQAX9X10LPFT (SEQ ID NO: 271), in which X9 is S or R, or X10 is D or Q. [000274] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 comprising the amino acid sequence of GTFX 1X2X3 AIX4 (SEQ ID NO: 272), in which7107489Xi is S or N, X2 is N or S, X3 is Y or H, or X4 is S or T; a HC CDR2 comprising the amino acid sequence of XsIIPIFGXeANYAQKFQG (SEQ ID NO: 273), in which X5 is G or A, or Xe is T, V or F; a HC CDR3 comprising the amino acid sequence of ARGAPNYYGX7X8SSRGIAFDI (SEQ ID NO: 274), in which X7is S or A, or X8is S, Q or A; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 4; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and / or a LC CDR3 comprising the amino acid sequence of VQANAFPYX9 (SEQ ID NO: 275), in which X9 is T, K or S. [000275] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 comprising the amino acid sequence of GSISSSX1YX2WX3 (SEQ ID NO: 276), in which Xi is S or P, X2 is Y or N, or X3 is G or V; a HC CDR2 comprising the amino acid sequence of SIX4X5SGSTYYNPSLKS (SEQ ID NO: 277), in which X4is S or L, or X5is Y or H; a HC CDR3 comprising the amino acid sequence of ARGX6PTYX7GAASHYYYYMDV (SEQ ID NO: 278), in which X6is A or V, X7is F or W; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 130; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 131; and / or a LC CDR3 comprising the amino acid sequence of EQYGSX8SPLT (SEQ ID NO: 279), in which X8is Y or E.[000276] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 comprising the amino acid sequence of YTFX1GYX2MH (SEQ ID NO: 280), in which Xi is T or A, or X2 is Y or D; a HC CDR2 comprising the amino acid sequence of SINPX3SGX4TNYAQKFQG (SEQ ID NO: 281), in which X3is S or T, or X4is G or R; a HC CDR3 comprising the amino acid sequence of ARGGPSTWYGGSAYXsYYGXeDV (SEQ ID NO: 282), in which X5 is Y or T, or Xe is M or A; a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 143; a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 23; and / or a LC CDR3 comprising the amino acid sequence of QQYAX7LWT (SEQ ID NO: 283), in which X7is N or P.[000277] In some embodiments, an antibody of the present disclosure comprises one or more of the HC CDRs (e.g., HC CDR1, HC CDR2, or HC CDR3) amino acid sequences from any one of the anti-KLK7 antibodies selected from Tables 2a and 2b. In some embodiments, an antibody of the present disclosure comprises the HC CDR3 amino acid sequences from any one of the anti-KLK7 antibodies selected from Tables 2a and 2b. In some embodiments, an antibody of the present disclosure comprise the HC CDR1, HC CDR2, and HC CDR3 as provided for any one of the antibodies elected from Tables 2a and 2b. In some embodiments, an antibody of the present disclosure comprises the LC CDR3 amino acid sequences from any one of the anti-KLK7 antibodies selected from Tables 2a and71074892b. In some embodiments, an antibody of the present disclosure comprises one or more of the LC CDRs (e.g., LC CDR1, LC CDR2, or LC CDR3) amino acid sequences from any one of the anti-KLK7 antibodies selected from Tables 2a and 2b. In some embodiments, an antibody of the present disclosure comprise the LC CDR1, LC CDR2, and LC CDR3 s provided for any one of the anti-KLK7 antibodies selected from Tables 2a and 2b.[000278] In some embodiments, an antibody of the present disclosure comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 as provided for any one of the anti-KLK7 antibodies selected from Tables 2a and 2b. In some embodiments, antibody heavy and / or light chain CDR3 domains may play a particularly important role in the binding specificity / affinity of an antibody for an antigen. Accordingly, an antibody of the disclosure may include at least the heavy and / or light chain CDR3s of any one of the anti-KLK7 antibodies selected from Tables 2a and 2b.[000279] Also within the scope of the present disclosure are variants of any of the exemplary anti-KLK7 antibodies as disclosed herein. A variant may contain one or more amino acid residue variations in the VH and / or VL, or in one or more of the HC CDRs and / or one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, protease activity inhibitory activity, anti-inflammatory activity, or a combination thereof) as the reference antibody.[000280] In some embodiments, an antibody of the disclosure have one or more CDRs (e.g., HC CDR or LC CDR) sequences substantially similar to any of the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 sequences from one of the anti- KLK7 antibodies selected from Tables 2a and 2b. In some embodiments, the position of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary by one, two, three, four, five, or six amino acid positions so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). For example, in some embodiments, the position defining a CDR of any antibody described herein can vary by shifting the N-terminal and / or C-terminal boundary of the CDR by one, two, three, four, five, or six amino acids, relative to the CDR position of any one of the antibodies described herein, so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of7107489-IOS- the binding of the original antibody from which it is derived). In another embodiment, the length of one or more CDRs along the VH (e.g., HC CDR1, HC CDR2, or HC CDR3) and / or VL (e.g., LC CDR1, LC CDR2, or LC CDR3) region of an antibody described herein can vary (e.g., be shorter or longer) by one, two, three, four, five, or more amino acids, so long as immuno specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% of the binding of the original antibody from which it is derived). [000281] Accordingly, in some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids shorter than one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein may be one, two, three, four, five or more amino acids longer than one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be extended by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it7107489is derived). In some embodiments, the amino portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, the carboxy portion of a HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and / or LC CDR3 described herein can be shortened by one, two, three, four, five or more amino acids compared to one or more of the CDRs described herein (e.g., CDRS from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). Any method can be used to ascertain whether immuno specific binding to KLK7 (e.g., human or mouse KLK7) is maintained, for example, using binding assays and conditions described in the art.[000282] In some examples, an antibody of the disclosure have one or more CDR (e.g., HC CDR or LC CDR) sequences substantially similar to any one of the anti-KLK7 antibodies selected from Tables 2a and 2b. For example, an antibody described herein may include one or more CDR sequence(s) from any of the anti-KLK7 antibodies selected from Tables 2a and 2b containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the CDRs provided herein (e.g., CDRs from any of the anti-KLK7 antibodies selected from Tables 2a and 2b) so long as specific binding to KLK7 (e.g., human or mouse KLK7) is maintained (e.g., substantially maintained, for example, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% relative to the binding of the original antibody from which it is derived). In some embodiments, any of the amino acid variations in any of the CDRs provided herein may be conservative variations. Conservative variations can be introduced into the CDRs at positions where the residues are not likely to be involved in interacting with a KLK7 (e.g., human or mouse KLK7), for example, as determined based on a crystal structure. Some aspects of the disclosure provide antibodies that comprise one or more of the heavy chain variable (VH) and / or light chain variable (VL) domains provided herein. In some embodiments, any of the VH domains provided herein include one or more of the HC CDR sequences (e.g., HC CDR1, HC CDR2, and HC CDR3) provided herein, for example, any of7107489the HC CDR sequences provided in any one of the anti-KLK7 selected from Tables 2a and 2b. In some embodiments, any of the VL domains provided herein include one or more of the LC CDR sequences (e.g., LC CDR1, LC CDR2, and LC CDR3) provided herein, for example, any of the LC CDR sequences provided in any one of the anti-KLK7 antibodies selected from Tables 2a and 2b.[000283] In some embodiments, an antibody of the disclosure include any antibody that includes a heavy chain variable domain and / or a light chain variable domain of any one of the anti-KLK7 antibodies selected from Tables 2a and 2b, and variants thereof. In some embodiments, an antibody of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of any anti-KLK7 antibodies selected from Tables 2a and 2b.[000284] Aspects of the disclosure provide antibodies having a heavy chain variable (VH) and / or a light chain variable (VL) domain amino acid sequence homologous to any of those described herein. In some embodiments, an antibody comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the heavy chain variable sequence and / or any light chain variable sequence of any one of the anti-KLK7 antibodies selected from Tables 2a and 2b. In some embodiments, the homologous heavy chain variable and / or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein. For example, in some embodiments, the degree of sequence variation (e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%) may occur within a heavy chain variable and / or a light chain variable sequence excluding any of the CDR sequences provided herein. In some embodiments, an antibody provided herein comprise a heavy chain variable sequence and a light chain variable sequence that comprises a framework sequence that is at least 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the framework sequence of any anti-KLK7 antibodies selected from Tables 2a and 2b.[000285] In some embodiments, an antibody of the present disclosure is a humanized antibody (e.g., a humanized variant containing one or more CDRs of Tables 2a and 2b). In some embodiments, an antibody of the present disclosure comprises a HC CDR1, a HC CDR2, a HC CDR3, a LC CDR1, a LC CDR2, and a LC CDR3 that are the same as the HC CDR1, HC CDR2, HC CDR3, LC CDR1, LC CDR2, and LC CDR3 shown in Tables 2a and 2b, and comprises a humanized heavy chain variable region and / or a humanized light chain variable region.-IOS-[000286] In some embodiments, an antibody of the present disclosure is a humanized antibody comprising a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH of any of the anti-KLK7 antibodies listed in Tables 2a and 2b. Alternatively or in addition, the antibody of the present disclosure is a humanized antibody comprising a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL of any one of the anti-KLK7 antibodies listed in Tables 2a and 2b.[000287] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 72. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 73.[000288] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 66, a HC CDR2 having the amino acid sequence of SEQ ID NO: 67, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 71.[000289] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 66, HC CDR2 having the amino acid sequence of SEQ ID NO: 67, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 71.[000290] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to theHC CDR1 having the amino acid sequence of SEQ ID NO: 66, HC CDR2 having the amino acid sequence of SEQ ID NO: 67, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 71.[000291] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 66; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 67; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 71.[000292] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 72. