Protein Tasg-D3 and application of related biological materials thereof

Abstract

The invention belongs to the field of molecular biology, and particularly relates to a protein Tasg-D3 and application of related biological materials of the protein Tasg-D3. The Tasg-D3 is a protein of which the amino acid sequence is as shown in SEQ ID NO: 3. According to the invention, a gene for coding Tasg-D3 is introduced into wheat Fielder to obtain Tasg-D3 overexpression strains OE7, OE13 and OE17, and the plant height and grain length of the Tasg-D3 overexpression strains are obviously lower than those of a receptor control Fielder, which indicates that the Tasg-D3 and the coding gene thereof negatively regulate the plant height and grain weight of a plant. The Tasg-D3 and related biological materials thereof can be used for cultivating lodging-resistant varieties, and the wheat breeding process is accelerated.

Description

TECHNICAL FIELD

[0001] The present application belongs to the field of molecular biology, and particularly relates to the application of protein Tasg-D3 and related biological materials. BACKGROUND

[0002] Wheat (Triticum aestivum L.) is one of the most important food crops in the world and is widely planted in the world.

[0003] Considerable efforts have been made to improve agronomic traits to increase wheat yield. The introduction of semi-dwarf genes into wheat is a major success in breeding high-yielding varieties. Grain shape is also an important agronomic trait of wheat, which affects the yield and flour yield of cereal crops. Positioning and cloning of wheat grain type genes and elucidating their molecular mechanisms of regulating grain type play an important role in improving wheat yield and quality. SUMMARY

[0004] The technical problem to be solved by the present application is how to regulate the agronomic traits of plants.

[0005] To solve the above problems, the present application provides the application of a protein or a substance regulating the expression of a gene encoding the protein or a substance regulating the activity or content of the protein in regulating the agronomic traits of plants, wherein the protein is a Tasg-D3 protein, which can be any of the following:

[0006] A1) a protein with an amino acid sequence of SEQ ID NO: 3,

[0007] A2) a fusion protein obtained by connecting the N-terminal or / and C-terminal of the protein of A1) with a protein tag.

[0008] In the above application, the protein is derived from wheat (Triticum aestivum L.).

[0009] The protein can be artificially synthesized, or its encoding gene can be synthesized first and then expressed biologically.

[0010] The tag protein includes but is not limited to: GST (glutathione S-transferase) tag protein, His6 tag protein (His-tag), MBP (maltose binding protein) tag protein, Flag tag protein, SUMO tag protein, HA tag protein, Myc tag protein, eGFP (enhanced green fluorescent protein), eCFP (enhanced cyan fluorescent protein), eYFP (enhanced yellow green fluorescent protein), mCherry (monomeric red fluorescent protein), or AviTag tag protein.

[0011] Herein, the substance that regulates the activity and / or content of the protein can be a substance that regulates the expression of a gene encoding the protein Tasg-D3.

[0012] Herein, the substance that regulates the expression of a gene can be a substance that performs at least one of the following six regulations: B1) regulation at the transcription level of the encoding gene, B2) regulation after the transcription of the encoding gene, B3) regulation of the RNA transport of the encoding gene, B4) regulation of the translation of the encoding gene, B5) regulation of the mRNA degradation of the encoding gene, and B6) post-translational regulation of the gene.

[0013] The present application also provides the use of a biological material, which can be any one of the following:

[0014] C1) the use of a biological material in regulating the agronomic traits of a plant and / or in the preparation of a product for regulating the agronomic traits of a plant,

[0015] C2) the use of the biological material in breeding a plant with altered agronomic traits and / or in the preparation of a product for breeding a plant with altered agronomic traits,

[0016] C3) the use of the biological material in plant breeding and / or in the preparation of a plant breeding product;

[0017] The biological material can be any one of the following:

[0018] D1) a nucleic acid molecule encoding the aforementioned protein;

[0019] D2) an expression cassette containing the nucleic acid molecule of D1);

[0020] D3) a recombinant vector containing the nucleic acid molecule of D1), or a recombinant vector containing the expression cassette of D2);

[0021] D4) a recombinant microorganism containing the nucleic acid molecule of D1), or a recombinant microorganism containing the expression cassette of D2), or a recombinant microorganism containing the recombinant vector of D3);

[0022] D5) a transgenic plant cell line containing the nucleic acid molecule of D1), or a transgenic plant cell line containing the expression cassette of D2);

[0023] D6) a transgenic plant tissue containing the nucleic acid molecule of D1), or a transgenic plant tissue containing the expression cassette of D2);

[0024] D7) a transgenic plant organ containing the nucleic acid molecule of D1), or a transgenic plant organ containing the expression cassette of D2).

