Application of BnPetM gene or biological material containing BnPetM gene in regulation and control of plant photosynthesis

Abstract

The invention belongs to the technical field of plant genetic engineering, and particularly discloses application of a BnPetM gene or a biological material containing the BnPetM gene in regulation and control of plant photosynthesis. A base sequence of the BnPetM gene is a nucleotide sequence as shown in SEQ ID NO: 1, and a coded protein sequence is an amino acid sequence as shown in SEQ ID NO: 2. Research results prove that the BnPetM gene plays a positive regulation role in rape photosynthesis related traits. Transgenosis tests of the BnPetM gene in oilseed rape prove that overexpression of the gene not only greatly improves photosynthesis capacity of transgenic oilseed rape, but also improves seed yield related traits of oilseed rape families, such as plant height and oil content of seeds. Therefore, the BnPetM gene has a good application prospect in improvement of photosynthetic characters of rape and other crops.

Description

Technical Field

[0001] This invention belongs to the field of plant genetic engineering technology. Specifically, it involves the isolation, cloning, and functional verification of an important gene controlling photosynthetic traits in rapeseed. BnPetM Application in rapeseed genetic improvement. This invention involves overexpression of [a specific gene] in rapeseed. BnPetM The gene can significantly improve the photosynthetic level of transgenic rapeseed plants, confirming the important function and application value of the gene. Background Technology

[0002] Plant photosynthesis consists of two steps: photosynthetic electron transport and photosynthetic carbon assimilation. Carbon assimilation is mainly accomplished by the Kelvin cycle. The rate-limiting enzyme in this pathway, ribulose-1,6-bisphosphate carboxylase (Rubisco), also possesses oxidase activity, resulting in photorespiration, which limits its carbon assimilation efficiency as a carboxylase. Based on differences in CO2 fixation methods, carbon assimilation is mainly divided into the C3 and C4 pathways. In plants using the C3 pathway, photosynthesis primarily occurs in mesophyll cells, exhibiting strong photorespiration but low photosynthetic efficiency. Plants using the C4 pathway introduce a unique carbon concentration mechanism; high ambient CO2 concentrations inhibit Rubisco's photorespiration, thus enabling highly efficient photosynthesis.

[0003] Based on the photosynthetic process, the photosynthetic capacity of plants can be enhanced by improving the efficiency of light energy absorption and utilization and CO2 fixation. Previous studies have mainly focused on improving plant photosynthetic capacity through methods such as optimizing the enzyme activity characteristics of Rubisco, enhancing its activity and carboxylation capacity, and inhibiting its photorespiration; introducing C4 photosynthetic pathway components into C3 crops; and utilizing photoprotection to rapidly restore and improve plant canopy structure (Murchie et al., 2009; Evans, 2013). Valuable progress has been made in optimizing the enzyme activity characteristics of Rubisco. Transgenic tobacco plants infused with Rubisco structural subunit genes and their assembly chaperone genes or carboxysosome protein genes from cyanobacteria can significantly enhance Rubisco's carboxylation capacity and form carboxysosome-like structures within the cells; however, these transgenic tobacco plants require high CO2 concentrations to survive (Line et al., 2014). Improving photosynthetic efficiency by introducing the C4 photosynthetic pathway into C3 crops remains a long-term goal. Simply introducing key enzyme genes from the C4 pathway into C3 crops has not yielded the desired effect of increased photosynthetic capacity. Numerous domestic and international studies have attempted to introduce genes encoding key enzymes of the C4 photosynthetic carbon fixation pathway, such as phosphoenolpyruvate carboxylase (PEPC), malate dehydrogenase (NADP-MDH), malate enzyme (NADP-ME), and phosphopyruvate dikinase (PPDK), into C3 crops like rice, wheat, potatoes, and tobacco (Häusler et al., 2002; Covshoff and Hibberd, 2012). While some transgenic progeny families showed increased enzyme activity, the photosynthetic efficiency and yield of most transgenic materials did not change significantly. These studies indicate that the expression of photosynthetic genes and enzyme activities, as well as the allocation of photosynthetic products, in C3 crops are quite complex. However, the biochemical and molecular regulatory mechanisms of the photosynthetic pathway in crops remain poorly understood.

