Family a DNA polymerases and variants thereof
Family A DNA polymerase variants with targeted amino acid substitutions enhance strand displacement activity and salt tolerance, addressing limitations in existing Bst DNA polymerases for efficient isothermal amplification.
Patent Information
- Application Number
- PCT/CN2025/126384
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-10-08
- Filing Date
- 2025-10-08
- Publication Date
- 2026-04-16
AI Technical Summary
Existing family A DNA polymerases, such as Bst DNA polymerases, are not optimally suited for isothermal amplification techniques like LAMP due to variations in strand displacement activity, salt tolerance, and no-template control signals, limiting their effectiveness in molecular diagnostics.
Development of family A DNA polymerase variants with specific amino acid substitutions at key positions, enhancing strand displacement activity, salt tolerance, and reducing no-template control signals, thereby improving performance in isothermal amplification reactions.
The variants exhibit improved activity, tolerance to higher salt concentrations, and reduced no-template control signals, enabling faster and more accurate DNA amplification in techniques like LAMP, suitable for molecular diagnostics.
Smart Images

Figure PCTCN2025126384-FTAPPB-I100001 
Figure PCTCN2025126384-FTAPPB-I100002 
Figure PCTCN2025126384-FTAPPB-I100003
Abstract
Description
FAMILY A DNA POLYMERASES AND VARIANTS THEREOFSEQUENCE LISTING
[0001] The sequence listing that is contained in the file named “088177-8009WO01” , which is 39, 935 bytes (as measured in Microsoft Windows) and was created on September 29, 2024, is filed herewith by electronic submission and is incorporated by reference herein. CROSS-REFERENCE TO RELATED APPLICATIONS
[0002] This application claims priority to PCT application PCT / CN2024 / 123310, filed October 08, 2024, the disclosure of which is incorporated herein by reference.FIELD OF THE INVENTION
[0003] The present disclosure relates generally to the field of molecular biology. In particular, the disclosure relates to family A DNA polymerases and the variants thereof.BACKGROUND
[0004] Bst DNA polymerases are a group of family A DNA polymerases derived from the genus Geobacillus of the family of Bacillaceae. The first Bst DNA polymerase was identified from and named after the obsolete strain Bacillus Stearothermophilus which has been renamed Geobacillus Stearothermophilus based on better classification evidence. Bacteria from the genus Geobacillus evolved to live in a variety of harsh environments with raised temperatures such as hot springs and hydrothermal vents. The native Bst DNA polymerase has 876 amino acid residues with a N-terminus containing 5’-3’ exonuclease activity. Truncating this N-terminal region of 289 amino-acid long generates Bst DNA polymerase, Large Fragment (LF) , and removes the 5’-3’ exonuclease activity. This large fragment derivative has a strong strand-displacement activity that displaces the DNA strand that is in the way of new DNA polymerization. The large fragment DNA polymerases have been used in applications such as DNA sequencing, DNA amplifications, and many isothermal amplification techniques (SDA, HDA, LAMP, WGA, etc. ) developed toward molecular diagnostics.SUMMARY
[0005] The present disclosure provides candidate family A DNA polymerase having LAMP activity or strand displacement activity, family A DNA polymerase variants, methods for synthesizing DNA using such candidate DNA polymerase and variants thereof, and kits for use in such methods.
[0006] In one aspect, the present disclosure provides a family A DNA polymerase variant comprising at least one substitution of an amino acid residue at a position corresponding to position 554, 557, 558, 579, 620, 782, 785, 573, 593, 863, 512, 563, 792, 859, 423, 634 or 729 of a reference DNA polymerase. In some embodiments, the reference DNA polymerase comprises an amino acid sequence corresponding to SEQ ID NO: 1.
[0007] In some embodiments, the family A DNA polymerase variant described herein comprises the following substitution: (1) the amino acid residue corresponding to the position 554, 557, 558, 579, 620, 782, 785, or 573 is substituted with a basic amino acid residue; or (2) the amino acid residue corresponding to the position 593 or 863 is substituted with an acid amino acid residue; or (3) the amino acid residue corresponding to the position 512, 563, 792, or 859 is substituted with a non-polar amino acid residue; or (4) the amino acid residue corresponding to the position 423, 634 or 729 is substituted with a polar amino acid residue.
[0008] In some embodiments, the family A DNA polymerase variant described herein comprises the following substitution: (1) the amino acid residue corresponding to the position 554, 557, 558, 579, 620, 782, 785, or 573 is substituted with lysine or arginine; or (2) the amino acid residue corresponding to the position 593 or 863 is substituted with a aspartate residue or a glutamate residue; or (3) the amino acid residue corresponding to the position 512, 563, 792, or 859 is substituted with an alanine residue or an isoleucine residue; or (4) the amino acid residue corresponding to the position 423, 634 or 729 is substituted with a tyrosine residue, a tryptophan residue, or a glutamine residue.
[0009] In some embodiments, the family A DNA polymerase variant described herein comprises at least one substitution selected from the group consisting of: Y554KR, S557K, A558R, Q579R, E620R, N782R, S785R, R423W, R512A, K563A, N573K, K593D, R634Q, R729Y, M792I, R859A, and K863E.
[0010] In some embodiments, the family A DNA polymerase variant described herein further comprises at least one substitution selected from the group consisting of: M311L, M370G, I385L, F392L, L395M, Q405R, M416L, K431E / D, A444G, G581D, V595K / L, R596G / E / K, D598E / V, G600K / E / R / I, V602I / A / L, A609I, I657E, E658G, T685K, I716V / F / L, D718A / E / T, Y719F, E734G, P744S, Y762C, R770K / E, D810E, D830E and E846R.
[0011] In some embodiments, the family A DNA polymerase variant described herein comprises at least one combination of substitutions selected from the group consisting of: Group 1: Y554KR, S557K, A558R, Q579R, E620R, N782R, and S785R; or Group 2: R423W, R512A, K563A, N573K, K593D, R634Q, R729Y, M792I, R859A, and K863E; or any combinations of substitutions between Group 1 and Group 2.
[0012] In some embodiments, the family A DNA polymerase variant described herein comprises: (1) an amino acid sequence of any one of SEQ ID NOs: 1-22, or at least 80 percent identity thereto; or (2) an amino acid sequence of any one of SEQ ID NOs: 23-26, or at least 90 percent identity thereto.
[0013] In some embodiments, the family A DNA polymerase variant described herein lacks 5’-3’ exonuclease activity. In some embodiments, the family A DNA polymerase variant described herein comprises the large fragment of the DNA polymerase. In some embodiments, the family A DNA polymerase variant described herein lacks 250-300, 270-300, 285-290, or 289 amino acid residues at the N-terminus. In some embodiments, the family A DNA polymerase variant described herein exhibits an enhanced activity, salt tolerance, or lower no-template control signal compared to family A DNA polymerase that do not undergo the corresponding substitutions.
[0014] In some embodiments, the family A DNA polymerase variant described herein further comprising one or more tags or linkers.
[0015] In another aspect, the present disclosure provides a polynucleotide encoding the family A DNA polymerase variant described herein.
[0016] In another aspect, the present disclosure provides a vector comprising the polynucleotide described herein.
[0017] In another aspect, the present disclosure provides a recombinant host cell suitable for producing a family A DNA polymerase variant. In some embodiments, the recombinant host cell comprises the polynucleotide described herein.