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 73.[000293] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 72. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid7107489-HO- variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 73.[000294] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 72. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 73.[000295] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 199. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 200.[000296] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 74, a HC CDR2 having the amino acid sequence of SEQ ID NO: 67, a HC CDR3 having the amino acid sequence of SEQ ID NO: 75, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 198.[000297] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 74, HC CDR2 having the amino acid sequence of SEQ ID NO: 67, and HC CDR3 having the amino acid sequence of SEQ ID NO: 75. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 198.[000298] In some embodiments, an anti-KLK7 antibody of the present disclosure7107489comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 74, HC CDR2 having the amino acid sequence of SEQ ID NO: 67, and HC CDR3 having the amino acid sequence of SEQ ID NO: 75. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 198.[000299] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 74; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 67; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 75. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 198.[000300] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 199. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 200.[000301] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19,710748918, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 199. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 200.[000302] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 199. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 200.[000303] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 77. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78.[000304] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 201, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000305] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 201, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of7107489SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000306] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 201, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000307] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 201; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000308] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 77. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the7107489amino acid sequence of SEQ ID NO: 78.[000309] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 77. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 78.[000310] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 77. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 78.[000311] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78.[000312] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000313] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of7107489the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000314] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000315] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 79; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 76.7107489[000316] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 78.[000317] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 78.[000318] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 78.[000319] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 82.[000320] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000321] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as7107489compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000322] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000323] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 79; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 68. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a7107489LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000324] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 82.[000325] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 82.[000326] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 80. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 82.[000327] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 84. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78.[000328] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 83, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 76.7107489[000329] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000330] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000331] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 79; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 83. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with7107489the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 76.[000332] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 84. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 78.[000333] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 84. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 78.[000334] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 84. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 78.[000335] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 87. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 88.[000336] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID7107489NO: 85, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000337] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 85. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000338] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 85. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000339] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 79; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR37107489having the amino acid sequence of SEQ ID NO: 85. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 86.[000340] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 87. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 88.[000341] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 87. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 88.[000342] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 87. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 88.[000343] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 285. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 82.7107489[000344] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 89, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000345] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 89. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000346] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 284, HC CDR2 having the amino acid sequence of SEQ ID NO: 79, and HC CDR3 having the amino acid sequence of SEQ ID NO: 89. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 69, LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000347] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 284; a HC CDR2 having no more than 3 amino acid variations (e.g., no more7107489than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 79; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 89. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 69; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 70; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 81.[000348] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 285. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 82.[000349] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 285. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 82.[000350] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 285. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL as set forth in SEQ ID NO: 82.[000351] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having7107489the amino acid sequence of SEQ ID NO: 98. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97.[000352] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 90, a HC CDR2 having the amino acid sequence of SEQ ID NO: 91, a HC CDR3 having the amino acid sequence of SEQ ID NO: 92, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 95.[000353] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 90, HC CDR2 having the amino acid sequence of SEQ ID NO: 91, and HC CDR3 having the amino acid sequence of SEQ ID NO: 92. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 93, LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and LC CDR3 having the amino acid sequence of SEQ ID NO: 95.[000354] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC CDR1 having the amino acid sequence of SEQ ID NO: 90, HC CDR2 having the amino acid sequence of SEQ ID NO: 91, and HC CDR3 having the amino acid sequence of SEQ ID NO: 92. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, a LC CDR2, and a LC CDR3 that collectively are at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the to the LC CDR1 having the amino acid sequence of SEQ ID NO: 93, LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and LC CDR3 having the amino acid sequence of SEQ ID NO: 95.[000355] In some embodiments, an anti-KLK7 antibody of the present disclosure7107489comprises: a HC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 90; a HC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR2 having the amino acid sequence of SEQ ID NO: 91; and / or a HC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the HC CDR3 having the amino acid sequence of SEQ ID NO: 92. Alternatively or in addition, the anti- KLK7 antibody of the present disclosure comprises: a LC CDR1 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR1 having the amino acid sequence of SEQ ID NO: 93; a LC CDR2 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR2 having the amino acid sequence of SEQ ID NO: 94; and / or a LC CDR3 having no more than 3 amino acid variations (e.g., no more than 3, 2, or 1 amino acid variation) as compared with the LC CDR3 having the amino acid sequence of SEQ ID NO: 95.[000356] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising the amino acid sequence of SEQ ID NO: 98. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising the amino acid sequence of SEQ ID NO: 97.[000357] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VH as set forth in SEQ ID NO: 98. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL containing no more than 20 amino acid variations (e.g., no more than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the VL as set forth in SEQ ID NO: 97.[000358] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH as set forth in SEQ ID NO: 98. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL7107489as set forth in SEQ ID NO: 97.[000359] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 153. Alternatively or in addition, the anti-KLK7 antibody of the present disclosure comprises a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97.[000360] In some embodiments, an antibody of the present disclosure comprises a HC CDR1 having the amino acid sequence of SEQ ID NO: 96, a HC CDR2 having the amino acid sequence of SEQ ID NO: 109, a HC CDR3 having the amino acid sequence of SEQ ID NO: 92, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 95.[000361] In some embodiments, an anti-KLK7 antibody of the present disclosure comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 5 amino acid variations (e.g., no more than 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1 having the amino acid sequence of SEQ ID NO: 96, HC CDR2 having the amino acid sequence of SEQ ID NO: 109, and HC CDR3 having the amino acid sequence of SEQ ID NO: 92. Alternatively or in add...