[0004] Rapeseed is one of the most important oilseed crops, and its rapeseed oil accounts for half of my country's edible vegetable oil supply. Currently, there are many shortcomings in the research and understanding of rapeseed's photosynthetic traits. Therefore, in-depth research on the regulatory genes of rapeseed's photosynthetic traits is of great significance for promoting the development of high-oil-yield and high-yield rapeseed. Summary of the Invention

[0005] The present invention relates to a photosynthetic regulatory gene. BnPetM or contain BnPetM Application of gene-based biomaterials in enhancing plant photosynthetic capacity. This invention isolates and applies a biomaterial containing... BnPetM A DNA fragment of a gene that confers an enhancement of the photosynthetic level-related trait in rapeseed. The present invention isolates and clones... BnPetMThe nucleotide sequence of the gene is shown in SEQ ID NO: 1, which is 673 bp in length. Its corresponding amino acid sequence is shown in SEQ ID NO: 2, and the protein is 123 amino acids in length.

[0006] The specific technical solution provided by this invention is as follows: In a first aspect, the present invention provides a BnPetM Genes or containing BnPetM Application of genetic biomaterials in regulating plant photosynthesis.

[0007] In a preferred embodiment of the present invention, the plant is rapeseed.

[0008] As a preferred embodiment of the present invention, by overexpressing the... BnPetM Genes are used to enhance a plant's photosynthetic capacity.

[0009] More preferably, by overexpressing the BnPetM Genes can be used to increase rapeseed plant height, main inflorescence length, seed oil content, or seed yield.

[0010] As a preferred embodiment of the present invention, it includes BnPetM Gene-containing biological materials are BnPetM Gene overexpression vectors or recombinant bacteria.

[0011] More preferably, the construction process of the overexpression vector is as follows: Using rapeseed tissue cDNA obtained by reverse transcription as a template, primers were designed and PCR amplification was performed to obtain cDNA containing... BnPetM cDNA fragments of the complete coding region of a gene; The inclusion BnPetM The cDNA fragment of the complete coding region of the gene was ligated into the intermediate vector pENTR / SD / D-TOPO using the TOPO cloning method. After positive identification, the obtained vector plasmid was ligated into the expression vector pEarleyGate101 via LR recombination to obtain the overexpression vector.

[0012] More preferably, the PCR amplification conditions are: 94 °C pre-denaturation for 1 min; 94 °C for 30 sec, 56 °C for 30 sec, 72 °C for 30 sec, 30 cycles; 72 °C extension for 5 min.

[0013] More preferably, the primer sequence is: Upstream primer BnPetMF: 5'-TCGTTAGTGGCTGTGGCA-3'; Downstream primer BnPetMR: 5'- TACCGTTTGATCAGTGAGGAT-3'.

[0014] In a second aspect, the present invention provides a method for cultivating plants with enhanced photosynthetic capacity, comprising the following steps: Construct the BnPetM Gene overexpression vectors; The overexpression vector was introduced into Agrobacterium to obtain an infection solution; Plant tissues are infected with the aforementioned infection solution, co-cultured, screened, and cultivated to obtain... BnPetM Transgenic plants with increased gene expression levels.

[0015] In a preferred embodiment of the present invention, the plant is rapeseed.

[0016] More preferably, the infection is performed by infecting the hypocotyl of sterile rapeseed seedlings with the infection solution.

[0017] More preferably, the infection time is 20 minutes.

[0018] Compared with the prior art, the beneficial effects of the present invention are as follows: This invention is the first discovery BnPetM Genes play a positive regulatory role in the photosynthetic-related traits of rapeseed. BnPetM Transgenic experiments with this gene in rapeseed have confirmed that overexpression of this gene not only significantly improves the photosynthetic capacity of transgenic rapeseed, but also enhances seed yield-related traits such as plant height and seed oil content in rapeseed families. Therefore, BnPetM Genes have promising applications in improving photosynthetic traits in rapeseed and other crops.

[0019] The present invention can be used BnPetM Gene expression vectors are used to transform hosts in a variety of plants, including rapeseed, to cultivate plant varieties with enhanced photosynthetic capacity. Attached Figure Description

[0020] Sequence Listing SEQ ID NO:1 is the sequence of clones isolated and cloned in this invention, containing... BnPetM The nucleotide sequence of the gene is 673 bp in length; the coding region is 165–536 bp in length and 372 bp in length.

[0021] Sequence Listing SEQ ID NO:2 is BnPetM The gene encodes a protein sequence that contains a total of 123 amino acids.

