Application and method of ganoderma lucidum transcription factor yabby1 in regulating and controlling transcriptional activity of ganoderic acid synthetic gene SQS

Abstract

The invention provides an application of a ganoderma lucidum transcription factor yabby1 in regulating and controlling the transcriptional activity of a ganoderic acid synthetic gene SQS and a method, and belongs to the field of gene engineering. The nucleotide sequence of the yabby1 gene provided by the invention is as shown in SEQ ID NO. 1, and the amino acid sequence of the yabby1 gene is as shown in SEQ ID NO. 2; the ganoderma lucidum transcription factor yabby1 gene and the ganoderma lucidum SQS gene are constructed on a recombinant vector and are introduced into cells, so that the expression of the ganoderma lucidum SQS gene can be activated, and the content of ganoderic acid in ganoderma lucidum can be increased.

Description

Technical Field

[0001] The present invention belongs to the field of genetic engineering, relates to a Ganoderma lucidum transcription factor, and specifically relates to an application and method of the Ganoderma lucidum transcription factor yabby1 in regulating the transcription activity of the ganoderic acid synthesis gene SQS. Background Art

[0002] Ganoderma lucidum is the dried fruiting body of the Ganoderma lucidum or Ganoderma sinensis, a Polyporaceae family fungus. It has a sweet taste and a neutral nature, and enters the heart, lung, liver, and kidney meridians. It has the effects of tonifying qi, calming the mind, and relieving cough and asthma. It is used to treat restlessness, insomnia, palpitations, lung deficiency, cough and asthma, consumptive fatigue, shortness of breath, and loss of appetite. Modern research has revealed that Ganoderma triterpenes are one of the main components that contribute to Ganoderma lucidum's medicinal effects. Ganoderic acid is a highly oxidized lanostane-type tetracyclic triterpenoid compound, with various types including Ganoderic acid A, Ganoderic acid B, and Ganoderic acid C1. Ganoderic acid exhibits multiple pharmacological effects, including anti-inflammatory, anti-tumor, and anti-aging, and has potential clinical applications and new drug development potential. Ganoderic acid has demonstrated efficacy in treating inflammatory responses in various diseases, exerting its anti-inflammatory effects by regulating inflammatory cytokine levels and related signaling pathways. Ganoderic acid can also restore organ damage, showing improvements in lung, liver, and kidney damage. Furthermore, ganoderic acid exerts broad-spectrum anti-tumor effects through multiple pathways, including cell cycle arrest, tumor cell proliferation inhibition, and apoptosis induction. It also protects the nervous system by inhibiting inflammation and reducing hippocampal neuronal apoptosis. It also lowers blood glucose and lipid levels by regulating glucose and lipid metabolism, demonstrating its potential for preventing and treating diseases such as tumors, the nervous system, and diabetes. Currently, ganoderic acid and its derivatives are among the most important pharmacologically active components of Ganoderma lucidum. Molecularly elucidating the ganoderic acid biosynthesis pathway and its regulatory mechanisms will facilitate the use of modern synthetic biology to increase the content of Ganoderma lucidum triterpenes and enable large-scale production of Ganoderma lucidum triterpenes. The MVA pathway for ganoderic acid biosynthesis is currently known to initiate from acetyl-CoA and, through several catalytic reactions, generate lanosterol, the precursor of Ganoderma lucidum triterpenes. Key pathway genes, including Gl-aact, Gl-hmgs, Gl-hmgr, Gl-mvd, Gl-fps, Gl-sqs, and Gl-ls, have been cloned, but the molecular mechanisms by which lanosterol influences downstream ganoderic acid biosynthesis remain unclear. At present, only four CYP450 genes, cyp5150l8, cyp512u6, cyp505d13, and cyp5139g1, have been found to be involved in the biosynthesis of ganoderic acid. The mechanism of action of the remaining CYP450s remains unclear. Therefore, studying and analyzing the molecular regulatory mechanism of CYP450s in the biosynthetic pathway of ganoderic acid is the main direction of current research on Ganoderma lucidum. At present, the research strategies on the biosynthesis and metabolic regulation of ganoderic acid mainly focus on several aspects: environmental factors such as dissolved oxygen, heat stress, pH, and culture methods significantly affect the biosynthesis of ganoderic acid; exogenous additives such as metal ions Cu 2+ 、Mn2 + 、Na + Inducing the upregulation of Gl-hmgs, Gl-fps, and Gl-sqs gene transcription, inducing the accumulation of ganoderic acid; regulating the synthesis of ganoderic acid by affecting the expression of key enzymes in the synthesis pathway through the expression of single or multiple signal molecules, such as Ca2 + , NO, ROS, cAMP, H2S and other signal molecules may be transmitted through Ca 2+ Regulatory genes involved in ganoderic acid biosynthesis.