[0018] In another aspect, the present disclosure provides a method of producing a family A DNA polymerase. In some embodiments, the method comprises the steps of culturing the recombinant host cell described herein, thereby giving a culture, and collecting the family A DNA polymerase variant from the culture obtained in the above step.
[0019] In another aspect, the present disclosure provides a family A DNA polymerase, which has a strand displacement activity, the family A DNA polymerase comprising: (1) an amino acid sequence of any one of SEQ ID NOs: 1-22 or a large fragment thereof, or (2) the presence of 1-3 amino acid substitutions base on (1) . In some embodiments, the strand displacement activity is expressed as LAMP activity time to result with Cq ≤ 30, ≤ 25, ≤22, or ≤ 20, or equivalent to an incubation time of ≤ 10.5 min, ≤ 9 min, ≤ 7.7 min, or ≤7 min.
[0020] In another aspect, the present disclosure provides a kit for performing a DNA amplification reaction. In some embodiments, the kit comprises the family A DNA polymerase variant or the candidate family A DNA polymerase described herein and a reaction buffer solution. In some embodiments, the kit further comprises a primer. In some embodiments, the amplification reaction is an isothermal amplification reaction, e.g. loop-mediated isothermal amplification (LAMP) reaction, recombinase polymerase amplification (RPA) reaction, helicase dependent amplification (HDA) reaction, or strand displacement amplification (SDA) reaction.
[0021] In another aspect, the present disclosure provides a method of performing a DNA amplification reaction. In some embodiments, the method comprises: incubating the family A DNA polymerase variant or the candidate family A DNA polymerase described herein with a DNA template and a primer under a condition suitable for the family A DNA polymerase variant to perform the DNA amplification reaction, thereby synthesizing a DNA strand complementary to the DNA template. In some embodiments, the DNA amplification reaction is an isothermal amplification reaction, e.g., loop-mediated isothermal amplification (LAMP) reaction, recombinase polymerase amplification (RPA) reaction, helicase dependent amplification (HDA) reaction, or strand displacement amplification (SDA) reaction. In some embodiments, the method further comprises via a reverse transcriptase. BRIEF DESCRIPTION OF DRAWING
[0022] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure. The disclosure may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0023] FIG. 1 illustrates the phylogenetic relationship of hypothetic DNA polymerases containing >73%identity to Bst DNA Polymerase. These homologs consist of 4 groups (A, B, C and D) based on their closeness to each other. The accession number and strain origin of 16 representing enzymes chosen to study their activity are shown on the right.
[0024] FIG. 2A-2B illustrates the activity of representative hypothetic wildtype enzymes. The activity shown is the ability to support LAMP amplification and how fast the signal rises above the signal threshold line. A. Amplification curves for THD16697-LF, KJE28804-LF, and AAB52611-LF. B. Hypothetical enzyme AAB62092-LF is inactive.
[0025] FIG. 3 illustrates the Bst variants with tolerance to high KCl concentration in LAMP amplification. Relative speed at 150 mM KCl and 50 mM KCl. Salt Tolerance Index: (speed at 150 mM-Speed at 50 mM) / speed at 50mM.
[0026] FIG. 4 illustrates the Activity of Bst variants in buffers containing 50, 100, 150 and 200 mM KCl.
[0027] FIG. 5A-5K illustrates the Bst variants with reduced or no NTC amplification signal. Amplification curves of the parental enzyme and 10 variants each carrying a single mutation in the presence of template (straight curves) or none (curves with triangles) .
[0028] FIG. 6 illustrates multiple sequence alignment of representative Bst DNA polymerases, large fragments.
[0029] FIG. 7 illustrates salt tolerance properties of the Bst variants in TWG31496LF (SEQ ID NO. 9) background in LAMP amplification. Relative speed at 150 mM KCl and 50 mM KCl. Salt Tolerance Index: (speed at 50 mM-Speed at 150 mM) / speed at 50mM.
[0030] FIG. 8A-8D illustrates examples of combining salt tolerance and low NTC mutation sites to generate Bst DNA polymerase variants that retain both properties.
[0031] FIG. 9A-9B illustrates the performance of these variants in LAMP amplification. FIG. 9A. LAMP amplification speed in reactions containing specific template and non-template control (NTC) in reaction buffers containing 150 mM KCl. FIG. 9B. Degree of salt tolerance shown as Salt Tolerance Index [ (speed at 50 mM-Speed at 150 mM) / speed at 50mM] .DETAILED DESCRIPTION OF THE INVENTION
[0032] Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
[0033] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.
[0034] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and / or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.
[0035] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible. I. Definition
[0036] It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the invention as claimed. In this application, the use of the singular includes the plural unless specifically stated otherwise. In this disclosure, the term “or” is used to mean “and / or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive. As used herein “another” may mean at least a second or more. Furthermore, the use of the term “including” , as well as other forms, such as “includes” and “included” , is not limiting. Also, terms such as “element” or “component” encompass both elements and components comprising one unit and elements and components that comprise more than one subunit unless specifically stated otherwise. Also, the use of the term “portion” can include part of a moiety or the entire moiety.
[0037] As used herein, the singular forms “a” , “an” and “the” include plural references unless the context clearly dictates otherwise.
[0038] The term “amino acid” as used herein refers to an organic compound containing amine (-NH2) and carboxyl (-COOH) functional groups, along with a side chain specific to each amino acid. The names of amino acids are also represented as standard single letter or three-letter codes in the present disclosure.
[0039] As used herein, the amino acid residues are abbreviated below: Alanine (Ala; A) , Asparagine (Asn; N) , Aspartic acid (Asp; D) , Arginine (Arg; R) , Cysteine (Cys; C) , Glutamate (Glu; E) , Glutamine (Gln; Q) , Glycine (Gly; G) , Histidine (His; H) , Isoleucine (Ile; I) , Leucine (Leu; L) , Lysine (Lys; K) , Methionine (Met; M) , Phenylalanine (Phe; F) , Proline (Pro; P) , Serine (Ser; S) , Threonine (Thr; T) , Tryptophan (Trp; W) , Tyrosine (Tyr; Y) , and Valine (Val; V) .
[0040] As used herein, the term “amplifying” refers to a process whereby a portion of a nucleic acid is replicated using, for example, any of a broad range of primer extension reactions. Exemplary primer extension reactions include, but are not limited to, PCR. Unless specifically stated, “amplifying” refers to a single replication or to an arithmetic, logarithmic, or exponential amplification.
[0041] As used herein, “DNA polymerase” refers to a polypeptide that catalyzes the synthesis of DNA using an existing polynucleotide as a template.
[0042] The term “host cell” means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest. The term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
[0043] As used herein, an “isolated” biological component (such as a nucleic acid, peptide or cell) has been substantially separated, produced apart from, or purified away from other biological components or cells of the organism in which the component naturally occurs, i.e., other chromosomal and extrachromosomal DNA and RNA, cells and proteins. Nucleic acids, peptides and proteins which have been "isolated" thus include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
[0044] The term “mutant” protein as used herein refers to a protein that has one or more amino acid substitutions, deletions (including truncations) or additions (including insertion) relative to a wild-type. A mutant protein may have less than 100%sequence identity to the amino acid sequence of a naturally occurring protein but may have any amino acid that is at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99%identical to the amino acid sequence of the naturally occurring protein.