[0025] In the above-mentioned applications, the nucleic acid molecule of d1) can be any one of the following DNA molecules,

[0026] e1) the coding region sequence is a DNA molecule as shown in SEQ ID NO: 2,

[0027] e2) a DNA molecule hybridizing to the nucleotide sequence defined in e1) under stringent conditions and encoding the protein as described above.

[0028] The nucleic acid molecule described herein can be DNA, such as cDNA, genomic DNA or recombinant DNA; the nucleic acid molecule can also be RNA, such as gRNA, mRNA, siRNA, shRNA, sgRNA, miRNA or antisense RNA.

[0029] The vector described herein is well known to those skilled in the art, including but not limited to: plasmid, bacteriophage (such as lambda phage or M13 filamentous phage, etc.), cosmid (i.e. cos plasmid), Ti plasmid or viral vector. Specifically, it can be pUbi-pwmb110 vector.

[0030] A recombinant expression vector containing the Tasg-D3 gene can be constructed using existing plant expression vectors. The plant expression vectors include but are not limited to Agrobacterium binary vectors and vectors that can be used for plant microprojectile bombardment, etc. The plant expression vector can also contain the 3' untranslated region of the foreign gene, i.e. it contains a polyadenylation signal and any other DNA fragment involved in mRNA processing or gene expression. The polyadenylation signal can guide the addition of polyadenylate to the 3' end of the mRNA precursor, such as the 3' untranslated region of the Agrobacterium crown gall induced (Ti) plasmid gene (such as the nopaline synthase Nos gene), plant genes (such as soybean storage protein genes) have similar functions.

[0031] When constructing a recombinant plant expression vector using the Tasg-D3 gene, any one of the enhancer promoters or constitutive promoters can be added before the transcription initiation nucleotide, including but not limited to the cauliflower mosaic virus (CaMV) 35S promoter, the ubiquitin promoter of maize, which can be used alone or in combination with other plant promoters; in addition, when constructing a plant expression vector using the gene of the present application, enhancers can also be used, including translation enhancers or transcription enhancers, and these enhancer regions can be ATG start codon or adjacent regions start codon, but they must be in the same reading frame as the coding sequence to ensure correct translation of the entire sequence. The source of the translation control signal and the start codon is wide, which can be natural or synthetic. The translation initiation region can be from the transcription initiation region or the structural gene.

[0032] For the convenience of identification and screening of the transgenic plant cells or plants, the plant expression vector used can be processed, such as adding genes that can be expressed in plants, including but not limited to, genes encoding enzymes or luminescent compounds that can produce color changes (GUS genes, luciferase genes, etc.), antibiotic markers with resistance (gentamicin markers, kanamycin markers, etc.), or chemical reagent resistance marker genes (such as herbicide resistance genes), etc. For the safety of transgenic plants, no selective marker genes can be added, and the transformed plants can be directly screened under adverse conditions.

[0033] The Tasg-D3 gene or a fragment of the gene provided by the present application can be introduced into plant cells or recipient plants by using any vector that can guide the expression of foreign genes in plants, so as to obtain transgenic cell lines and transgenic plants with changed salt tolerance. The expression vector carrying the Tasg-D3 gene can be transformed into plant cells or tissues by using Ti plasmid, Ri plasmid, plant virus vector, direct DNA transformation, microinjection, electroporation, Agrobacterium-mediated transformation, etc. The transformed plant tissues are cultivated into plants.

[0034] The present application also provides a method for regulating the agronomic traits of plants, which comprises introducing the gene encoding the protein as described above into the plants of interest to regulate the agronomic traits of the plants.

[0035] The present application also provides a method for producing plants with changed agronomic traits, which comprises introducing the gene encoding the protein as described above into the plants of interest to produce plants with changed agronomic traits.

[0036] In the present application, the indicators of plant breeding can include the agronomic traits of plants. The purposes of plant breeding can include cultivating plants with changed agronomic traits.

[0037] In the present application, the agronomic traits can be grain traits and / or plant height. The grain traits can be kernel length and / or kernel weight.

[0038] In the present application, the changed agronomic traits can be shorter kernel length and / or reduced kernel weight and / or reduced plant height.