[0022] Figure 1 pEarleyGate101- is a modified pEarleyGate101 carrier as its framework. BnPetM Plasmid map and construction process diagram of overexpression vector.

[0023] Figure 2yes BnPetM Analysis of photosynthetic electron transport and chlorophyll fluorescence indices in overexpressing plants during the seedling stage. A represents... BnPetM Chlorophyll fluorescence imaging analysis of overexpressing plants during the seedling stage. B, C, and D are... BnPetM Analysis of photosynthetic electron transport and chlorophyll fluorescence parameters in overexpressing plants during seedling stage. In the figure: ZS6, wild-type control; BnPetM-1, BnPetM-7, BnPetM-11, BnPetM-15, and BnPetM-18 are BnPetM overexpressing plant families. ETR, relative electron transport rate. Fv / Fm, photochemical catalytic efficiency. NPQ, non-photochemical quenching. 5 replicates. "*" indicates student. t Test P Values ​​less than 0.05 indicate significant differences; "**" represents students. t Test P The value is less than 0.01, indicating a highly significant difference.

[0024] Figure 3 yes BnPetM Analysis of photosynthetic parameters of overexpressing plants during the seedling stage in the field. In the figure: ZS6 is the wild-type control; BnPetM-1, BnPetM-7, BnPetM-11, BnPetM-15, BnPetM-18, and BnPetM-19 are families of BnPetM overexpressing plants. NPR is net photosynthetic rate. Tmmol is transpiration rate. Five replicates were performed. "*" indicates a student. t Test P Values ​​less than 0.05 indicate significant differences; "**" represents students. t Test P The value is less than 0.01, indicating a highly significant difference.

[0025] Figure 4 yes BnPetM Identification of phenotypic and seed yield-related traits of overexpressing plants at the field growth stage. In the figure: ZS6 is the wild-type control; BnPetM-1, BnPetM-7, and BnPetM-11 are families of BnPetM overexpressing plants. 10 replicates. "*" indicates student. t Test P Values ​​less than 0.05 indicate significant differences; "**" represents students. t Test P The value is less than 0.01, indicating a highly significant difference. Detailed Implementation

[0026] The following embodiments define the present invention and describe its application in cloning containing... BnPetM DNA fragments of the complete coding region of the gene, and verification BnPetMMethods for gene function. Based on the following description and these embodiments, those skilled in the art can determine the essential features of the invention, and various changes and modifications can be made to the invention to suit different uses and conditions without departing from the spirit and scope of the invention.

[0027] This invention clones genes from rapeseed. BnPetM The study discovered that this gene positively regulates photosynthetic traits in rapeseed and identified its biological function in improving rapeseed's photosynthetic capacity. This discovery will play an important role in deepening our understanding of the molecular mechanisms of rapeseed photosynthetic regulation and in improving the photosynthetic efficiency of rapeseed and other crops.

[0028] 1. BnPetM Construction and genetic transformation of gene overexpression vectors In order to analyze BnPetM To investigate the function of the gene, this invention overexpresses it in wild-type rapeseed and studies the biological function of the gene by examining the phenotype of the transgenic plants.

[0029] The method for constructing overexpression vectors is as follows: First, obtain the genome annotation information by searching the NCBI genome annotation website (https: / / www.ncbi.nlm.nih.gov / ). BnPetM Gene annotation number: BnaA09g40450D. Amplification primers were designed based on this gene sequence.