Claims

1. CLAIMSWhat is claimed is:

1. An antibody that specifically binds to KLK5, the antibody comprising:(a) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 3, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(b) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 10, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.;(c) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 14, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(d) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 16, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(e) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 18, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(f) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 24, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29;(g) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 28, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29;(h) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 32, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 37;(i) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 36, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29;(j) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 42, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;7107489(k) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 46, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(l) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 49, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(m) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 51, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(n) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 53, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(o) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 58, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 59; or(p) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 64, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 65; and a heavy chain constant region that comprises L234A, L235A, and P329A substitutions according to EU numbering.

2. An antibody that specifically binds to KLK5, the antibody comprising:(a) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 3, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(b) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 10, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11.;(c) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 14, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(d) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 16, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;7107489(e) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 18, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 11;(f) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 24, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29;(g) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 28, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29;(h) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 32, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 37;(i) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 36, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 29;(j) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 42, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(k) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 46, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(l) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 49, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(m) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 51, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(n) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 53, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 43;(o) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 58, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 59; or7107489(р) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 64, and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 65; and a heavy chain constant region that comprises M428L and N434A substitutions according to EU numbering.

3. The antibody of claim 1 or claim 2, wherein the heavy chain constant region comprises L234A, L235A, P329A, M428L and N434A substitutions according to EU numbering.

4. The antibody of any one of claims 1-3, wherein the heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 521.

5. The antibody of any one of claims 1-4, wherein the antibody further comprises a light chain constant region.

6. The dual inhibitor antibody of claim 5, wherein the light chain constant region comprises the amino acid sequence of SEQ ID NO: 520.