[0039] In the present application, the shorter kernel length of the recipient wheat grain can improve the flour yield of wheat, and the reduced plant height of the recipient wheat can enhance the resistance to lodging of the recipient wheat.

[0040] The kernel weight can be the weight of 100 kernels.

[0041] In the present application, the plant height can be the distance between the root and the top of the main stem of wheat during the grain filling stage.

[0042] In the above method, the protein is derived from wheat.

[0043] In the above-mentioned use or method, the plant can be any one of the following: F1) a seed plant, F2) a dicotyledon plant, F3) a Rosales plant, F4) a Poaceae plant, F5) a Triticum plant, and F6) a wheat.

[0044] In one specific embodiment of the present application, the plant of interest is a wheat plant that does not contain the protein and / or does not contain the gene encoding the protein.

[0045] The present application also provides a protein, which is the protein described above.

[0046] The present application also provides a biological material, which is the biological material described above.

[0047] In the present study, a wheat sgdp602 with reduced plant height and changed grain type was screened from the EMS mutant library of Pingan 602 (a wheat variety in Henan Province). Through gene cloning, TraesCS3D03G0288900 was determined as the target gene, and the 306th proline in the gene was mutated to leucine, which was named as Tasg-D3. The mutation resulted in changes in plant height and grain type, and caused a 22.07% reduction in thousand-grain weight. Experiments proved that introduction of the Tasg-D3 protein or its encoding gene of the present application into a recipient wheat Fielder (which does not contain the Tasg-D3 protein and its encoding gene of the present application) can reduce the plant height of the recipient wheat, enhance its resistance to lodging, and also make the grain length shorter and improve the flour yield of the wheat. BRIEF DESCRIPTION OF DRAWINGS

[0048] Figure 1 The agarose electrophoresis map for identification of T0 generation transgenic plants.

[0049] Figure 2 Comparison of plant height of wild-type Fielder and Tasg-D3 transgenic lines OE7, OE13 and OE17.

[0050] Figure 3 Comparison of grain length of wild-type Fielder and Tasg-D3 transgenic lines OE7, OE13 and OE17.

[0051] Figure 4 Comparison of ear length of wild-type Fielder and Tasg-D3 transgenic lines OE7, OE13 and OE17.

[0052] Figure 5 Comparison of thousand-grain weight of wild-type Fielder and Tasg-D3 transgenic lines OE7, OE13 and OE17. DETAILED DESCRIPTION

[0053] The following examples use GraphPad prism 9.5.1 statistical software to process the data, and the experimental results are expressed as mean ± standard deviation, using One-way ANOVA test, P<0.05 (*) indicates significant difference, P<0.01 (**) indicates extremely significant difference, P<0.001 (****) indicates extremely significant difference, P<0.0001 (****).

[0054] Example 1, obtaining and identifying of transgenic Tasg-D3 wheat

[0055] 1.1 Cloning of Tasg-D3 gene

[0056] Ethyl methanesulfonate was used to induce mutation in wheat variety PA602, and a mutant with small spike and round leaf tip was screened from the M2 plants of PA602, which was named sgdp602. It was backcrossed with PA602 and selfed to obtain F2 plants. The segregation ratio was observed in the F2 population, which was consistent with 1:2:1 (84 wild type / 170 intermediate / 87 mutant phenotype, χ 2 <χ 2 0.05,2 =5.99), which proved that the gene causing the trait of sgdp602 was caused by single gene mutation.

[0057] According to the F 2:3 According to the results of family phenotype identification, 30 homozygous F2:3 families of wild type and mutant were selected respectively, and each family had one single plant. 3 cm of the middle part of the second leaf was taken as a single plant sample. All wild type samples were mixed together to form a wild type pool, and all mutant single plant samples were mixed together to form a mutant pool, which were sent to Beijing Maimesai Biological Technology Co., Ltd. for transcriptome sequencing together with the parent samples.

[0058] The raw reads obtained by transcriptome were analyzed by BSR-seq (the software used was fastqc, fastp, STAR, picard, samtools, GATK), and SNP data were obtained. SNP-index and ED algorithm were used to analyze the SNP data. The target gene was located on 3D chromosome. The SNPs on 3D were converted into KASP markers, and a co-segregation marker K3D64687 was obtained. The gene TraesCS3D03G0288900 in which the co-segregation marker K3D64687 was located was considered as a candidate gene, which was named as Tasg-D3.