[0045] A specific amino acid position (number) in the protein of the present disclosure may be determined by comparing an amino acid sequence of a target protein with a reference sequence (such as SEQ ID NO: 1) using a standard sequence comparison tool, for example, two sequences are compared with a Smith-Waterman algorithm or a CLUSTALW2 algorithm, and the above sequence is considered to be aligned when a comparison score is the highest. The comparison score may be calculated according to the methods in Wilbur, W. J. and Lipman, D. J. (1983) Rapid similarity searches of nucleic acid and protein data banks. Proc. Natl. Acad. Sci. USA, 80: 726-730. Default parameters are preferably used in a ClustalW2 (1.82) algorithm: protein gap open penalty = 10.0; protein gap extension penalty =0.2; protein matrix = Gonnet; protein / DNA end gap = -1; and protein / DNAGAPDIST = 4. An AlignX program (apart of a vectorNTI group) is preferably used to fit the default parameters of multiple comparisons (gap open penalty: 10og gap extension penalty 0.05) , and the position of the specific amino acid in the target protein is determined by comparing the amino acid sequence of the protein with SEQ ID NO: 1.
[0046] It is to be understood that, the amino acids in the mutein of the present disclosure are numbered based on the reference sequence SEQ ID NO: 1. When certain specific mutein is of 80%or above identity to the sequence shown in SEQ ID NO: 1, the amino acid number of the mutein may have misalignment relative to the amino acid number of SEQ ID NO: 1, for example, misalignment of 1-5 positions to an N-terminal or C-terminal of the amino acid. With a conventional sequence comparison technology in the art, a person skilled in the art may generally understand that such misalignment is within a reasonable range, and should believe that mutein being of 80% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identity due to the misalignment of the amino acid numbers and having the same or similar activity or feature is also within the range of the mutein of the present disclosure.
[0047] The term “nucleic acid” or “polynucleotide” as used herein refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single-or double-stranded form. Unless otherwise indicated, a particular polynucleotide sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) , alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and / or deoxyinosine residues (see Batzer et al., Nucleic Acid Res. 19 (18) : 5081 (1991) ; Ohtsuka et al., J. Biol. Chem. 260 (5) : 2605-2608 (1985) ; and Rossolini et al., Mol. Cell. Probes 8 (2) : 91-98 (1994) ) .
[0048] The term “operably linked” refers to an arrangement of elements wherein the components so described are configured so as to perform their usual function. Thus, a given signal peptide that is operably linked to a polypeptide directs the secretion of the polypeptide from a cell. In the case of a promoter, a promoter that is operably linked to a coding sequence will direct the expression of the coding sequence. The promoter or other control elements need not be contiguous with the coding sequence, so long as they function to direct the expression thereof. For example, intervening untranslated yet transcribed sequences can be present between the promoter sequence and the coding sequence and the promoter sequence can still be considered “operably linked” to the coding sequence.
[0049] “Percent (%) sequence identity” with respect to amino acid sequence (or nucleic acid sequence) is defined as the percentage of amino acid (or nucleic acid) residues in a candidate sequence that are identical to the amino acid (or nucleic acid) residues in a reference sequence, after aligning the sequences and, if necessary, introducing gaps, to achieve the maximum number of identical amino acids (or nucleic acids) . Conservative substitution of the amino acid residues may or may not be considered as identical residues. Alignment for purposes of determining percent amino acid (or nucleic acid) sequence identity can be achieved, for example, using publicly available tools such as BLASTN, BLASTp (available on the website of U.S. National Center for Biotechnology Information (NCBI) , see also, Altschul S.F. et al., J. Mol. Biol., 215 (3) : 403-410 (1990) ; Stephen F. et al., Nucleic Acids Res., 25 (17) : 3389-3402 (1997) ) , ClustalW2 (available on the website of European Bioinformatics Institute, see also, Higgins D. G. et al., Methods in Enzymology, 266: 383-402 (1996) ; Larkin M. A. et al., Bioinformatics (Oxford, England) , 23 (21) : 2947-8 (2007) ) , and ALIGN or Megalign (DNASTAR) software. A person skilled in the art may use the default parameters provided by the tool or may customize the parameters as appropriate for the alignment, such as for example, by selecting a suitable algorithm.
[0050] The term “polypeptide” or “protein” means a string of at least two amino acids linked to one another by peptide bonds. Polypeptides and proteins may include moieties in addition to amino acids (e.g., may be glycosylated) and / or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a “polypeptide” or “protein” can be a complete polypeptide chain as produced by a cell (with or without a signal sequence) or can be a functional portion thereof. Those of ordinary skill will further appreciate that a polypeptide or protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means. The term also includes amino acid polymers in which one or more amino acids are chemical analogs of a corresponding naturally occurring amino acid and polymers.
[0051] As used herein, the term “primer” refers to an oligonucleotide, typically between about 10 to 100 nucleotides in length, capable of selectively binding to a specified target nucleic acid or “template” by hybridizing with the template. The primer can provide a point of initiation for template-directed synthesis of a polynucleotide complementary to the template, which can take place in the presence of appropriate enzyme (s) , cofactors, substrates such as nucleotides and oligonucleotides and the like.
[0052] As used here, the term “primer extension reaction” refers to a reaction in which a polymerase catalyzes the template-directed synthesis of a nucleic acid from the 3' end of a primer. The term “primer extension product” refers to the resultant nucleic acid. A non-limiting exemplary primer extension reaction is the polymerase chain reaction (PCR) . The terms “extending” and “extension” refer to the template-directed synthesis of a nucleic acid from the 3' end of a primer, which is catalyzed by a polymerase.
[0053] The term “recombinant” when used with reference to a polypeptide (e.g., antibody, antigen) or a polynucleotide, refers to a polypeptide or polynucleotide that is produced by a recombinant method. A “recombinant polypeptide” includes any polypeptide expressed from a recombinant polynucleotide. A “recombinant polynucleotide” includes any polynucleotide which has been modified by the introduction of at least one exogenous (i.e., foreign, and typically heterologous) nucleotide or the alteration of at least one native nucleotide component of the polynucleotide and need not include all of the coding sequence or the regulatory elements naturally associated with the coding sequence. A “recombinant vector” refers to a non-naturally occurring vector, including, e.g., a vector comprising a recombinant polynucleotide sequence.
[0054] As used herein, “substitution” refers to the replacement of at least one base, nucleobase, nucleoside, nucleotide or amino acid with a different base, nucleobase, nucleoside, nucleotide or amino acid.
[0055] As used herein, a “vector” refers to a nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell. A vector may include nucleic acid sequences that permit it to replicate in the host cell, such as an origin of replication. A vector may also include one or more therapeutic genes and / or selectable marker genes and other genetic elements known in the art. A vector can transduce, transform or infect a cell, thereby causing the cell to express nucleic acids and / or proteins other than those native to the cell. A vector optionally includes materials to aid in achieving entry of the nucleic acid into the cell, such as a viral particle, liposome, protein coating or the like. II. Family A DNA Polymerase Variant and Production Thereof
[0056] DNA polymerases are polypeptides that catalyze the synthesis of DNA using an existing polynucleotide as a template. DNA polymerases include DNA-dependent polymerases, which use DNA as a template, or RNA-dependent polymerases, such as reverse transcriptase (RT) , which use RNA as a template.