[0030] Using leaf cDNA of “Zhongshuang 11 (ZS11)” (a publicly used rapeseed variety bred by the Oil Crops Research Institute of the Chinese Academy of Agricultural Sciences) obtained by reverse transcription as a template, the following amplification was performed using upstream primer BnPetMF (5'-TCGTTAGTGGCTGTGGCA-3', SEQ ID NO: 3, sequence-specific primer with TOPO cloning adapter at the 5' end) and downstream primer BnPetMR (5'-TACCGTTTGATCAGTGAGGAT-3', SEQ ID NO: 4, sequence-specific primer with TOPO cloning adapter at the 5' end). BnPetM The nucleotide sequence (165–536 bp) of the amplified cDNA fragment of the complete coding region of the gene is as follows: BnPetM The cDNA sequence is shown in SEQ ID NO: 1: (the coding region is located at bases 165 to 536). TCCTATCTATCTCGTCGTTAGTGGCTGTGGCAGCCACACCCACCTTATCCGCAATCTCCTATTTCTCTAAAATATAAAGCTTCCCTTCTTTTGCTTCTCTACTTGAGTCGACCCACTTTCTGTTGCATCCTTCAAAACTTAATTCATTAGCAAAAAGGA ATGGCTACAGCAGCGGCGCCGGCGGTGGTTGCATGGACAAGAACGGGAACTGCGTTCAA GTCCGGACAGGCACAGATGAAATCGGAGATGAAAGTTTCTTACGTAAGAGGACTAAATTCTTACGGTGGTCTCAAGG CACAGAACAACAAGGTTGTCTCTATGGGATTACCAGTCTGCACCGAACAGTGCTTTGCAAACGTCGTGATGTCTCTC AAAGGACGCACAAGTCGTGGAGGAGCATTGACCTCGACCTGTAACGCGGTCGGAGAGATTTTCAAGATTGCAGCAAT CATGAACGCTCTTACTCTCGTTGGCGTTGCGGTTGGATTCGTTCTCCTTCGAATCGAAGCTTCTGTTGAGGAAGCTG AGTAA ATAGATTGAGGAATCCTTTTTCTTATATTATTATTATATTGTTGTTGTCAAGCTTGGATGCATTATATGACATTTGTTTATGATGAAGCTCTTTTGTTCTTGGAATCCTCACTGATCAAACGGTACTTTTTTTTTTG The BnPetM protein sequence is shown in SEQ ID NO: 2: MATAAAPAVVAWTRTGTAFKSGQAQMKSEMKVSYVRGLNSYGGLKAQNNKVVSMGLPVCTEQCFANVVMSLKGRTSRGGALTSTCNAVGEIFKIAAIMNALTLVGVAVGFVLLRIEASVEEAE The PCR reaction conditions were as follows: 94 °C pre-denaturation for 1 min; 30 cycles of 94 °C for 30 sec, 56 °C for 30 sec, and 72 °C for 30 sec; extension at 72 °C for 5 min.

[0031] The PCR reaction system consisted of: 2 μL 10×PCR amplification buffer, 1.5 μL MgCl2 (1.5 mmol / L), 2 μL dNTPs (200 μmol / L), 0.2 μg template DNA, 0.5 μL BnPetMF / R primer pair (10 pmol / L), and 0.2 μL Taq DNA polymerase.

[0032] The amplified PCR products were ligated into the intermediate vector pENTR / SD / D-TOPO using the TOPO cloning method (see...). Figure 1After positive identification, the obtained vector plasmid was ligated into the final expression vector pEarleyGate101 via LR recombination, driven by a constitutive 35S promoter, with the BnPetM terminus fused to the EYFP and HA tags in a reading frame. The vector was then transformed into *E. coli* and positive clones were screened. The final overexpression plasmid vector was named pEarleyGate101- BnPetM ,See Figure 1 .

[0033] The modified pEarleyGate101- was transformed into rapeseed using Agrobacterium-mediated genetic transformation. BnPetM The overexpression vector was transferred into the rapeseed variety "Zhongshuang 6 (ZS6)" (a publicly used rapeseed variety bred by the Oil Crops Research Institute of the Chinese Academy of Agricultural Sciences). After infection, co-culture, screening for Basta-resistant callus, differentiation, rooting, hardening-off, and transplanting, transgenic plants were obtained. The specific rapeseed genetic transformation steps are as follows:

[0034] (1) Seed sterilization: Soak rapeseed ZS6 seeds in 75% alcohol for 1 minute, rinse once with sterile water, then soak in 84 disinfectant for 15 minutes, and rinse the seeds with sterile water 3-5 times, 1 minute each time.

[0035] (2) Aseptic seedling culture: Sterilized seeds were sown into MO medium (2.2 g / L MS, 7.5 g / L Agar, pH 6.0), about 40 seeds per bottle, and incubated in the dark at 24°C for 5-6 days.

[0036] (3) Inoculation culture: One day before infection and transformation, the substance containing pEarleyGate101- BnPetM Agrobacterium strains to be transfected with the overexpression vector plasmid were inoculated into 20 mL LB liquid medium and cultured at 28 °C and 200 rpm.

[0037] (4) Rapeseed infection and transformation: Cut the hypocotyl of the cultured sterile rapeseed seedlings to a length of approximately 7-10 mm; then add 20 mL of the prepared Agrobacterium tumefaciens solution (OD200). 600 Centrifuge at approximately 0.6 g / L to remove supernatant, add an equal volume of suspension medium (4.4 g / L MS, 30 g / L sucrose, pH 6.0) to resuspend, and inoculate the cut hypocotyls in the medium for 20 min.