[0059] The total RNA was extracted from the second leaf of EMS mutant sgdp602 (hereinafter referred to as sgdp602) of wheat variety Pingan 0602 at the three-leaf stage, and then the first strand cDNA was reverse transcribed from the total RNA by using reverse transcriptase, thereby obtaining the cDNA of sgdp602. The DNA content of the cDNA of sgdp602 was 66 ng / μL.

[0060] The PCR amplification was performed by using the cDNA of sgdp602 as a template, primer F: 5'-CTCTAGTAGGTGTCCCCGCG-3' and primer R: 5'-CTCCTCAGGATTTAGGAGAGAGAGT-3', thereby obtaining a PCR amplification product of about 1400 bp.

[0061] The reaction system was 50 μL, which was composed of 1 μL KOD-plus-DNA polymerase, 1 μL template, 5 μL 10 x PCR buffer for KOD-plus, 5 μL dNTPs aqueous solution with a concentration of 2 mM (i.e. the concentrations of dATP, dTTP, dCTP and dGTP were all 2 mM), 2 μL MgSO4 aqueous solution with a concentration of 25 mM, 1.5 μL primer F aqueous solution with a concentration of 10 μM, 1.5 μL primer R aqueous solution with a concentration of 10 μM and 33 μL water.

[0062] The reaction condition was as follows: 98 °C pre-denaturation for 2 min; 98 °C denaturation for 30 s, 54 °C annealing for 30 s, 68 °C extension for 40 s, 35 cycles.

[0063] The obtained PCR amplification product and the vector pGEM-Teasy were ligated, thereby obtaining the recombinant plasmid pGEM-Teasy-Tasg-D3. The sequencing was performed on the recombinant plasmid pGEM-Teasy-Tasg-D3. The sequencing result showed that the recombinant plasmid pGEM-Teasy-Tasg-D3 contained the DNA molecule shown in sequence 1 in the sequence listing (hereinafter named as Tasg-D3 gene).

[0064] 1.2 Construction of recombinant plasmid pUbi::Tasg-D3-pwmb110

[0065] The PCR amplification was performed by using the recombinant plasmid pGEM-Teasy-Tasg-D3 as a template, primer 5'-CAGGTCGACTCTAGAGGATCC CCCGGG ATGGAGGCGCCGCCGGGGCC -3' (the underlined part was the enzyme digestion recognition sequence of restriction endonuclease Xam I) and primer 5'-TAGTCCATGGTACCGGATCC ACTAGTGCTCCCAGCATGGGCGAAGTTG -3' (the underlined part was the enzyme digestion recognition sequence of restriction endonuclease Spe I), thereby obtaining a PCR amplification product of about 1230 bp.

[0066] The vector pUbi-pwmb110 was double digested with restriction enzymes Xam I and Spe I, and a vector backbone of about 12.1 kb was recovered. The nucleotide sequence of pUbi-pwmb110 is SEQ ID NO: 1 (12117 bp) in the sequence listing.

[0067] The enzyme digestion product and the vector backbone were ligated to obtain the recombinant plasmid pUbi::Tasg-D3-pwmb110.

[0068] According to the sequencing results, the structure of the recombinant plasmid pUbi::Tasg-D3-pwmb110 is described as follows: pUbi::Tasg-D3-pwmb110 is a Tasg-D3 gene expression vector obtained by replacing the small fragment 5'-ATTTAAATGTCGAC-3' between the restriction enzyme Xam I and Spe I recognition sequences of the vector pUbi-pwmb110 with the DNA molecule (Tasg-D3 coding gene) shown in SEQ ID NO: 2 (1206 bp) in the sequence listing, while keeping other nucleotides of pUbi-pwmb110 unchanged.

[0069] The recombinant plasmid pUbi::Tasg-D3-pwmb110 expresses the protein shown in SEQ ID NO: 3 (401 aa) in the sequence listing (hereinafter referred to as the Tasg-D3 protein or protein Tasg-D3), which is specifically as follows: MEAPPGPEPMVLDAPPPLAAAVVPAHAATEKTRTEGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVVSLKHCFFSTTSRDELFLNLVMEYVPETLYRVLKHYSNANQRMPLIYVKLYMYQLFRGLAYVHTVPGVCHRDVKPQNVLVDPLTHQVKICDFGSAKVLVPGEPNIAYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGETAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHLWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAHSFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGPNFAHAGS.

[0070] 1.3 Obtaining of the T0 generation of wheat plants intended to be transformed with the Tasg-D3 gene

[0071] The recombinant plasmid pUbi::Tasg-D3-pwmb110 was transformed into Agrobacterium tumefaciens strain EHA105 to obtain recombinant Agrobacterium EHA105 / pUbi::Tasg-D3-pwmb110 containing the recombinant plasmid pUbi::Tasg-D3-pwmb110.