[0057] Based on sequence homology, bacterial DNA polymerases can be subdivided into seven different families: A, B, C, D, X, Y, and RT. DNA-dependent DNA polymerases fall into one of six families (A, B, C, D, X, and Y) , with most falling into one of three families (A, B, and C) . See, e.g., Ito et al. (1991) Nucleic Acids Res. 19: 4045-4057; Braithwaite et al. (1993) Nucleic Acids Res. 21: 787-802; Filee et al. (2002) J. Mol. Evol. 54: 763-773; and Alba (2001) Genome Biol. 2: 3002.1-3002.4. Certain DNA polymerases may be single-chain polypeptides (e.g., certain family A and B polymerases) or multi-subunit enzymes (e.g., certain family C polymerases) with one of the subunits having polymerase activity.
[0058] Family A DNA polymerases ( “Pol A” ) include both replicative and repair polymerases. Replicative members from this family include T7 DNA polymerase and the eukaryotic mitochondrial DNA Polymerase γ. Among the repair polymerases are E. coli DNA Pol I, Thermus aquaticus Pol I (Taq DNA polymerase) , and Bacillus stearothermophilus Pol I. Excision repair and processing of Okazaki fragments generated during lagging strand synthesis are performed by the repair polymerases. Because most thermostable Pol A enzymes do not possess the 3’ to 5’ exonuclease activity, they are incapable of proofreading the newly synthesized nucleic acid strand and consequently have high error rates.
[0059] DNA polymerases are roughly shaped like a hand with a thumb, palm and fingers. The thumb is involved in binding and moving double-stranded DNA. The palm carries the polymerase active site, whereas the fingers bind substrates (template DNA and nucleoside triphosphates) . The exonuclease activity is in a separate protein domain. Mg2+ is a cofactor.
[0060] The original Bst DNA polymerase is the DNA polymerase I isolated from Bacillus Stearothermophilus (now classified as a Geobacillus) and belongs to family A DNA polymerases. Bst DNA polymerase is uniquely useful for a variety of isothermal amplification reactions due to its robust strand displacement abilities. In particular, it is a favored polymerase for the implementation of loop-mediated isothermal amplification (LAMP) . LAMP is a powerful and widely used diagnostic method that can rival PCR in sensitivity and speed. Since it does not require thermocycling and associated instrumentation, it is frequently found to be more convenient for both clinical and field use.
[0061] Family A DNA polymerases include a number of different enzymes that may differ in structure and function. Although Bst DNA polymerases belong to the family A, not all family A DNA polymerases are suitable for LAMP assays. For example, some family A DNA polymerases lack the necessary strand displacement activity or are unsuitable for working under LAMP reaction temperature conditions. Table 2 shows that three of the family A DNA polymerases did not exhibit LAMP activity, although they are highly homologous to the Bst enzymes. A. Family A DNA Polymerases and Variants thereof
[0062] We surveyed the GenBank database for protein sequences that showed high identity to the original Bst DNA polymerase, and these sequences are all from bacteria that can live in environment with temperatures above 50℃. These hypothetical enzymes were obtained and aligned against each other to determine their phylogenetic relationship. Representing proteins from each clade were tested for function. The expressed proteins have N-terminal truncation at a location like the large fragment from the original Bst DNA polymerase (see Table 2 for the sequences of the large fragments of the surveyed family A DNA polymerase) . Most expressed enzymes showed activity in the function assay. Surprisingly, some of them did not have activity even though expressed abundantly. Some of these inactive enzymes showed high degree of similarity to the original Bst DNA polymerase. Active candidates were subjected to extensive engineering to obtain enzymes that have improved properties over its wildtype version, and satisfied many attributes associated with fast and accurate detection in isothermal amplifications.
[0063] The present disclosure in one aspect provides a family A DNA polymerase variant. In some embodiments, the family A DNA polymerase variant exhibits an enhanced activity, salt tolerance, or lower no-template control signal compared to corresponding wild-type family A DNA polymerase.
[0064] In some embodiments, the family A DNA polymerase variant described herein comprises at least a substitution of an amino acid residue at a position corresponding to position 554, 557, 558, 579, 620, 782, 785, 573, 593, 863, 512, 563, 792, 859, 423, 634 or 729 of a reference DNA polymerase. In some embodiments, the reference DNA polymerase comprises an amino acid sequence corresponding to SEQ ID NO: 1.
[0065] The reference sequence (SEQ ID NO: 1) is used to locate where the substitution site is located, and is not a restriction on the family A DNA polymerase variant to make substitutions only on the basis of the reference sequence; it may also make substitutions on the basis of other sequences (e.g., SEQ ID NOs: 2-26) corresponding to the location of the substitution site.
[0066] In some embodiments, the family A DNA polymerase variant described herein comprises the following substitution: (5) the amino acid residue corresponding to the position 554, 557, 558, 579, 620, 782, 785, or 573 is substituted with a basic amino acid residue; or (6) the amino acid residue corresponding to the position 593 or 863 is substituted with an acid amino acid residue; or (7) the amino acid residue corresponding to the position 512, 563, 792, or 859 is substituted with a non-polar amino acid residue; or (8) the amino acid residue corresponding to the position 423, 634 or 729 is substituted with a polar amino acid residue, all referring to the reference DNA polymerase of SEQ ID NO: 1.
[0067] In some embodiments, the family A DNA polymerase variant described herein comprises the following substitution: (5) the amino acid residue corresponding to the position 554, 557, 558, 579, 620, 782, 785, or 573 is substituted with lysine or arginine; or (6) the amino acid residue corresponding to the position 593 or 863 is substituted with a aspartate residue or a glutamate residue; or (7) the amino acid residue corresponding to the position 512, 563, 792, or 859 is substituted with an alanine residue or an isoleucine residue; or (8) the amino acid residue corresponding to the position 423, 634 or 729 is substituted with a tyrosine residue, a tryptophan residue, or a glutamine residue, all referring to the reference DNA polymerase of SEQ ID NO: 1.
[0068] In some embodiments, the family A DNA polymerase variant described herein comprises at least one substitution selected from the group consisting of: Y554KR, S557K, A558R, Q579R, E620R, N782R, S785R, R423W, R512A, K563A, N573K, K593D, R634Q, R729Y, M792I, R859A, and K863E, all referring to the reference DNA polymerase of SEQ ID NO: 1.
[0069] Our approaches to directly looking for Bst variants that have improved amplification speed, increased salt tolerance and reduced NTC level have yielded novel classes of mutations. These new mutations will allow the engineering of a new generation of family A DNA polymerases suitable for a variety of amplification technologies such as LAMP, HDA, SDA, RPA etc. These new mutations Y265KR, S268K, A269R, Q290R, E331R, N493R, S496R, located in AAB52611-LF, correspond to amino acid residues 554, 557, 558, 579, 620, 782, and 785, respectively, located in AAB52611 (SEQ ID NO; 1) , which benefit salt tolerance at these positions. These new mutations R134W, R223A, K274A, N284K, K304D, R345Q, R440Y, M503I, R570A, K574E, located in AAB52611-LF, correspond to amino acid residues 423, 512, 563, 573, 593, 634, 729, 792, 859, and 863, respectively, located in AAB52611 (SEQ ID NO: 1) , which benefit Low / No NTC at these positions. Table 3 below shows the mutations in exemplary family A DNA polymerases.