[0003] Transcription factors (TFs), also known as trans-acting factors, are crucial components of gene regulatory networks and are ubiquitous in biological processes such as growth, development, and environmental response (ONG L, HUANG SC, WISEA, et al. A transcription factor hierarchy defines an environmental stress response network[J]. Science, 2016). They regulate the transcription of target genes by binding to promoters, effectively initiating secondary metabolic pathways and thereby enhancing the production of secondary metabolites. They are currently a commonly used and effective genetic engineering tool (WANG M, QIU X, PAN X, et al. Transcriptional Factor-Mediated Regulation of Active Component Biosynthesis in Medicinal Plants[J]. Current Pharmaceutical Biotechnology, 2021). Furthermore, TFs largely determine the inducible expression of key enzyme genes, as well as the specificity and efficiency of their spatiotemporal expression. Therefore, TFs hold great promise as a new research direction in the regulation of secondary metabolism.

[0004] The prior art CN119061025A discloses that the Ganoderma lucidum transcription factor C3H-2 can activate the expression of Ganoderma lucidum SQS gene and LSS gene, thereby increasing the content of ganoderic acid in Ganoderma lucidum. Tu Junliang et al. (Tu Junliang. Study on the regulation of ganoderic acid biosynthesis by calcineurin-responsive zinc finger transcription factor CRZ1 in Ganoderma lucidum [D]. Kunming University of Science and Technology, 2021.) constructed the crz1 gene silencing and high expression engineered strains CRZ1SI and CRZ1OE, and carried out liquid static fermentation culture on CRZ1SI, CRZ1OE and wild type (WT) strains respectively. In 10mM Ca 2+Under these conditions, silencing crz1 significantly reduced ganoderic acid content in liquid static fermentation, while overexpression of crz1 significantly increased ganoderic acid content in liquid static fermentation. Quantitative PCR results showed that the transcription levels of the farnesyl pyrophosphate synthase and lanolinol synthase genes in the CRZ1si strain were significantly lower than those in the WT strain. The transcription levels of fps and Is in the CRZ1OE strain were significantly higher than those in the WT strain throughout the liquid static fermentation. These results indicate that silencing and overexpression of crz1 significantly affect ganoderic acid accumulation and the transcription levels of genes involved in ganoderic acid biosynthesis. Studies investigating the mechanism by which crz1 regulates ganoderic acid biosynthesis revealed that CRZ1 binds to the promoter of the fps gene, which is involved in ganoderic acid biosynthesis.

[0005] The YABBY gene family possesses two highly conserved domains: the zinc finger domain and the YABBY domain. Based on their diverse expression patterns across angiosperms, YABBY genes can be divided into two categories: "vegetative" and "reproductive." FIL, YAB3, YAB2, and YAB5 are expressed in cotyledons and floral organs, with little expression in ovules, making them "vegetative" genes. CRC and INO are expressed exclusively in developing carpels and ovules, respectively, making them "reproductive" genes. Studies in Arabidopsis thaliana have shown that FIL, YAB2, YAB3, and YAB5 exhibit both vegetative and reproductive expression. Experiments have shown that the functional diversity of the YABBY family is likely related to differences in gene regulation and expression during the evolution of monocots and dicots. Furthermore, the YABBY family is rich in cis-elements, suggesting that YABBY genes may play a regulatory role in plant stress resistance. Studies have shown that YABBY transcription factors regulate plant secondary metabolism, acting as both activators and repressors of secondary metabolites. So far, no YABBY gene related to ganoderic acid synthesis has been disclosed. Summary of the Invention

[0006] The present invention addresses the problem that the prior art fails to disclose the influence of the YABBY gene on ganoderic acid synthesis. It provides the use and method of the Ganoderma lucidum transcription factor yabby1 in regulating the transcriptional activity of the ganoderic acid synthesis gene SQS. The yabby1 gene provided by the present invention has a nucleotide sequence as shown in SEQ ID NO. 1 and an amino acid sequence as shown in SEQ ID NO. 2. When the Ganoderma lucidum transcription factor yabby1 gene and the Ganoderma lucidum SQS gene are constructed into a recombinant vector and introduced into cells, the expression of the Ganoderma lucidum SQS gene can be activated, thereby increasing the ganoderic acid content in Ganoderma lucidum.