[0072] The recombinant plasmid pUbi::Tasg-D3-pwmb110 was transformed into Fielder by Agrobacterium-mediated genetic transformation to obtain T0 generation wheat plants into which the Tasg-D3 gene was introduced: the specific method is as follows: the young embryo shield of wheat Fielder (recipient) was infected with the recombinant Agrobacterium EHA105 / pUbi::Tasg-D3-pwmb110, and the embryo was transferred to induction medium for culture at 22-23°C in the dark to induce embryogenic callus. The infected embryogenic callus was then transferred to rooting medium and cultured at 22-23°C under the condition of 12h light / 12h darkness per day for 3-4 weeks to obtain T0 generation regenerated seedlings, i.e., T0 generation wheat plants into which the Tasg-D3 gene was introduced.

[0073] 1.4 Detection of T0 generation Tasg-D3 transgenic plants

[0074] Ten T0 generation transgenic wheat plants were randomly selected for PCR detection, and the specific steps are as follows:

[0075] 1. The CTAB genomic DNA extraction method was used to extract total DNA from the leaves of the 10 T0 generation transgenic wheat seedlings. The DNA content in the leaves of each T0 generation transgenic wheat was about 200 ng / μL.

[0076] 2. PCR technology was used to obtain the sequence of the fragment including Tasg-D3 and the vector tag in each T0 generation transgenic wheat. The forward primer was 5'-TCGATGCTCACCCTGTTGTTTG-3' and the reverse primer was 5'-AGACCGGCAACAGGATTCAATC-3'.

[0077] The reaction system was 20 μL, which was composed of 10 μL 2×Phanta Max Master Mix (Dye Plus), 0.5 μL forward primer with a concentration of 10 μM, 0.5 μL reverse primer with a concentration of 10 μM, 1 μL T0 generation transgenic wheat genomic DNA, and 8.0 μL ddH2O.

[0078] The reaction program was as follows: 94°C pre-denaturation for 3 min; 95°C denaturation for 3 sec, 60°C annealing for 30 sec, 35 cycles.

[0079] 3. Agarose gel electrophoresis was used to detect positive single clones.

[0080] The PCR products were subjected to agarose gel electrophoresis, and the results are shown in Figure 1 The transgenic single clones were identified by band size comparison and named OE1-OE23. The positive single clone PCR product was about 1186 bp larger than the non-positive single clone PCR product. There were 15 positive single clones, namely OE3-OE14, OE16, OE17, and OE18.

[0081] Example 2, Trait Analysis of Tasg-D3 Transgenic Plants

[0082] 2.1 Phenotypic trait analysis of Tasg-D3 transgenic plants

[0083] Wheat to be tested: The Tasg-D3 transgenic positive single clones OE7, OE13, and OE17 in Example 1 were self-pollinated, and the T1 generation seeds were harvested after maturation to obtain the corresponding Tasg-D3 transgenic lines OE7, OE13, and OE17, which were sown together with the recipient control Fielder under greenhouse potting conditions.

[0084] Wheat greenhouse potting culture conditions: culture under the conditions of temperature 25°C, light 350 μmol photons m -2 s -1 -2, humidity 70-75%, and maturation.

[0085] Observe the growth of wheat during the growth period, and randomly select 10 plants from each line for plant height measurement. The results are shown in Figure 2 . It was found that the plant height of the Tasg-D3 transgenic plants was 34.63 ± 5.65 cm, 53.87 ± 3.23 cm, and 30.03 ± 6.58 cm, respectively, which was 51.09%, 23.92%, and 57.59% lower than Fielder, with significant differences. The plant height is the distance between the root and the top of the main stem of wheat during the grain filling period.

[0086] 2.2 Grain trait detection of Tasg-D3 transgenic lines

[0087] The ear length, grain length, and thousand-grain weight of the main ear of 10 plants from each line were investigated.

[0088] Grain length statistics: After the above wheat seeds matured, the seeds harvested from a single plant were dried at 37°C for one week, and after the seeds reached a constant weight, the grain length of the Tasg-D3 transgenic wheat and the wild type Fielder was measured. At least 60 seeds from each line were measured, and the results are shown in Figure 3 . The grain length of the Tasg-D3 transgenic wheat decreased by 4.37%, 12.47%, and 5.49% compared with the wild type Fielder, showing significant differences.