[0070] Table 3. Exemplary novel mutations of family A DNA polymerases.
[0071] These variant positions could be combined in various permutations by themselves to engineer optimal Bst enzymes containing 1, 2 or 3 or more variant sites. They can be combined with other variants that further improve properties.
[0072] In some embodiments, the family A DNA polymerase variant described herein further comprises at least one substitution selected from the group consisting of: M311L, M370G, I385L, F392L, L395M, Q405R, M416L, K431E / D, A444G, G581D, V595K / L, R596G / E / K, D598E / V, G600K / E / R / I, V602I / A / L, A609I, I657E, E658G, T685K, I716V / F / L, D718A / E / T, Y719F, E734G, P744S, Y762C, R770K / E, D810E, D830E and E846R.
[0073] In some embodiments, the family A DNA polymerase variant described herein comprises at least one combination of substitutions selected from the group consisting of: Group 1: Y554KR, S557K, A558R, Q579R, E620R, N782R, and S785R; or Group 2: R423W, R512A, K563A, N573K, K593D, R634Q, R729Y, M792I, R859A, and K863E; or any combinations of substitutions between Group 1 and Group 2.
[0074] In some embodiments, the family A DNA polymerase variant described herein further comprises one or more conservative sequence modifications. As used herein, the term “conservative sequence modifications” refers to amino acid modifications that do not significantly affect or alter the DNA polymerase activities of the DNA polymerase containing the amino acid sequence. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
[0075] Amino acid substitutions can be made, in some cases, by selecting substitutions that do not differ significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, (b) the charge or hydrophobicity of the molecule at the target sit; or (c) the bulk of the side chain. For example, naturally occurring residues can be divided into groups based on side-chain properties; (1) hydrophobic amino acids (methionine, alanine, valine, leucine, and isoleucine) ; (2) neutral hydrophilic amino acids (cysteine, serine, threonine, asparagine, and glutamine) ; (3) acidic amino acids (aspartic acid and glutamic acid) ; (4) basic amino acids (histidine, lysine, and arginine) ; (5) amino acids that influence chain orientation (glycine and proline) ; and (6) aromatic amino acids (tryptophan, tyrosine, and phenylalanine) . Substitutions made within these groups can be considered conservative substitutions. Examples of substitutions include, without limitation, substitution of valine for alanine, lysine for arginine, glutamine for asparagine, glutamic acid for aspartic acid, serine for cysteine, asparagine for glutamine, aspartic acid for glutamic acid, proline for glycine, arginine for histidine, leucine for isoleucine, isoleucine for leucine, arginine for lysine, leucine for methionine, leucine for phenylalanine, glycine for proline, threonine for serine, serine for threonine, tyrosine for tryptophan, phenylalanine for tyrosine, and / or leucine for valine. Exemplary substitutions are shown in Table 1. Amino acid substitutions may be introduced into the family A DNA polymerase and the products screened for retention of the biological activity of family A DNA polymerase.
[0076] Table 1. Exemplary substitutes of amino acid residues in family A DNA polymerase
[0077] Although these variants were discovered with AAB52611-LF which served as a representative sequence, they are expected to improve other family A DNA polymerase in a similar way based on the nature of high identity among these sampled large fragments of enzymes, and the location of these variant sites in highly conserved sequence regions. This is demonstrated by the locations of these variants when they are placed on top of amino sequence alignment of a subgroup of Bst LF (FIG. 6) .
[0078] We find some highly conservative consensus regions, such as Consensus Sequence 1: KKTKTGYSTSADVLEKLAPHHEIVENILHYRQLGKLQSTYIEGLLKVV (SEQ ID NO: 23) ; Consensus Sequence 2: EPNLQNIPIRLEEGRKIRQA (SEQ ID NO: 24) , Consensus Sequence 3: NFNVRSFAERTAMNTPIQGS (SEQ ID NO: 25) , Consensus Sequence 4: LRVPLKVDYHYGPTWYDAK (SEQ ID NO: 26) ; it can be expected that family A DNA polymerase mutants that include these consensus sequences and sequences with 90%identity to the consensus sequences still perform similar functions.
[0079] In some embodiments, the family A DNA polymerase variant described herein comprises: (1) an amino acid sequence of any one of SEQ ID NOs: 1-22, or at least 80 percent identity thereto; or (2) an amino acid sequence of any one of SEQ ID NOs: 23-26, or at least 90 percent identity thereto.
[0080] In some embodiments, the family A DNA polymerase variant described herein lacks 5’-3’ exonuclease activity. In some embodiments, the family A DNA polymerase variant described herein comprises the large fragment of the DNA polymerase. In some embodiments, the family A DNA polymerase variant described herein lacks 250-300, 270-300, 285-290, or 289 amino acid residues at the N-terminus. In some embodiments, the family A DNA polymerase variant described herein exhibits an enhanced activity, salt tolerance, or lower no-template control signal compared to family A DNA polymerase that do not undergo the corresponding substitutions.
[0081] Based on our unpredictable discovery of candidate family A DNA polymerases with lamp activity. The present disclosure in another aspect provides a family A DNA polymerase. The family A DNA polymerase, which has a strand displacement activity, comprises: (1) an amino acid sequence of any one of SEQ ID NOs: 1-22 or a large fragment thereof, or (2) the presence of 1-3 amino acid substitutions base on (1) .
[0082] In some embodiments, the strand displacement activity is expressed as LAMP activity time to result with Cq ≤ 30, ≤ 25, ≤ 22, or ≤ 20, or equivalent to an incubation time of ≤ 10.5 min, ≤ 9 min, ≤ 7.7 min, or ≤ 7 min. B. Methods of Production
[0083] The family A DNA polymerase variant according to the present disclosure can be prepared recombinantly, by expression from e.g. a nucleic acid construct encoding for the family A DNA polymerase variant, for example as described in Molecular Cloning: A Laboratory Manual, 4th edition (Sambrook et al., 2001) , the entire contents of both of which are hereby incorporated by reference.
[0084] In one embodiment, DNA encoding the wild type family A DNA polymerase can be isolated using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to the family A DNA polymerase gene) . The encoding DNA may also be obtained by synthetic methods. The encoding polynucleotide can then be mutated at the site of interest by site-directed mutagenesis at the selected codons encoding the residues of interest. The mutant encoding polynucleotide can be inserted into a vector to generate a polynucleotide encoding the family A DNA polymerase variant using recombinant techniques known in the art. Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter (e.g. T7, SV40, CMV, EF-1α) , and a transcription termination sequence, which are operably linked to the mutant encoding polynucleotide.
[0085] Vectors comprising the polynucleotide sequence encoding the family A DNA polymerase variant can be introduced to a host cell for cloning or gene expression. Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote (e.g., E. coli) , yeast (e.g., Saccharomyces cerevisiae) , or higher eukaryote cells (e.g., mammalian host cell lines) .
[0086] Host cells are transfected with the above-described expression or cloning vectors for family A DNA polymerase variant production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
[0087] In certain embodiments, the family A DNA polymerase variant of the present disclosure may be purified. The term “purified, ” as used herein, is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally-obtainable state. A purified protein therefore also refers to a protein, free from the environment in which it may naturally occur. Where the term “substantially purified” is used, this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%or more of the proteins (e.g., by weight) in the composition.