[0007] To achieve the above object, the technical solution adopted by the present invention is as follows: In one aspect, the present invention provides a Ganoderma lucidum transcription factor yabby1, wherein the nucleotide sequence of the Ganoderma lucidum transcription factor yabby1 is the sequence shown in SEQ ID NO.1, or a sequence having a sequence similarity of more than 80% to SEQ ID NO.1.

[0008] On the other hand, the present invention provides a recombinant vector comprising the above-mentioned Ganoderma lucidum transcription factor yabby1.

[0009] Preferably, the recombinant vector comprises a plasmid, a phage or a virus.

[0010] Preferably, the recombinant vector is a plasmid, and the plasmid includes pGADT7-AD or pGreenII62-SK.

[0011] Preferably, when the plasmid is pGADT7-AD, the primers for amplifying the Ganoderma lucidum transcription factor yabby1 are shown as SEQ ID NOs. 4-5; when the plasmid is pGreenII62-SK, the primers for amplifying the Ganoderma lucidum transcription factor yabby1 are shown as SEQ ID NOs. 6-7.

[0012] In another aspect, the present invention provides a cell comprising the aforementioned Ganoderma lucidum transcription factor yabby1 or the aforementioned recombinant vector.

[0013] Preferably, the cell is a genetically engineered bacterium, which includes Escherichia coli, yeast, Agrobacterium, actinomycetes or filamentous fungi.

[0014] On the other hand, the present invention provides the use of the Ganoderma lucidum transcription factor yabby1 in regulating the expression of Ganoderma lucidum SQS gene.

[0015] On the other hand, the present invention provides a method for synthesizing ganoderic acid, wherein the method comprises biosynthesis through the above-mentioned Ganoderma transcription factor yabby1, the above-mentioned recombinant vector or the above-mentioned cell.

[0016] On the other hand, the present invention provides the use of the above-mentioned Ganoderma lucidum transcription factor yabby1, the above-mentioned recombinant vector, the above-mentioned cell or the above-mentioned method in the synthesis of ganoderic acid.

[0017] Compared with the prior art, the present invention has the following beneficial effects: 1. The present invention constructs the Ganoderma lucidum transcription factor yabby1 gene and the Ganoderma lucidum SQS gene into a recombinant vector and introduces the vector into cells, thereby enhancing the expression of the Ganoderma lucidum SQS gene and increasing the ganoderic acid content in Ganoderma lucidum.

[0018] 2. The Ganoderma lucidum transcription factor yabby1 can regulate the key enzyme genes involved in the synthesis and metabolism of ganoderic acid, thereby achieving the regulation of the ganoderic acid content in Ganoderma lucidum. BRIEF DESCRIPTION OF THE DRAWINGS

[0019] Figure 1 This is the calorimetric diagram of yabby1 gene expression in Example 1.

[0020] Figure 2 This is the plasmid map of pGADT7-yabby1.

[0021] Figure 3 The figure shows the analysis results of yeast one-hybrid experiment; among them, the control group is the pAbAi-SQS recombinant vector and the pGADT7-AD empty vector co-transformed into yeast competent cells; the experimental group is the pAbAi-SQS recombinant vector and the pGADT7-yabby1 recombinant vector co-transformed into yeast competent cells.

[0022] Figure 4 This is the plasmid map of pGreenII 62SK-yabby1, abbreviated as 62SK-yabby1 in the figure.

[0023] Figure 5 Figure 3 shows the analysis results of the dual-luciferase reporter experiment and the fluorescence imaging results. A shows the results of the dual-luciferase reporter experiment, where ** indicates that there is a significant difference between the 62SK+SQS group and the yabby1+SQS group (p value < 0.01). B shows the fluorescence imaging results, where the 62SK+SQS group and the yabby1+SQS group are located on both sides of the same leaf. DETAILED DESCRIPTION

[0024] Unless otherwise specified, all raw materials and reagents used in the present invention were purchased from commercial suppliers, and experiments were performed according to the operating instructions. Unless otherwise specified, all instruments, equipment, devices, etc. used in the present invention were conventional instruments, equipment, devices, etc., and experiments were performed according to the operating instructions and supporting reagents.