7. The antibody of any one of claims 1-6, wherein the antibody comprises:(a) a HC CDR1 having the amino acid sequence of SEQ ID NO: 1, a HC CDR2 having the amino acid sequence of SEQ ID NO: 2, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6:(b) a HC CDR1 having the amino acid sequence of SEQ ID NO: 7, a HC CDR2 having the amino acid sequence of SEQ ID NO: 8, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6;(с) a HC CDR1 having the amino acid sequence of SEQ ID NO: 12, a HC CDR2 having the amino acid sequence of SEQ ID NO: 13, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a7107489LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6;(d) a HC CDR1 having the amino acid sequence of SEQ ID NO: 15, a HC CDR2 having the amino acid sequence of SEQ ID NO: 13, a HC CDR3 having the amino acid sequence of SEQ ID NO: 9, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6;(e) a HC CDR1 having the amino acid sequence of SEQ ID NO: 12, a HC CDR2 having the amino acid sequence of SEQ ID NO: 13, a HC CDR3 having the amino acid sequence of SEQ ID NO: 17, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 6;(f) a HC CDR1 having the amino acid sequence of SEQ ID NO: 19, a HC CDR2 having the amino acid sequence of SEQ ID NO: 20, a HC CDR3 having the amino acid sequence of SEQ ID NO: 21, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 34;(g) a HC CDR1 having the amino acid sequence of SEQ ID NO: 25, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 27, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 34;(h) a HC CDR1 having the amino acid sequence of SEQ ID NO: 30, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 31, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 35;(i) a HC CDR1 having the amino acid sequence of SEQ ID NO: 30, a HC CDR2 having the amino acid sequence of SEQ ID NO: 26, a HC CDR3 having the amino acid sequence of SEQ ID NO: 33, a LC CDR1 having the amino acid sequence of SEQ ID NO: 22, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 34;(j) a HC CDR1 having the amino acid sequence of SEQ ID NO: 38, a HC CDR2 having the amino acid sequence of SEQ ID NO: 39, a HC CDR3 having the amino acid7107489sequence of SEQ ID NO: 40, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41;(k) a HC CDR1 having the amino acid sequence of SEQ ID NO: 44, a HC CDR2 having the amino acid sequence of SEQ ID NO: 45, a HC CDR3 having the amino acid sequence of SEQ ID NO: 40, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41;(l) a HC CDR1 having the amino acid sequence of SEQ ID NO: 47, a HC CDR2 having the amino acid sequence of SEQ ID NO: 48, a HC CDR3 having the amino acid sequence of SEQ ID NO: 40, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41;(m) a HC CDR1 having the amino acid sequence of SEQ ID NO: 47, a HC CDR2 having the amino acid sequence of SEQ ID NO: 48, a HC CDR3 having the amino acid sequence of SEQ ID NO: 50, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41;(n) a HC CDR1 having the amino acid sequence of SEQ ID NO: 44, a HC CDR2 having the amino acid sequence of SEQ ID NO: 45, a HC CDR3 having the amino acid sequence of SEQ ID NO: 52, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 41;(o) a HC CDR1 having the amino acid sequence of SEQ ID NO: 54, a HC CDR2 having the amino acid sequence of SEQ ID NO: 55, a HC CDR3 having the amino acid sequence of SEQ ID NO: 56, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 57; or(p) a HC CDR1 having the amino acid sequence of SEQ ID NO: 60, a HC CDR2 having the amino acid sequence of SEQ ID NO: 61, a HC CDR3 having the amino acid sequence of SEQ ID NO: 62, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 63.71074898. The antibody of any one of claims 1-7, wherein the antibody comprises:(a) a VH comprising the amino acid sequence of SEQ ID NO: 3 and a VL comprising the amino acid sequence of SEQ ID NO: 11;(b) a VH comprising the amino acid sequence of SEQ ID NO: 10, and a VL comprising the amino acid sequence of SEQ ID NO: 1 E;(c) a VH comprising the amino acid sequence of SEQ ID NO: 14, and a LC CDR1, LC CDR2 and a VL comprising the amino acid sequence of SEQ ID NO: 11;(d) a VH comprising the amino acid sequence of SEQ ID NO: 16, and a VL comprising the amino acid sequence of SEQ ID NO: 11;(e) a VH comprising the amino acid sequence of SEQ ID NO: 18, and a VL comprising the amino acid sequence of SEQ ID NO: 11;(f) a VH comprising the amino acid sequence of SEQ ID NO: 24, and a VL comprising the amino acid sequence of SEQ ID NO: 29;(g) a VH comprising the amino acid sequence of SEQ ID NO: 28, and a VL comprising the amino acid sequence of SEQ ID NO: 29;(h) a VH comprising the amino acid sequence of SEQ ID NO: 32, and a VL comprising the amino acid sequence of SEQ ID NO: 37;(i) a VH comprising the amino acid sequence of SEQ ID NO: 36, and a VL comprising the amino acid sequence of SEQ ID NO: 29;(j) a VH comprising the amino acid sequence of SEQ ID NO: 42, and a VL comprising the amino acid sequence of SEQ ID NO: 43;(k) a VH comprising the amino acid sequence of SEQ ID NO: 46, and a VL comprising the amino acid sequence of SEQ ID NO: 43;(l) a VH comprising the amino acid sequence of SEQ ID NO: 49, and a VL comprising the amino acid sequence of SEQ ID NO: 43;(m) a VH comprising the amino acid sequence of SEQ ID NO: 51, and a VL comprising the amino acid sequence of SEQ ID NO: 43;(n) a VH comprising the amino acid sequence of SEQ ID NO: 53, and a VH comprising the amino acid sequence of SEQ ID NO: 43;(o) a VH comprising the amino acid sequence of SEQ ID NO: 58, and a VH comprising the amino acid sequence of SEQ ID NO: 59; or(p) a VH comprising the amino acid sequence of SEQ ID NO: 64, and a VH comprising the amino acid sequence of SEQ ID NO: 65.71074899. The antibody of any one of claims 1-8, wherein the antibody comprises:(a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 154, and a light chain comprising the amino acid sequence of SEQ ID NO: 155;(b) a heavy chain comprising the amino acid sequence of SEQ ID NO: 156, and a light chain comprising the amino acid sequence of SEQ ID NO: 157;(c) a heavy chain comprising the amino acid sequence of SEQ ID NO: 158, and a light chain comprising the amino acid sequence of SEQ ID NO: 159;(d) a heavy chain comprising the amino acid sequence of SEQ ID NO: 160, and a light chain comprising the amino acid sequence of SEQ ID NO: 161;(e) a heavy chain comprising the amino acid sequence of SEQ ID NO: 162, and a light chain comprising the amino acid sequence of SEQ ID NO: 163;(f) a heavy chain comprising the amino acid sequence of SEQ ID NO: 164, and a light chain comprising the amino acid sequence of SEQ ID NO: 165;(g) a heavy chain comprising the amino acid sequence of SEQ ID NO: 166, and a light chain