[0088] Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest may be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity) . Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing. Other methods for protein purification include, precipitation with ammonium sulfate, PEG, or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques. III. Compositions and Kits
[0089] Also provided in the present disclosure are compositions and kits suitable for an amplification reaction. In some embodiments, the compositions and kits comprise the family A DNA polymerase variant or family A DNA polymerase described herein. Such compositions and kits comprise, in addition to the family A DNA polymerase variant or family A DNA polymerase described herein, components usable for DNA synthesis, such as primer, deoxyribonucleotide, and reaction buffer.
[0090] In some embodiment, the amplification reaction is an isothermal amplification reaction, e.g. loop-mediated isothermal amplification (LAMP) reaction, recombinase polymerase amplification (RPA) reaction, helicase dependent amplification (HDA) reaction, or strand displacement amplification (SDA) reaction.
[0091] In one embodiment, the composition or kit according to the present disclosure may include at least one primer, at least one deoxyribonucleotide, and / or a reaction buffer solution in addition to the family A DNA polymerase variant or family A DNA polymerase described herein.
[0092] The primer may be an oligonucleotide having a nucleotide sequence complementary to the template DNA, and is not particularly limited as long as it anneals to the template DNA under the reaction conditions used. The primer may be oligonucleotide having a random sequence (random primer) .
[0093] The length of the primer is preferably at least six nucleotides since a specific annealing process is performed, and more preferably at least 10 nucleotides. The length of the primer is preferably at most 100 nucleotides and more preferably at most 30 nucleotides in terms of the synthesis of oligonucleotide. The oligonucleotide can be synthesized, for example, according to the phosphoramidite method by the DNA synthesizer 394 (manufactured by Applied Biosystems Inc) . The oligonucleotide may be synthesized according to any other process, such as the triester phosphate method, H-phosphonate method, or thiophosphate method. The oligonucleotide may be oligonucleotide derived from a biological specimen, and for example, may be prepared such that it is isolated from restricted endonuclease digest of DNA prepared from a natural specimen.
[0094] As used herein, deoxyribonucleotide refers to phosphate groups bonded to deoxyribose bonded to organic bases by the phosphoester bond. A natural DNA includes four different nucleotides. The nucleotides respectively consisting of adenine, guanine, cytosine and thymine bases can be found in the natural DNA. The adenine, guanine, cytosine and thymine bases, are respectively abbreviated as A, G, C and T. The deoxyribonucleotide includes free monophosphate, diphosphate and triphosphate (more specifically, the phosphate groups each includes one, two or three phosphate portions) . Therefore, the deoxyribonucleotide includes deoxyribonucleotide triphosphate (for example, dATP, dCTP, dITP, dGTP and dTTP) and derivatives thereof. The deoxyribonucleotide derivative includes [αS] dATP, 7-deaza-dGTP, 7-deaza-dATP and a deoxynucleotide derivative showing resistance against the decomposition of nucleic acid. The nucleotide derivative includes, for example, deoxyribonucleotide labeled in such a manner that can be detected by a radioactive isotope such as 32P or 35S, a fluorescent portion, a chemiluminescent portion, a bioluminescent portion or an enzyme.
[0095] Deoxyribonucleotide triphosphate, as used herein, refers to a nucleotide of which the sugar portion is composed of deoxyribose, and having a triphosphate group. A natural DNA includes four different nucleotides which respectively has adenine, guanine, cytosine and thymine as the base portion. The deoxyribonucleotide triphosphate contained in an exemplary composition or kit of the present disclosure is a mixture of four deoxyribonucleotides triphosphate, dATP, dCTP, dGTP, and dTTP.
[0096] As used herein, the reaction buffer solution means a solution suitable for the family A DNA polymerase variant disclosed herein to perform DNA synthesis. In one embodiment, the reaction buffer includes a buffer agent or a buffer agent mixture and may further include divalent cations and monovalent cations. In one embodiment, the reaction buffer contained in the composition or kit is a 5X or 10X buffer solution, i.e., the buffer solution needs to be diluted 5 or 10 times in a reaction for DNA synthesis. IV. Method of Use
[0097] In another aspect, the present disclosure provides methods of using the family A DNA polymerase variant or family A DNA polymerase as disclosed herein for DNA synthesis.
[0098] In some embodiment, the method further comprising the step of reverse transcribing RNA to cDNA with the inclusion of a reverse transcriptase.
[0099] In one embodiment, the method for synthesizing DNA using the composition disclosed herein, comprises the steps of:
[0100] A) preparing a solution comprising the family A DNA polymerase variant disclosed herein, at least one primer, at least one deoxyribonucleotide, and DNA serving as a template; and
[0101] B) incubating the solution prepared in the step A) under a condition suitable for the family A DNA polymerase variant to perform primer extension, i.e., synthesizing DNA using the DNA as the template.
[0102] In one method disclosed herein, the DNA synthesis reaction may include one kind of template or a plurality of different templates having different nucleotide sequences. When a specific primer for a particular template is used, primer extension products from the plurality of different templates in the nucleic acid mixture can be produced. The plurality of templates may be present in the different nucleic acids or the same nucleic acid. The DNA, which is a template to which the method disclosed herein is applicable, is not particularly limited. Examples of the DNA are an group of DNA molecules in all of DNAs in a specimen, a group of DNA molecules such as plasmid DNA or genomic DNA, or particular group of DNA molecules (for example, a group of DNA molecules having a common nucleotide sequence motif, a group of DNA molecules concentrated by means of the subtraction process) .
[0103] In some embodiments, the DNA serving as the template may be included in a specimen derived from an organism such as cells, tissues or blood, or a specimen such as food, soil or waste water which possibly includes organisms. Further, the DNA may be included in a nucleic acid-containing preparation obtained by processing such a specimen or the like according to the conventional process. Examples of the preparation is homogenized cells, and a specimen obtained by fractioning the homogenized cells, all of DNAs in the specimen, or a group of particular DNA molecules, for example, a specimen in which genomic DNA is enriched, and the like.
[0104] The amount of the family A DNA polymerase variant to be used in the method disclosed herein is not particularly limited. In the case where the DNA synthesis reaction is performed with 20 μL of the reaction solution, the amount of the family A DNA polymerase variant can be 0.02 -20 μg, or 1 -10 μg, or 2 -5 μg.
[0105] The concentration of the primer used in the method disclosed herein is not particularly limited. The concentration is preferably at least 0.1 μM, 0.2 μM or 0.3 μM in the DNA synthesis reaction.
[0106] The conditions which are suitable for the family A DNA polymerase variant to perform DNA synthesis reaction, i.e., satisfactory for synthesizing the primer extension strand complementary to the template DNA are not particularly limited. Typically, isothermal amplification using the family A DNA polymerase variant described herein can be performed at a constant temperature between 37 to 65 ℃.
[0107] In some embodiments, the family A DNA polymerase variant described herein can be used in a Loop-mediated isothermal amplification (LAMP) reaction, which uses 4-6 primers recognizing 6-8 distinct regions of target DNA for a highly specific amplification reaction. In an example, the family A DNA polymerase variant described herein initiates synthesis and 2 specially designed primers form “loop” structures to facilitate subsequent rounds of amplification through extension on the loops and additional annealing of primers. DNA products are very long (>20 kb) and formed from numerous repeats of the short (80- 250 bp) target sequence, connected with single-stranded loop regions in long concatamers.