[0025] In order to make the purpose, technical solutions and advantages of the present invention more clearly understood, the present invention is further described in detail below in conjunction with the examples. In the examples, if specific conditions are not specified, the conditions according to normal conditions or manufacturer's recommendations are carried out. If all reagents or instruments are not specified by manufacturer, they are all conventional products that can be purchased commercially. In order to better illustrate the present invention, numerous specific details are provided in the specific embodiments below. The specific embodiments described herein are only used to explain the present invention and are not intended to constitute any limitation of the present invention.

[0026] Professional data analysis software was used for data analysis and statistical analysis, and t-test was used for significance analysis. P < 0.05 indicated a significant difference.

[0027] The yabby1 gene and the SQS gene of the invention are both derived from Ganoderma lucidum.

[0028] Example 1: Screening of key genes regulating ganoderic acid synthesis based on transcriptome 1) Mass spectrometry imaging was used to detect the ganoderic acid content in the shell layer, cortex layer, and flesh layer of Ganoderma lucidum.

[0029] 2) Based on single-cell transcriptome data, we identified gene family members related to ganoderic acid synthesis in Ganoderma lucidum and preliminarily screened the key enzyme protein sequences in the ganoderic acid biosynthesis pathway that catalyze the production of ganoderic acid from lanosterol.

[0030] 3) Based on the transcriptome data of different tissue parts of Ganoderma lucidum, the key genes in the ganoderic acid biosynthesis pathway that catalyze the production of ganoderic acid from lanosterol were further screened through gene expression difference analysis.

[0031] 4) Correlation analysis was performed between the second-generation transcriptome data and genes in the ganoderic acid biosynthesis pathway, and the gene yabby1 that promotes ganoderic acid synthesis was screened out. The nucleotide sequence of the Ganoderma lucidum transcription factor yabby1 is shown in SEQ ID NO.1, and the amino acid sequence is shown in SEQ ID NO.2. The gene expression calorimetry is shown in Figure 1 , it can be seen that the expression level of yabby1 is highest in mycelium.

[0032] SEQ ID NO.1: Atggtcgttaccactggaaagcagcccgcgggggacgcggctaagaagacgtcggccaagggacggaaaaagacgggcagtgccggcgggcggaagaagctgaccgaattcaac aagtttatgcagaccgaagtcgcgcggctcaaacaggaaaatcccgacatgccgcataaggataggttcaagcttgtcattgacaactggaacaagcagaaggagagcaagtag.

[0033] SEQ ID NO.2: MVVTTGKQPAGDAAKKTSAKGRKKTGSAGGRKKLTEFNKFMQTEVARLKQENPDMPHKDRFKLVIDNWNKQKESK.

[0034] Example 2: Yeast one-hybrid assay To determine whether yabby1 can directly regulate SQS genes, we first conducted a yeast one-hybrid assay: (1) Construction of recombinant vector Using gDNA from the Ganoderma lucidum variety Xianzhi No. 2 as a template, the promoter region 2000 bp before the start codon ATG of the SQS gene was cloned (nucleotide sequence shown in SEQ ID NO. 3) and constructed into the pAbAi vector (manufacturer: Shanghai Zeye Biological Co., Ltd.; product number: ZY8159; insertion sites: HindIII, XmaI) to obtain the recombinant vector pAbAi-SQS. The primer sequences for amplifying the SQS gene promoter region are shown in SEQ ID NOs. 8-9: SEQ ID NO.3: Forward primer: 5´-TAGGGTCTGCTCGATTTTCG-3´ (SEQ ID NO. 8); Reverse primer: 5´-TATGACGAAAGAGTTGGTAG-3´ (SEQ ID NO. 9).

[0035] Using the cDNA of Ganoderma lucidum Xianzhi No. 2 as a template, the full-length coding region of the yabby1 gene was cloned (the sequence of yabby1 is shown in SEQ ID NO. 1). The homologous recombination primer sequences used to amplify yabby1 are shown in SEQ ID NO. 4 and SEQ ID NO. 5, respectively. The recombinant vector pGADT7-yabby1 was constructed (manufacturer: Shanghai Zeye Biotechnology Co., Ltd.; product number: ZY6124; insertion sites: HindIII, XmaI) to obtain the recombinant vector pGADT7-yabby1 (plasmid map see Figure 2 ); Forward primer: 5´-GCCATGGAGGCCATGGTCGTTACCACTGG-3´ (SEQ ID NO. 4); Reverse primer: 5´-CAGCTCGAGCTCGTCACTACTTGCTCTCCTTCTGC-3´ (SEQ ID NO. 5).