comprising the amino acid sequence of SEQ ID NO: 167;(h) a heavy chain comprising the amino acid sequence of SEQ ID NO: 168, and a light chain comprising the amino acid sequence of SEQ ID NO: 169;(i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 170, and a light chain comprising the amino acid sequence of SEQ ID NO: 171;(j) a heavy chain comprising the amino acid sequence of SEQ ID NO: 172, and a light chain comprising the amino acid sequence of SEQ ID NO: 173;(k) a heavy chain comprising the amino acid sequence of SEQ ID NO: 174, and a light chain comprising the amino acid sequence of SEQ ID NO: 175;(l) a heavy chain comprising the amino acid sequence of SEQ ID NO: 176, and a light chain comprising the amino acid sequence of SEQ ID NO: 177;(m) a heavy chain comprising the amino acid sequence of SEQ ID NO: 178, and a light chain comprising the amino acid sequence of SEQ ID NO: 179;(n) a heavy chain comprising the amino acid sequence of SEQ ID NO: 180, and a light chain comprising the amino acid sequence of SEQ ID NO: 181;(o) a heavy chain comprising the amino acid sequence of SEQ ID NO: 182 , and a light chain comprising the amino acid sequence of SEQ ID NO: 183; or(p) a heavy chain comprising the amino acid sequence of SEQ ID NO: 184, and a light chain comprising the amino acid sequence of SEQ ID NO: 185.710748910. An antibody that specifically binds to KLK7, the antibody comprising:(a) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 72 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 73;(b) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 199 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 200;(c) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 77 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78;(d) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 80 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78;(e) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 80 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 82;(f) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 84 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78;(g) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 87 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 88;(h) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 285 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 82;(i) comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 98 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97;(j) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 153 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97;7107489(k) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 103 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 104;(l) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 107 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 108;(m) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 111 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97;(n) comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 115 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 116;(o) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 121 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 122;(p) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 127 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 128;(q) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 133 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 134;(r) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 139 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 140;(s) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 145 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 146; or(t) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 151 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 152; and a heavy chain constant region that comprises L234A, L235A, and P329A substitutions according to EU numbering.710748911. An antibody that specifically binds to KLK7, the antibody comprising:(a) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 72 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 73;(b) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 199 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 200;(c) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 77 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78;(d) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 80 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78;(e) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 80 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 82;(f) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 84 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 78;(g) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 87 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 88;(h) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 285 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 82;(i) comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 98 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97;(j) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 153 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97;7107489(k) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 103 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 104;(l) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 107 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 108;(m) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 111 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 97;(n) comprises a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 115 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 116;(o) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 121 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 122;(p) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 127 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 128;(q) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 133 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 134;(r) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 139 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 140;(s) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 145 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 146; or(t) a HC CDR1, HC CDR2 and HC CDR3 of a heavy chain variable domain having the amino acid sequence of SEQ ID NO: 151 and a LC CDR1, LC CDR2 and LC CDR3 of a light chain variable domain having the amino acid sequence of SEQ ID NO: 152; and a heavy chain constant region that comprises M428L and N434A substitutions according to EU numbering.710748912. The antibody of claim 10 or claim 11, wherein the heavy chain constant region comprises L234A, L235A, P329A, M428L and N434A substitutions according to EU numbering.