[0108] In some embodiments, the family A DNA polymerase variant described herein can be used in a recombinase polymerase amplification (RPA) reaction, which is enabled through the activity of a recombinase enzyme that help primers invade into double-stranded DNA. In one example, T4 UvsX DNA Recombinase can be used in combination with its accessory protein, UvsY, and the single-stranded binding protein gp32 to form D-loop recombination structures for initiation of amplification by the family A DNA polymerase variant described herein.
[0109] The following examples are provided to better illustrate the claimed invention and are not to be interpreted in any way as limiting the scope of the invention. All specific compositions, materials, and methods described below, in whole or in part, fall within the scope of the invention. These specific compositions, materials, and methods are not intended to limit the invention, but merely to illustrate specific embodiments falling within the scope of the invention. One skilled in the art may develop equivalent compositions, materials, and methods without the exercise of inventive capacity and without departing from the scope of the invention. It will be understood that many variations can be made in the procedures herein described while still remaining within the bounds of the invention. It is the intention of the inventors that such variations are included within the scope of the invention. EXAMPLE 1
[0110] This example shows the discovery of family A DNA polymerases having LAMP activity.
[0111] Using bioinformatics approach, we searched the GenBank database for protein sequences using BLASTP (Basic Local Alignment Search Tool with protein database) analysis and identified about 200 candidates.
[0112] By performing multiple sequence alignments, a phylogenetic tree was constructed to reveal the relationship among these sequences (FIG. 1) . They could be separated into 4 major groups (A, B, C and D) with B having the most members. Based on the abundance and phylogenetic relatedness, a total of 16 sequences (SEQ ID NOs: 1-16) were chosen to represent different subgroups in functional analysis.
[0113] These 16 screened enzymes LF (Large Fragment from SEQ ID NOs: 1-16, see Table 2) were constructed by standard gene synthesis and assembled into a T7 promoter-based protein expression vector pET21a. 15 / 16 constructs expressed well in this system (Table 2) . The expressed proteins were tested for their polymerase activity in a LAMP (loop-mediated amplification) assay (Notomi et al, 2000) . In this assay, a set of primers targeting a specific sequence region of a template are combined to amplify a small DNA target region by a thermophilic DNA polymerase at ~65℃. The amplification signal is monitored as fluorescent signal produced by dsDNA-specific binding dye, which is in proportion to the accumulation of synthesized DNA and is acquired in real-time on a qPCR machine. The amplification speed, which is defined as the time point when the amplification signal reaches above a threshold line, is proportional to the polymerase activity. In our assay, primers are designed to amplify a small region of the lambda phage DNA. In this assay, a reference Bst DNA polymerase LF (AAB52611-LF) (Large fragment from SEQ ID No: 1) showed moderate LAMP amplification activity. Among those predicted proteins (FIG. 2A-2B, Table 2) , most of them showed activity and some of them have higher activity than AAB52611-LF.
[0114] Based on the excellent LAMP activity of some of the above family A DNA polymerases, it can be expected that substituting at least one beneficial or equivalent amino acid on their basis would still exhibit LAMP activity not inferior to that of the original enzyme, for example, 6 enzymes (SEQ ID NOs: 17-22) were constructed, all of which have comparable or superior LAMP activity to the original enzyme (Table 2) .
[0115] Table 2. Predicated and synthetic family A DNA polymerases LAMP Activity: +++, Cq<30; ++, Cq between 30-50; +, Cq>50 1 Cq equals 21s incubation time. EXAMPLE 2
[0116] This example shows engineering of the family A DNA polymerases identified in EXAMPLE 1.
[0117] It is desired to have DNA polymerases that support isothermal amplification, tolerate high salt, and low or no amplification in the absence of target sequence. To improve the enzyme properties, those family A DNA polymerases identified in EXAMPLE 1 that showed high activity were chosen to engineer variants that show improved properties in amplification speed, salt tolerance and low no-template amplification signal. Candidate mutation sites were generated by using the Q5 Site-Directed Mutagenesis (New England Biolabs) and mutation sites were verified by whole plasmid sequencing. The activity of these Bst polymerase variants was compared against their parental wildtype protein in the above LAMP based assay.
[0118] To discover variants that increase salt tolerance, we designed and screened novel mutations in a derivative clone based on AAB52611-LF. These variants were assayed for their activity to support LAMP amplification at low (50 mM) and high (150 mM) KCl conditions. The parent clone showed a reduced speed at 150 mM KCl compared to that at 50 mM, indicating an inhibition by high salt. Several variants were discovered to have varied degree of tolerance to high concentrations of 150 mM KCl (FIG. 3) : Two variants (S268K and Q290R) showed moderate increased activity at 150 mM KCL, four (A269K, E331R, N493R, and S496R) , and a variant which carries an insertion of two amino acid (Y265KR) even showed higher activity at 150 mM KCl. In a further demonstration, these variants were tested for LAMP activity under conditions containing 50, 100, 150 and 200 mM KCl and they showed a trend of strong activity at high range of KCl concentration (FIG. 4) . Even at 200 mM KCl, several variants were observed to have strong activity.
[0119] Amplification signal from no-template control (NTC) is very critical in isothermal amplification, as it may lead to false positive amplification. Thus, it is valuable to have Bst DNA polymerase that produces low or no NTC signal. Almost all current commercial enzymes produce NTC signal to some degree. Toward this goal, we assayed mutations for their NTC signal level in LAMP amplification and compared to that from their parent enzyme. We found variants with amino acid changes at 10 positions could result in LAMP reactions with very low NTC or none during the entire amplification period (~40 minutes) while the signal from amplifications containing template remained little changed (FIG. 5A-5K) . As shown in the first panel for the parental clone, there was prominent NTC signal in both duplicate samples. Variant R134W had much delayed NTC signal compared to its parent. Three variants (K274A, R345Q and R570A) showed even delayed NTC and only appeared in one of the duplicates. Six variants (R223A, N284K, K304D, R440Y, M503I, and K574E) did not show any NTC signal. EXAMPLE 3
[0120] This example demonstrates that the salt tolerant substitutions shown in EXAMPLE 2 also confer salt tolerance when introduced to a different Bst-LF homolog, indicating these amino acids play universal roles.
[0121] Bst DNA polymerases share about >73%identity as shown in the selected enzymes in Table 2. This high levels of identity implies these enzymes have very similar structures and individual amino acids show similar functions. We introduced the amino acid substitutions that confer salt tolerance in AAB52611-LF into a different Bst homolog. We chose TWG31496-LF and these two proteins share 88.4 %identity. The activity of these TWG31496-LF variants was compared against their parental wildtype protein in the above LAMP based assay in buffers containing low (50 mM) and high (150 mM) KCl conditions. The results are summarized in FIG. 7. These variants were found to also show significant tolerance in reaction buffers containing 150 mM KCl compared to their parental strain, indicating these amino acid substitutions increase tolerance to high salt concentration. Interestingly, the degree of salt resistance conferred by individual amino acid substitutions generally follow the same trend but there is some difference. A comparison of the salt resistance by equivalent substitutions between TWG31496-LF and TWG31496-LF is summarized in Table 4.