[0038] (5) Co-cultivation: Use sterile filter paper to absorb any excess residual bacterial solution from the outside of the hypocotyl. Place the infected hypocotyl on M1 medium (4.4 g / L MS, 30 g / L sucrose, 18 g / L mannitol, 1 mg / L 2,4-D, 0.3 mg / L KT, 100 μM AS, 7.5 g / L Agar, pH 6.0) and incubate in the dark at 24°C for 2 days.

[0039] (6) Callus selection and culture: The hypocotyls were transferred to M2 medium (4.4 g / L MS, 30 g / L sucrose, 18 g / L mannitol, 1 mg / L 2,4-D, 0.3 mg / L KT, 150 μL / L STS (0.1 M Na2SO3:0.1 M AgNO3 = 4:1), 300 mg / L TMT, Basta, 7.5 g / L Gar, pH 6.0) and cultured under light for three weeks (24°C, 16 h light / 8 h dark).

[0040] (7) Callus succession and differentiation: The hypocotyls were then transferred to M3 medium (4.4 g / L MS, 10 g / L glucose, 0.25 g / L xylose, 0.6 g / L LMES, 2 mg / L ZT, 0.1 mg / L IAA, 300 mg / L TMT, Basta, 7.5 g / L Agar, pH 6.0) and cultured under light (24℃, 16 h light / 8 h dark), with fresh medium changed every two weeks.

[0041] (8) Rooting culture: When the differentiated shoots reach about 2cm in length, cut them off and transfer them to M4 medium (3.21g / L B5, 30g / L sucrose, 7.5g / L Agar, pH 6.0). Once they have developed a relatively well-developed root system in the M4 medium, they can be transplanted into soil for further growth.

[0042] 2. BnPetM Identification of photosynthetic capacity of transgenic families with overexpressed genes in the field during seedling stage BnPetM Gene overexpression transgenic families and control ZS6 were planted in the field at the Hanchuan transgenic base. When the seedlings grew to the 6-leaf stage, the chlorophyll fluorescence and photosynthesis of the fully expanded third leaf from the top were measured and analyzed.

[0043] The specific methods for measuring photosynthetic traits and physiological parameters are as follows: The Li-6800 photosynthesis measuring instrument is equipped with an independent leaf chamber, which can directly measure physiological indicators such as net photosynthetic rate, transpiration rate, stomatal conductance, and intercellular CO2 concentration of rapeseed experimental materials in the field; the PAM-2500 portable modulated chlorophyll fluorescence spectrometer is used to measure specific parameters of the photosystem of experimental materials, including fluorescence yield (F) and maximum fluorescence (Fm), photosynthetic quantum yield (ΔF / Fm), fluorescence quenching analysis (qP, qN, and NPQ), and light response curves; the Imaging-PAM MAXI modulated chlorophyll fluorescence imaging spectrometer is used for chlorophyll fluorescence imaging analysis of experimental materials.

[0044] During the light-dependent photosynthetic reaction stage, this invention utilized a chlorophyll fluorescence analyzer to analyze the in vivo photosynthetic photoelectron transfer process in the leaves of transgenic rapeseed families. The results showed that, compared to the ZS6 wild-type family, BnPetM The photosynthetic electron transport rate was significantly increased in gene overexpression families, with the maximum relative electron transport rate ETRmax (57.93 electrons / (PSII⋅ s)) being on average 41% higher than that of the control family (41.05 electrons / (PSII⋅ s)). Figure 2 Meanwhile, its non-photochemical quenching NPQ (0.49) was significantly lower than that of the control (0.55), indicating that... BnPetM Gene overexpression significantly improved the photosynthetic electron utilization efficiency of transgenic rapeseed, while reducing energy dissipation losses from non-photosynthetic chemistry.

[0045] The results of photosynthetic parameter measurements during the dark reaction phase showed that BnPetM The photosynthetic carbon assimilation efficiency of gene overexpression families was also significantly enhanced. Compared with the control family, the transpiration rate of the overexpression family was 8.63 µmol / m³. 2 / s, control was 5.60µmol / m 2 The water vapor exchange rate (VPS) also increased significantly, indicating a marked enhancement in its water vapor exchange rate. Its core photosynthetic output index, net photosynthetic rate (NPR), was 11.76 µmol / m³. 2 / s) compared to wild type (8.61 µmol / m 2 The average increase was 36%, with a maximum increase of 55% (13.39 µmol / m²). 2 / s; Figure 3 ).