[0036] (2) Transfected cells The recombinant vector pAbAi-SQS and the empty pGADT7-AD vector were co-transformed into yeast competent cells YIH (manufacturer: Shanghai Jingkang Bioengineering Co., Ltd.; catalog number: JK-G8044) as a control group, and the recombinant vector pAbAi-SQS and pGADT7-yabby1 were co-transformed into yeast competent cells YIH as an experimental group. The cells were respectively plated on (SD / -ura / -leu) deficient culture medium and cultured at 30°C for 3-4 days. Pick more than 10 positive clones and culture them in SD / -ura / -leu liquid medium at 30°C on a shaker until OD600>1.5. Centrifuge at 1000rpm for 2 minutes, discard the supernatant, and resuspend in sterile water to OD600≈0.2. Plate the clones at the original, 1 / 10, 1 / 100, and 1 / 1000 multiplication points on SD-leu / -ura solid medium containing AbA (Aureo basidin A) and culture at 30°C for 2-3 days. The results showed that by adding 100ng / mL of AbA to inhibit promoter autoactivation in SD / -ura / -leu-deficient medium, the growth ability of the yabby1 and SQS co-transfection combination was significantly better than the control (see Figure 3 ), indicating that yabby1 can directly bind to the SQS promoter in yeast cells.

[0037] Example 3: Dual luciferase reporter assay In this example, the dual luciferase system was used to analyze the effect of yabby1 protein on the transcriptional activity of the SQS gene in tobacco. First, the pGreenII-62sk-yabby1 and pGreenII-0800-SQS promoter recombinant vectors were constructed. Figure 4 ), the blank vector was pGreenII-62sk (Manufacturer: Shanghai Zeye Biotechnology Co., Ltd.; Product No.: ZY8123; Insertion site: HindIII, XmaI), and the primer sequences used to amplify yabby1 are shown in SEQ ID NOs. 6-7; when constructing pGreenII-0800-SQS, the blank vector was pGreenII-0800 (Manufacturer: Shanghai Zeye Biotechnology Co., Ltd.; Product No.: ZY6124; Insertion site: HindIII, XmaI), the SQS gene promoter sequence is shown in SEQ ID NO. 3, and the primer sequences used to amplify the SQS gene promoter are shown in SEQ ID NOs. 10-11; Forward primer: 5´-CGCTCTAGAACTAGTGGATCCATGGTCGTTACCACTGG-3´ (SEQ ID NO. 6); Reverse primer: 5´-TTCAGCGTACCGAATTGGTACTACTTGCTCTCCTTCTGC-3´ (SEQ ID NO. 7).

[0038] Forward primer: 5´-TATAGGGCGAATTGGGTACCTAGGGTCTGCTCGATTTTCGTG-3´ (SEQ ID NO. 10); Reverse primer: 5'-AGCTTATCGATACCGTCGACTATGACGAAAGAGTTGGTAGTAGA-3' (SEQ ID NO. 11).

[0039] The corresponding vectors were transformed into GV3101-pSoup-P19 Agrobacterium tumefaciens competent cells (Manufacturer: Shanghai Weidi Biotechnology Co., Ltd.; Catalog No.: AC1003M). The experimental group was set up to co-transform pGreenII-62sk-yabby1 and pGreenII-0800-SQS into Agrobacterium tumefaciens competent cells (named yabby1+SQS group, see Figure 5 The control group was set up with pGreenII-62sk blank vector and pGreenII-0800-SQS co-transformed into Agrobacterium tumefaciens competent cells (named 62sk+SQS group, see Figure 5 ).