[0089] Ear length statistics: After the above wheat seeds mature, the main ear length of Tasg-D3 transgenic wheat and wild type Fielder is counted, 10 single plants of each strain are measured for the main ear length, and the results are shown in Table 1. Figure 4 As shown in Table 1, the main ear length of Tasg-D3 transgenic wheat is decreased by 34.91%, 18.79% and 44.09% compared with the wild type Fielder.

[0090] Thousand seed weight statistics: After the above wheat seeds mature, the seeds harvested from a single plant are dried at 37℃ for one week, and the thousand seed weight of Tasg-D3 transgenic wheat and wild type Fielder is measured after the seeds reach a constant weight. The weight of 200 seeds is randomly measured for each strain to generate the thousand seed weight. The results are shown in Table 2. Figure 5 As shown in Table 2, the thousand seed weight of Tasg-D3 transgenic wheat is decreased by 16.39%, 29.92% and 31.2% compared with the wild type Fielder, showing a significant difference.

[0091] The above results show that the protein Tasg-D3 has important application value in regulating wheat grain traits (such as grain length, thousand seed weight, etc.) and plant height.

[0092] The above has been described in detail. For those skilled in the art, without departing from the purpose and scope of the present application, and without unnecessary experiments, the present application can be implemented in a wide range of equivalent parameters, concentrations and conditions. Although the present application gives a special example, it should be understood that further improvements can be made to the present application. In general, according to the principle of the present application, this application intends to include any change, use or improvement of the present application, including changes made by conventional techniques known in the art, which deviates from the scope disclosed in the present application.

Claims

1. Use of a protein or of a substance that modulates the expression of the gene encoding said protein or of a substance that modulates the activity or the content of said protein for modulating an agronomic trait of a plant, characterized in that, The protein is a Tasg-D3 protein, which is any one of: A1) a protein having an amino acid sequence of SEQ ID NO: 3, A2) a fusion protein obtained by linking a protein tag to the N-terminus or / and C- terminus of the protein of A1).

2. Use according to claim 1, characterized in that, The protein is derived from wheat.

3. Use according to claim 1 or 2, characterized in that, The regulation is at least one of the following six regulations: B1) regulation at the level of transcription of the encoding gene, B2) regulation after transcription of the encoding gene, B3) regulation of RNA transport of the encoding gene, B4) regulation of translation of the encoding gene, B5) regulation of mRNA degradation of the encoding gene, B6) post-translational regulation of the gene.

4. Use of a biomaterial, characterized in that, The use is any one of: C1) use of a biological material in regulating plant agronomic traits and / or in preparing a product for regulating plant agronomic traits, C2) use of the biological material in breeding plants with altered agronomic traits and / or in preparing a product for breeding plants with altered agronomic traits, C3) use of the biological material in plant breeding and / or in preparing a plant breeding product; The biological material is any one of: D1) a nucleic acid molecule encoding the protein of claim 1 or 2; D2) an expression cassette containing the nucleic acid molecule of D1); D3) a recombinant vector containing the nucleic acid molecule of D1) or containing the expression cassette of D2); D4) a recombinant microorganism containing the nucleic acid molecule of D1) or containing the expression cassette of D2) or containing the recombinant vector of D3); D5) a transgenic plant cell line containing the nucleic acid molecule of D1) or containing the expression cassette of D2); D6) a transgenic plant tissue containing the nucleic acid molecule of D1) or containing the expression cassette of D2); D7) a transgenic plant organ containing the nucleic acid molecule of D1) or containing the expression cassette of D2).

5. A method of modulating a plant agronomic trait, comprising The method comprises introducing into a plant of interest a gene encoding the protein of claim 1 or 2 to regulate plant agronomic traits.

6. A method of producing a plant with altered agronomic performance, comprising, The method comprises introducing into a plant of interest a gene encoding the protein of claim 1 or 2 to produce a plant with altered agronomic traits.

7. The method according to claim 5 or 6 or 7, characterized in that, The protein is derived from wheat.

8. Use according to claims 1-4 or method according to claims 5-7, characterized in that, The plant is any one of: F1) a seed plant, F2) a dicotyledon plant, F3) a Rosales plant, F4) a Poaceae plant, F5) a Triticum plant, F6) a wheat.

9. A protein, characterized in that, The protein is the protein of claim 1.

10. Biomaterials characterized in that, The biological material is the biological material of claim 4.

Images