13. The antibody of any one of claims 10-12, wherein the heavy chain constant region comprises the amino acid sequence of SEQ ID NO: 521.

14. The antibody of any one of claims 10-13, wherein the antibody further comprises a light chain constant region.

15. The antibody of claim 14, wherein the light chain constant region comprises the amino acid sequence of SEQ ID NO: 520.

16. The antibody of any one of claims 10-15, wherein the antibody comprises:(a) a HC CDR1 having the amino acid sequence of SEQ ID NO: 66, a HC CDR2 having the amino acid sequence of SEQ ID NO: 67, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 71;(b) a HC CDR1 having the amino acid sequence of SEQ ID NO: 74, a HC CDR2 having the amino acid sequence of SEQ ID NO: 67, a HC CDR3 having the amino acid sequence of SEQ ID NO: 75, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 198;(c) a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 201, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 76;(d) a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 76;7107489(e) a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 68, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 81;(f) a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 83, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 76;(g) a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 85, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 86;(h) a HC CDR1 having the amino acid sequence of SEQ ID NO: 284, a HC CDR2 having the amino acid sequence of SEQ ID NO: 79, a HC CDR3 having the amino acid sequence of SEQ ID NO: 89, a LC CDR1 having the amino acid sequence of SEQ ID NO: 69, a LC CDR2 having the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 81;(i) a HC CDR1 having the amino acid sequence of SEQ ID NO: 90, a HC CDR2 having the amino acid sequence of SEQ ID NO: 91, a HC CDR3 having the amino acid sequence of SEQ ID NO: 92, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 95;(j) a HC CDR1 having the amino acid sequence of SEQ ID NO: 96, a HC CDR2 having the amino acid sequence of SEQ ID NO: 109, a HC CDR3 having the amino acid sequence of SEQ ID NO: 92, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 95;(k) a HC CDR1 having the amino acid sequence of SEQ ID NO: 99, a HC CDR2 having the amino acid sequence of SEQ ID NO: 100, a HC CDR3 having the amino acid sequence of SEQ ID NO: 101, a LC CDR1 having the amino acid sequence of SEQ ID NO:710748993, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 102;(l) a HC CDR1 having the amino acid sequence of SEQ ID NO: 99, a HC CDR2 having the amino acid sequence of SEQ ID NO: 100, a HC CDR3 having the amino acid sequence of SEQ ID NO: 105, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 106;(m) a HC CDR1 having the amino acid sequence of SEQ ID NO: 96, a HC CDR2 having the amino acid sequence of SEQ ID NO: 109, a HC CDR3 having the amino acid sequence of SEQ ID NO: 110, a LC CDR1 having the amino acid sequence of SEQ ID NO: 93, a LC CDR2 having the amino acid sequence of SEQ ID NO: 94, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 95;(n) a HC CDR1 having the amino acid sequence of SEQ ID NO: 66, a HC CDR2 having the amino acid sequence of SEQ ID NO: 112, a HC CDR3 having the amino acid sequence of SEQ ID NO: 113, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 114;(o) a HC CDR1 having the amino acid sequence of SEQ ID NO: 117, a HC CDR2 having the amino acid sequence of SEQ ID NO: 118, a HC CDR3 having the amino acid sequence of SEQ ID NO: 119, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 120;(p) a HC CDR1 having the amino acid sequence of SEQ ID NO: 123, a HC CDR2 having the amino acid sequence of SEQ ID NO: 124, a HC CDR3 having the amino acid sequence of SEQ ID NO: 125, a LC CDR1 having the amino acid sequence of SEQ ID NO: 4, a LC CDR2 having the amino acid sequence of SEQ ID NO: 5, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 126;(q) a HC CDR1 having the amino acid sequence of SEQ ID NO: 19, a HC CDR2 having the amino acid sequence of SEQ ID NO: 20, a HC CDR3 having the amino acid sequence of SEQ ID NO: 129, a LC CDR1 having the amino acid sequence of SEQ ID NO: 130, a LC CDR2 having the amino acid sequence of SEQ ID NO: 131, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 132;(r) a HC CDR1 having the amino acid sequence of SEQ ID NO: 135, a HC CDR2 having the amino acid sequence of SEQ ID NO: 136, a HC CDR3 having the amino acid7107489sequence of SEQ ID NO: 137, a LC CDR1 having the amino acid sequence of SEQ ID NO: 130, a LC CDR2 having the amino acid sequence of SEQ ID NO: 131, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 138;(s) a HC CDR1 having the amino acid sequence of SEQ ID NO: 38, a HC CDR2 having the amino acid sequence of SEQ ID NO: 141, a HC CDR3 having the amino acid sequence of SEQ ID NO: 142, a LC CDR1 having the amino acid sequence of SEQ ID NO: 23, a LC CDR2 having the amino acid sequence of SEQ ID NO: 144, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 145; or(t) a HC CDR1 having the amino acid sequence of SEQ ID NO: 147, a HC CDR2 having the amino acid sequence of SEQ ID NO: 148, a HC CDR3 having the amino acid sequence of SEQ ID NO: 149, a LC CDR1 having the amino acid sequence of SEQ ID NO: 143, a LC CDR2 having the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 having the amino acid sequence of SEQ ID NO: 150.

17. The antibody of any one of claims 10-16, wherein the antibody comprises:(a) a VH comprising the amino acid sequence of SEQ ID NO: 72 and a VL comprising the amino acid sequence of SEQ ID NO: 73;(b) a VH comprising the amino acid sequence of SEQ ID NO: 199 and a VL comprising the amino acid sequence of SEQ ID NO: 200;(c) a VH comprising the amino acid sequence of SEQ ID NO: 77 and a VL comprising the amino acid sequence of SEQ ID NO: 78;(d) a VH comprising the amino acid sequence of SEQ ID NO: 80 and a VL comprising the amino acid sequence of SEQ ID NO: 78;(e) a VH comprising the amino acid sequence of SEQ ID NO: 80 and a VL comprising the amino acid sequence of SEQ ID NO: 82;(f) a VH comprising the amino acid sequence of SEQ ID NO: 84 and a VL comprising the amino acid sequence of SEQ ID NO: 78;(g) a VH comprising the amino acid sequence of SEQ ID NO: 87 and a VL comprising the amino acid sequence of SEQ ID NO: 88;(h) a VH comprising the amino acid sequence of SEQ ID NO: 285 and a VL comprising the amino acid sequence of SEQ ID NO: 82;(i) a VH comprising the amino acid sequence of SEQ ID NO: 98 and a VL comprising the amino acid sequence of SEQ ID NO: 97;7107489(j) a VH comprising the amino acid sequence of SEQ ID NO: 153 and a VL comprising the amino acid sequence of SEQ ID NO: 97;(k) a VH comprising the amino acid sequence of SEQ ID NO: 103 and a VL comprising the amino acid sequence of SEQ ID NO: 104;(l) a VH comprising the amino acid sequence of SEQ ID NO: 107 and a VL comprising the amino acid sequence of SEQ ID NO: 108;(m) a VH comprising the amino acid sequence of SEQ ID NO: 111 and a VL comprising the amino acid sequence of SEQ ID NO: 97;(n) a VH comprising the amino acid sequence of SEQ ID NO: 115 and a VL comprising the amino acid sequence of SEQ ID NO: 116;(o) a VH comprising the amino acid sequence of SEQ ID NO: 121 and a VL comprising the amino acid sequence of SEQ ID NO: 122;(p) a VH comprising the amino acid sequence of SEQ ID NO: 127 and a VL comprising the amino acid sequence of SEQ ID NO: 128;(q) a VH comprising the amino acid sequence of SEQ ID NO: 133 and a VL comprising the amino acid sequence of SEQ ID NO: 134;(r) a VH comprising the amino acid sequence of SEQ ID NO: 139 and a VL comprising the amino acid sequence of SEQ ID NO: 140;(s) a VH comprising the amino acid sequence of SEQ ID NO: 145 and a VL comprising the amino acid sequence of SEQ ID NO: 146; or(t) a VH comprising the amino acid sequence of SEQ ID NO: 151 and a VL comprising the amino acid sequence of SEQ ID NO: 152.