[0046] The above results demonstrate overexpression BnPetM The gene can significantly enhance the photosynthetic level of rapeseed, indicating that BnPetM Gene overexpression significantly improved the photosynthetic efficiency of transgenic rapeseed in both the light and dark reaction stages.

[0047] 3. BnPetMIdentification of field phenotype and seed yield-related traits in adult transgenic families with overexpressed genes Given BnPetM The photosynthetic level of gene overexpression families was significantly improved during the seedling stage. This invention conducted a detailed analysis of the phenotypic and seed yield-related traits of these families at field harvest. Field testing results at the mature plant stage showed that ( Figure 4 ), BnPetM The plant height (140.0 cm) and main inflorescence length (69.0 cm) of the overexpression family were both more than 10% higher than those of the control ZS6 (plant height 121.4 cm, main inflorescence length 56.2 cm). Simultaneously, the seed oil content (37.29% in the overexpression family, 34.19% in the control) was also more than 5% higher, indicating that… BnPetM Gene overexpression enhances photosynthesis and also improves seed yield-related traits.

[0048] In summary, this invention discovered through functional identification that BnPetM The overexpression family showed superior photosynthetic capacity and field trait performance compared to the control ZS6, revealing BnPetM Gene expression levels are significantly correlated with the photosynthetic capacity of rapeseed. Furthermore, the results of this invention indicate that... BnPetM The gene positively regulates the photosynthetic trait of rapeseed and plays an important role in improving the related traits of photosynthesis and seed yield. This discovery will be of great significance for deepening the understanding of the photosynthetic regulation mechanism of rapeseed and for the improvement of photosynthesis and high-yield breeding of rapeseed and other crops.

Claims

1. A kind BnPetM Genes or containing BnPetM The application of gene-based biomaterials in regulating plant photosynthesis is characterized by, The BnPetM The nucleotide sequence of the gene is shown as SEQ ID NO:

1.

2. Use according to claim 1, characterized in that, The plant is Brassica napus.

3. Use according to claim 2, characterized in that, By overexpressing the BnPetM gene to enhance photosynthetic capacity of Brassica napus.

4. Use according to claim 3, characterized in that, by overexpressing said BnPetM genes to increase the plant height, the length of the main inflorescence, the seed oil content or the seed yield of Brassica napus.

5. The use according to claim 1, characterized in that, Biological materials containing BnPetM genes are overexpression vectors or recombinant bacteria containing BnPetM genes.

6. Use according to claim 5, characterized in that, The construction process of the overexpression vector is as follows: The cDNA of the rape tissue obtained by reverse transcription is used as a template, a primer is designed and PCR amplification is performed to obtain a cDNA fragment containing the complete coding region of the gene. BnPetM the complete coding region of the gene. The method comprises the following steps: BnPetM The cDNA fragment of the complete coding region of the gene is connected to the intermediate vector pENTR / SD / D-TOPO by a TOPO cloning method, and the obtained vector plasmid is positively identified and then connected to the expression vector pEarleyGate101 by an LR recombination reaction to obtain the overexpression vector.

7. Use according to claim 6, characterized in that, The PCR amplification conditions are as follows: pre-denaturation at 94 ℃ for 1 min; 30 cycles of 94 ℃ for 30 sec, 56 ℃ for 30 sec, 72 ℃ for 30 sec, and extension at 72 ℃ for 5 min.

8. Use according to claim 6, characterized in that, The primer sequences are as follows: The upstream primer BnPetMF is 5'-TCGTTAGTGGCTGTGGCA-3'; The downstream primer BnPetMR is 5'-TACCGTTTGATCAGTGAGGAT-3'.

9. A method of breeding a plant with enhanced photosynthetic capacity, comprising, The method comprises the following steps: Construct according to claim 1 BnPetM overexpression vector of the gene; The overexpression vector is introduced into Agrobacterium to obtain an infection solution; The plant tissue is infected with the infection solution, co-cultured, screened, and cultivated to obtain the transgenic plant BnPetM The transgenic plant with increased expression of the gene.

10. The method of claim 9, wherein, The infection is performed by using the infection solution to infect hypocotyls of Brassica napus sterile seedlings.

Images