[0040] The experimental group used a mixture of Agrobacterium culture (pGreenII-62sk-yabby1, pGreenII-0800-SQS promoter, and competent Agrobacterium tumefaciens cells) stored at -80°C prior to use. The culture was streaked onto solid LB medium supplemented with 50µg / mL kanamycin (Kan) and 25µg / mL rifampicin (Rif). A single colony was then selected and inoculated into 0.6mL of the culture medium. This was then inoculated into shake flasks containing 5mL and 20mL of the same liquid medium at a 1:100 ratio, and the culture was allowed to grow overnight until the OD600 reached >2.0 during the stationary phase. The pellet was then centrifuged at 5000 rpm for 10 minutes at room temperature, collected, and resuspended in 1× MMA solution. The culture was mixed and incubated at room temperature in the dark for 3 hours before inoculation into Nicotiana benthamiana plants. Four- to five-week-old healthy Nicotiana benthamiana plants were selected and protected from light for 24 hours. After injection, the leaves were placed in darkness for 1-2 days and then placed in a 14 / 10h light cycle for 3-4 days. Fluorescence imaging of the leaves was performed (the imaging method was to spray D-luciferin sodium salt (30 mg / mL) on the back of the tobacco leaves after injection, and then stand in darkness for 10 minutes. The experimental results were then observed using a CDD in vivo imaging device). The imaging results are shown in Figure 5 B; then select 0.5cm 2 Add 500 μL of Glo lysis solution (manufacturer: Beijing Zhaosheng Lab Trading Co., Ltd.; item number: 0000566337) to the injection area and grind. After sufficient lysis, centrifuge at 12000 rpm and 4°C for 3 min, take 50 μL of supernatant + 50 μL of luciferin reaction substrate and react at room temperature for 10 min, use a microplate reader to measure the firefly luciferase fluorescence value as a, then add 50 μL of stop solution and react for 10 min and then measure the Renilla luciferase fluorescence value as b, and calculate whether there is an interaction between the transcription factor and the promoter by the ratio of a / b. The experimental method of the control group is the same as that of the experimental group, the only difference is that the vector pGreenII-62sk-yabby1 is replaced with the blank vector pGreenII-62sk. The results of the dual luciferase reporter experiment show (see Figure 5 ), the ratio of a / b in the yabby1+SQS group was higher than that in the control group (see Figure 5 A), the fluorescence signal is stronger (see Figure 5 B) yabby1 can activate the expression of SQS.

[0041] Finally, it should be noted that the above content is only used to illustrate the technical solution of the present invention, rather than to limit the scope of protection of the present invention. Simple modifications or equivalent substitutions of the technical solution of the present invention by ordinary technicians in this field do not deviate from the essence and scope of the technical solution of the present invention.

Claims

1. A Ganoderma lucidum transcription factor yabby1, characterized in that The nucleotide sequence of the Ganoderma lucidum transcription factor yabby1 is the sequence shown in SEQ ID NO.1, or a sequence having a sequence similarity of more than 80% to SEQ ID NO.

1.

2. A recombinant vector, characterized in that The recombinant vector comprises the Ganoderma lucidum transcription factor yabby1 according to claim 1.

3. The recombinant vector according to claim 2, characterized in that The recombinant vector includes a plasmid, a phage or a virus.

4. The recombinant vector according to claim 3, characterized in that The recombinant vector is a plasmid, and the plasmid includes pGADT7-AD or pGreenII62-SK.

5. The recombinant vector according to claim 4, characterized in that When the plasmid is pGADT7-AD, the primers for amplifying the Ganoderma lucidum transcription factor yabby1 are shown in SEQ ID NOs. 4-5; when the plasmid is pGreenII62-SK, the primers for amplifying the Ganoderma lucidum transcription factor yabby1 are shown in SEQ ID NOs. 6-7.

6. A cell comprising the Ganoderma lucidum transcription factor yabby1 according to claim 1 or the recombinant vector according to any one of claims 2 to 5.

7. The cell according to claim 6, characterized in that The cell is a genetically engineered bacterium, which includes Escherichia coli, yeast, Agrobacterium, actinomycetes or filamentous fungi.

8. Use of the Ganoderma lucidum transcription factor yabby1 according to claim 1 in regulating the expression of Ganoderma lucidum SQS gene.

9. A method for synthesizing ganoderic acid, characterized in that: The method comprises biosynthesis through the Ganoderma lucidum transcription factor yabby1 according to claim 1, the recombinant vector according to any one of claims 2 to 5, or the cell according to any one of claims 6 to 7.

10. Use of the Ganoderma transcription factor yabby1 according to claim 1, the recombinant vector according to any one of claims 2 to 5, the cell according to any one of claims 6 to 7, or the method according to claim 9 in the synthesis of ganoderic acid.

Images