18. The antibody of any one of claims 10-17, wherein the antibody comprises:(a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 186, and a light chain comprising the amino acid sequence of SEQ ID NO: 187;(b) a heavy chain comprising the amino acid sequence of SEQ ID NO: 188, and a light chain comprising the amino acid sequence of SEQ ID NO: 189;(c) a heavy chain comprising the amino acid sequence of SEQ ID NO: 190, and a light chain comprising the amino acid sequence of SEQ ID NO: 191;(d) a heavy chain comprising the amino acid sequence of SEQ ID NO: 192, and a light chain comprising the amino acid sequence of SEQ ID NO: 193;(e) a heavy chain comprising the amino acid sequence of SEQ ID NO: 194, and a light chain comprising the amino acid sequence of SEQ ID NO: 195;7107489(f) a heavy chain comprising the amino acid sequence of SEQ ID NO: 196, and a light chain comprising the amino acid sequence of SEQ ID NO: 197;(g) a heavy chain comprising the amino acid sequence of SEQ ID NO: 296, and a light chain comprising the amino acid sequence of SEQ ID NO: 297;(h) a heavy chain comprising the amino acid sequence of SEQ ID NO: 298, and a light chain comprising the amino acid sequence of SEQ ID NO: 299;(i) a heavy chain comprising the amino acid sequence of SEQ ID NO: 300, and a light chain comprising the amino acid sequence of SEQ ID NO: 301;(j) a heavy chain comprising the amino acid sequence of SEQ ID NO: 302, and a light chain comprising the amino acid sequence of SEQ ID NO: 303;(k) a heavy chain comprising the amino acid sequence of SEQ ID NO: 304, and a light chain comprising the amino acid sequence of SEQ ID NO: 305;(l) a heavy chain comprising the amino acid sequence of SEQ ID NO: 306, and a light chain comprising the amino acid sequence of SEQ ID NO: 307;(m) a heavy chain comprising the amino acid sequence of SEQ ID NO: 308, and a light chain comprising the amino acid sequence of SEQ ID NO: 309;(n) a heavy chain comprising the amino acid sequence of SEQ ID NO: 310, and a light chain comprising the amino acid sequence of SEQ ID NO: 311;(o) a heavy chain comprising the amino acid sequence of SEQ ID NO: 312, and a light chain comprising the amino acid sequence of SEQ ID NO: 313;(p) a heavy chain comprising the amino acid sequence of SEQ ID NO: 314, and a light chain comprising the amino acid sequence of SEQ ID NO: 315;(q) a heavy chain comprising the amino acid sequence of SEQ ID NO: 316, and a light chain comprising the amino acid sequence of SEQ ID NO: 317;(r) a heavy chain comprising the amino acid sequence of SEQ ID NO: 319, and a light chain comprising the amino acid sequence of SEQ ID NO: 319;(s) a heavy chain comprising the amino acid sequence of SEQ ID NO: 320, and a light chain comprising the amino acid sequence of SEQ ID NO: 321; or(t) a heavy chain comprising the amino acid sequence of SEQ ID NO: 322, and a light chain comprising the amino acid sequence of SEQ ID NO: 323.

19. An anti-KLK5xKLK7 bispecific antibody, comprising:(i) a first arm comprising CDRs and / or VH and / or VL, the sequences of which are derived from or correspond to or are the same as the sequences of the CDRs and / or VH7107489and / or VL of an anti-KLK5 antibody listed in the left column of Table 4, and a heavy chain constant region and / or light chain constant region having a combination of substitutions selected from versions #1-8 of Table 8; and(ii) a second arm comprising CDRs and / or VH and / or VL, the sequences of which are derived from or correspond to or are the same as the sequences of the CDRs and / or VH and / or VL of an anti-KLK7 antibody listed in the right column of Table 4, and a heavy chain constant region and / or light chain constant region having a combination of substitutions selected from versions #1-8 of Table 8.

20. An anti-KLK5xKLK7 bispecific antibody, comprising:(i) a first arm comprising means for binding KLK5 and a heavy chain constant region and / or light chain constant region having a combination of substitutions selected from versions #1-8 of Table 8; and(ii) a second arm comprising means for binding KLK7 and a heavy chain constant region and / or light chain constant region having a combination of substitutions selected from versions #1-8 of Table 8.

21. An improved bispecific antibody, comprising: a first arm that specifically binds KLK5, and a second arm that specifically binds KLK7, wherein the improvement comprises:(i) on the first arm, a heavy chain constant region and / or light chain constant region having a combination of substitutions selected from versions #1-8 of Table 8; and(ii) on the second arm, a heavy chain constant region and / or light chain constant region having a combination of substitutions selected from versions #1-8 of Table 8.

22. An anti-KLK5xKLK7 bispecific antibody, comprising:(a) a first arm comprising:(i) a HC CDR1, a HC CDR2, and a HC CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of any one of SEQ ID NOs: 3, 10, 14, 16, 18, 24, 28, 32, 36, 42, 46, 49, 51, 53, 58, or 64; and(ii) a LC CDR1, a LC CDR2, and a LC CDR3 of a light chain variable region (VL) comprising the amino sequence of any one of SEQ ID NO: 11, 29, 37, 39, 43, 59, or 65; and(b) a second arm comprising:7107489(i) a HC CDR1, a HC CDR2, and a HC CDR3 of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 72, 199, 77, 80, 84, 87, 285, 98, 153, 103, 107, 111, 127, 133, 139, 145, or 151; and(ii) a LC CDR1, a LC CDR2, and a LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 73, 200, 78, 82, 88, 97, 104, 108, 116, 122, 128, 134, 140, 146, or 152; and wherein the first arm comprises a first heavy chain constant region comprising L234A, L235A, and P329A substitutions according to EU numbering, and / or the second arm comprises a second heavy chain constant region comprising L234A, L235A, and P329A substitutions according to EU numbering.