[0122] Table 4. Comparison of salt tolerance in two different Bst DNA polymerases EXAMPLE 4
[0123] This example shows advantages of combining two classes of amino acids disclosed in Example 2.
[0124] Salt tolerance and NTC-reducing substitutions affect Bst DNA polymerase differently. Both properties are highly desirable in isothermal amplifications. We made Bst variants carrying combinations of these substitutions in AAB52611-LF by site-directed mutagenesis and assayed their activity in LAMP amplification to estimate the salt tolerance and NTC signal levels. We identified a subgroup of variants that retained both properties. Some examples are shown in FIG. 8A-8D for their amplification curves in reactions buffers containing 150 mM KCl, and FIG. 9A-9B for amplification speed and salt tolerance. Some variants showed almost no NTC (N493R K57E and S496R K574E, FIG. 8A and 8B) while some others have reduced NTC (Y264KR R345Q and A269R N284K, FIG. 8C and 8D) . A summary of amplification speed with template and NTC is presented in FIG. 9A. These variants retained their tolerance to high concentrations of salt in LAMP amplifications (FIG. 9B) .
Claims
1.A family A DNA polymerase variant comprising at least one substitution of an amino acid residue at a position corresponding to position 554, 557, 558, 579, 620, 782, 785, 573, 593, 863, 512, 563, 792, 859, 423, 634 or 729 of a reference DNA polymerase, wherein the reference DNA polymerase comprises an amino acid sequence corresponding to SEQ ID NO: 1.2.The family A DNA polymerase variant according to claim 1, wherein(1) the amino acid residue corresponding to the position 554, 557, 558, 579, 620, 782, 785, or 573 is substituted with a basic amino acid residue; or(2) the amino acid residue corresponding to the position 593 or 863 is substituted with an acid amino acid residue; or(3) the amino acid residue corresponding to the position 512, 563, 792, or 859 is substituted with a non-polar amino acid residue; or(4) the amino acid residue corresponding to the position 423, 634 or 729 is substituted with a polar amino acid residue.3.The family A DNA polymerase variant according to claim 1or 2, wherein(1) the amino acid residue corresponding to the position 554, 557, 558, 579, 620, 782, 785, or 573 is substituted with lysine or arginine; or(2) the amino acid residue corresponding to the position 593 or 863 is substituted with a aspartate residue or a glutamate residue; or(3) the amino acid residue corresponding to the position 512, 563, 792, or 859 is substituted with an alanine residue or an isoleucine residue; or(4) the amino acid residue corresponding to the position 423, 634 or 729 is substituted with a tyrosine residue, a tryptophan residue, or a glutamine residue.4.The family A DNA polymerase variant according to any one of claim 1-3, comprising at least one substitution selected from the group consisting of: Y554KR, S557K, A558R, Q579R, E620R, N782R, S785R, R423W, R512A, K563A, N573K, K593D, R634Q, R729Y, M792I, R859A, and K863E.5.The family A DNA polymerase variant according to any one of claim 1-4, further comprising at least one substitution selected from the group consisting of: M311L, M370G, I385L, F392L, L395M, Q405R, M416L, K431E / D, A444G, G581D, V595K / L, R596G / E / K, D598E / V, G600K / E / R / I, V602I / A / L, A609I, I657E, E658G, T685K, I716V / F / L, D718A / E / T, Y719F, E734G, P744S, Y762C, R770K / E, D810E, D830E and E846R.6.The family A DNA polymerase variant according to any one of claim 1-5, comprising at least one combination of substitutions selected from the group consisting of:Group 1: Y554KR, S557K, A558R, Q579R, E620R, N782R, and S785R; orGroup 2: R423W, R512A, K563A, N573K, K593D, R634Q, R729Y, M792I, R859A, and K863E; orany combinations of substitutions between Group 1 and Group 2.7.The family A DNA polymerase variant according to any one of claim 1-6, comprising (1) an amino acid sequence of any one of SEQ ID NOs: 1-22, or at least 80 percent identity thereto; or(2) an amino acid sequence of any one of SEQ ID NOs: 23-26, or at least 90 percent identity thereto.8.The family A DNA polymerase variant according to any one of claim 1-7,(1) which lacks 5’ -3’ exonuclease activity, or(2) which lacks 250-300, 270-300, 285-290, or 289 amino acid residues at the N-terminus, or(3) comprising or being large fragment of the family A DNA polymerase.9.The family A DNA polymerase variant according to any one of claim 1-8, which exhibits an enhanced activity, salt tolerance, or lower no-template control signal compared to the family A DNA polymerase that do not undergo the corresponding substitutions.10.The family A DNA polymerase variant according to any one of claim 1-9, further comprising one or more tags or linkers.11.A polynucleotide encoding the family A DNA polymerase variant according to any one of claim 1-10.12.A vector comprising the polynucleotide of claim 11.13.A recombinant host cell suitable for producing a family A DNA polymerase variant, comprising the polynucleotide of claim 11.14.A method of producing a family A DNA polymerase, comprising the steps of culturing the recombinant host cell of claim 13, thereby giving a culture, and collecting the family A DNA polymerase variant from the culture obtained in the above step.15.A family A DNA polymerase having a strand displacement activity, the family A DNA polymerase comprising:(1) an amino acid sequence of any one of SEQ ID NOs: 1-22 or a large fragment thereof, or(2) the presence of 1-3 amino acid substitutions base on (1) ,optionally, the strand displacement activity is expressed as LAMP activity time to result with Cq ≤ 30, ≤ 25, ≤ 22, or ≤ 20, or equivalent to an incubation time of ≤ 10.5 min, ≤ 9 min, ≤ 7.7 min, or ≤ 7 min.16.A kit for performing a DNA amplification reaction, comprising the family A DNA polymerase variant according to any one of claim 1-10 or the family A DNA polymerase according to claim 15, and a reaction buffer solution,optionally, the DNA amplification reaction is an isothermal amplification reaction, e.g. loop-mediated isothermal amplification (LAMP) reaction, recombinase polymerase amplification (RPA) reaction, helicase dependent amplification (HDA) reaction, or strand displacement amplification (SDA) reaction,optionally, further comprising a primer.17.A method of performing a DNA amplification reaction, comprising:incubating the family A DNA polymerase variant according to any one of claim 1-10 or the family A DNA polymerase according to claim 15 with a DNA template and a primer under a condition suitable for the family A DNA polymerase variant to perform the DNA amplification reaction, thereby synthesizing a DNA strand complementary to the DNA template.18.The method of claim 17, wherein the DNA amplification reaction is an isothermal amplification reaction, e.g., loop-mediated isothermal amplification (LAMP) reaction, recombinase polymerase amplification (RPA) reaction, helicase dependent amplification (HDA) reaction, or strand displacement amplification (SDA) reaction, optionally, the method further comprising the step of reverse transcribing RNA to cDNA with the inclusion of a reverse transcriptase.
Citation Information
Patent Citations
Method for improving activity of large fragments of polymerase through site-directed mutagenesis and application
CN112175980A
Bst DNA polymerase large fragment mutant and application thereof
CN115975978A
Bst DNA polymerase mutant, application and streptococcus pneumoniae detection kit
CN117721092A
Bst DNA polymerase mutant with improved enzymatic activity and application thereof
CN117925559A
Engineered DNA polymerase variants
WO2024059547A2