23. An anti-KLK5xKLK7 bispecific antibody, comprising:(a) a first arm comprising:(i) a HC CDR1, a HC CDR2, and a HC CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of any one of SEQ ID NOs: 3, 10, 14, 16, 18, 24, 28, 32, 36, 42, 46, 49, 51, 53, 58, or 64; and(ii) a LC CDR1, a LC CDR2, and a LC CDR3 of a light chain variable region (VL) comprising the amino sequence of any one of SEQ ID NO: 11, 29, 37, 39, 43, 59, or 65; and(b) a second arm comprising:(i) a HC CDR1, a HC CDR2, and a HC CDR3 of a VH comprising the amino acid sequence of any one of SEQ ID NOs: 72, 199, 77, 80, 84, 87, 285, 98, 153, 103, 107, 111, 127, 133, 139, 145, or 151; and(ii) a LC CDR1, a LC CDR2, and a LC CDR3 of a VL comprising the amino acid sequence of SEQ ID NO: 73, 200, 78, 82, 88, 97, 104, 108, 116, 122, 128, 134, 140, 146, or 152; and wherein the first arm comprises a first heavy chain constant region comprising M428L and N434A substitutions according to EU numbering, and / or the second arm comprises a second heavy chain constant region comprising M428L and N434A substitutions according to EU numbering.

24. The anti-KLK5xKLK7 bispecific antibody of claim 22 or 23, wherein the heavy chain constant region and / or the second heavy chain constant region comprises L234A, L235A, P329A, M428L and N434A substitutions according to EU numbering.710748925. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-24, wherein the first heavy chain constant region and / or the second heavy chain constant region further comprises knob / hole substitutions, and / or heavy chain-light chain heterodimerization substitutions.

26. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-25, wherein the first heavy constant region comprises the amino acid sequence of any one of SEQ ID NOs: 476-483.

27. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-26, wherein the second heavy constant region comprises the amino acid sequence of any one of SEQ ID NOs: 476-483.

28. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-27, wherein:(i) the first arm further comprises a first light chain constant region; and(ii) the second arm further comprises a second light chain constant region.

29. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-27, wherein the first light chain constant region comprises heavy chain-light chain heterodimerization substitutions.

30. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-29, wherein the second light chain constant region comprises heavy chain-light chain heterodimerization substitutions.

31. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-30, wherein the first light chain constant region comprises the amino acid sequence of any one of SEQ ID NO: 484-487.

32. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-31, wherein the second light chain constant region comprises the amino acid sequence of any one of SEQ ID NO: 484-487.710748933. The bispecific antibody of any one of claims 22-32, wherein the bispecific antibody comprises:(a) a first arm comprising a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 25, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 26, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 27, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 22, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 23, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 34; and(b) a second arm comprising a HC CDR1 comprising the amino acid sequence of SEQ ID NO: 284, a HC CDR2 comprising the amino acid sequence of SEQ ID NO: 79, a HC CDR3 comprising the amino acid sequence of SEQ ID NO: 89, a LC CDR1 comprising the amino acid sequence of SEQ ID NO: 69, a LC CDR2 comprising the amino acid sequence of SEQ ID NO: 70, and a LC CDR3 comprising the amino acid sequence of SEQ ID NO: 81.

34. The bispecific antibody of any one of claims 22-33, wherein the bispecific antibody comprises:(a) a first arm comprising a VH comprising the amino acid of SEQ ID NO: 28 and a VL comprising the amino acid sequence of SEQ ID NO: 29; and(b) a second arm comprising a VH comprising the amino acid sequence of SEQ ID NO: 285 and a VL comprising the amino acid sequence of SEQ ID NO: 82.

35. The anti-KLK5xKLK7 bispecific antibody of any one of claims 22-34, wherein the bispecific antibody comprises:(a) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 488, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 489; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 490, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 491;(b) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 492, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 493; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 494, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 495;(c) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 496, and a first light chain that comprises the amino acid sequence of SEQ7107489ID NO: 497; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 498, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 499;(d) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 500, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 501; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 502, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 503;(e) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 504, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 505; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 506, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 507;(f) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 508, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 509; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 510, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 511;(g) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 512, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 513; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 514, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 515; or(h) a first arm comprising a first heavy chain that comprises the amino acid sequence of SEQ ID NO: 516, and a first light chain that comprises the amino acid sequence of SEQ ID NO: 517; and a second arm comprising a second heavy chain that comprises the amino acid sequence of SEQ ID NO: 518, and a second light chain that comprises the amino acid sequence of SEQ ID NO: 519.

36. An isolated nucleic acid encoding the VH / VL or HC / LC of any one of the antibody of any one of claims 1-18.

37. An isolated nucleic acid encoding the VH / VL or HC / LC of the first arm, and / or the VH / VL or HC / LC of the second arm of the bispecific antibody of any one of claims 19-34.710748938. A host cell comprising the isolated nucleic acid of claim 36 or 37.

39. A composition comprising the antibody of any one of claims 1-18, the bispecific antibody of any one of claims 19-35, or the host cell of claim 38.

40. The composition of claim 39, further comprising an acceptable carrier.

41. A method of treating a skin barrier defect associated with KLK5 and KLK7 dysregulation, the method comprising: administering to a subject an effective amount of the antibody of any one of claims 1-18, the bispecific antibody of any one of claims 19-35, or the composition of claim 39 or 40.

42. The antibody of any one of claims 1-18, the bispecific antibody of any one of claims 19-35, or the composition of claim 39 or 40, for use in a method of treating a skin barrier defect associated with KLK5 and KLK7 dysregulation.

43. The method of claim 41, wherein the skin barrier defect associated with KLK5 and KLK7 dysregulation is Netherton syndrome, atopic dermatitis, eosinophilic esophagitis, prurigo nodularis, chronic pruritus of unknown origin (CPUO), dry skin, hidradenitis suppurativa, pemphigus vulgaris, lichen planus, KLK5 related asthma, ichthyosis vulgaris, or itch or chronic itch.

44. The antibody, bispecific antibody, or composition for use according to claim 42, wherein the skin barrier defect associated with KLK5 and KLK7 dysregulation is Netherton syndrome, atopic dermatitis, eosinophilic esophagitis, prurigo nodularis, chronic pruritus of unknown origin (CPUO), dry skin, hidradenitis suppurativa, pemphigus vulgaris, lichen planus, KLK5 related asthma, ichthyosis vulgaris, or itch or chronic itch.7107489

Images