Anti-aging composition containing rGDF11 as well as preparation method and application of anti-aging composition

Abstract

The invention belongs to the technical field of cosmetics, and particularly relates to an anti-aging composition containing rGDF11 as well as a preparation method and application of the anti-aging composition. The anti-aging composition provided by the invention is prepared from various active ingredients such as rGDF11, acetyl hexapeptide-8, glucomannan / chitosan nanoparticles, tween-20, a grape seed extract, a garden burnet root extract and pearl powder. In the composition provided by the invention, the rGDF11 and the acetyl hexapeptide can regulate and improve the aging symptoms of an organism in two aspects of internal tissues and skin tissues, and particularly have very obvious effects on middle-aged and elderly people. The anti-aging composition disclosed by the invention is applied to a freeze-dried product, so that the activity of each substance can be better maintained, and the action effect is prolonged.

Description

Technical Field

[0001] The present invention belongs to the technical field of cosmetics, and particularly relates to an anti-aging composition containing rGDF11, a preparation method thereof, and applications thereof. Background Art

[0002] Growth differentiation factor (GDF11), also known as bone morphogenetic protein 11 (BMP11), belongs to the transforming growth factor-β (TGF-β) superfamily and was first reported in 1999 as a new growth differentiation factor. The GDF11 gene is located on human chromosome 12q13.2. GDF11 is expressed in embryonic tissues, including the tail bud, limbs, and nervous system, as well as adult tissues such as the spinal cord, olfactory system, dental pulp, skeletal muscle, spleen, pancreas, intestine, kidney, brain, heart, and blood. It has been determined that GDF11 plays an important role in the development of bone, skeletal muscle, nervous system, digestive glands, and urogenital system.

[0003] In addition, the symptoms of aging are not only manifested on the surface of the skin, but also the aging of the body includes the aging of tissues and organs, such as the aging of heart function, the decline of cognitive ability, and the degeneration of skeletal muscle. In 2013, it was found that GDF11 can significantly improve the aging of the myocardium and skeletal muscle, has an obvious anti-aging effect, and can improve and reverse the symptoms of body aging to a certain extent. This anti-aging effect has made GDF11 a current research hotspot.

[0004] Based on this, Chinese Patent Application CN109069588A discloses a composition containing GDF11 and its applications. The composition can be used to improve wrinkles, regenerate skin, etc. The composition contains GDF11, but it adds GDF11 to the culture medium, and the technical effects of GDF11 are demonstrated by culturing cells. Whether GDF11 can be used in the preparation of skin care products is still undetermined in the prior art, and there are no related applications. Summary of the Invention

[0005] Aiming at the defects commonly existing in the prior art, the present invention provides an anti-aging composition containing rGDF11, a preparation method thereof, and applications thereof. The composition provided by the present invention can regulate and improve the symptoms of body aging in both internal tissues and skin tissues, and the preparation process is simple, and the skin care cost is low.

[0006] In order to achieve the above object, the technical solution adopted by the present invention is as follows:

[0007] An anti-aging composition, comprising the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, water; wherein, the final concentration of rGDF11 is 40-60 ng / mL, the final concentration of acetyl hexapeptide-8 is 40-260 ppm, the final concentration of chitosan nanoparticles is 80-200 μg / mL, the final concentration of Tween-20 is 0.05-0.1 μg / mL, the final concentration of grape seed extract is 0.01-0.02 μg / mL, the final concentration of sanguisorba officinalis extract is 0.05-0.07 μg / mL, pearl powder 10-50 ng / mL, sodium alginate 100-300 ng / mL.

[0008] Preferably, the final concentrations of each component are as follows: the final concentration of rGDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, pearl powder 30 ng / mL, sodium alginate 200 ng / mL.

[0009] Preferably, the amino acid sequence of the rGDF11 is as shown in SEQ ID NO.1.

[0010] SESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS(SEQ ID NO.1).

[0011] Preferably, the addition ratio of the grape seed extract to the sanguisorba officinalis extract is in the range of 1-3:3-5.

[0012] Preferably, the preparation process of the chitosan nanoparticles is as follows: Dissolve chitosan in water to prepare a 0.5 g / L solution, a total of 3 mL is prepared, and then slowly add a 0.3 g / L sodium tripolyphosphate aqueous solution thereto, and slowly stir with a glass rod at 24 °C, and collect the transparent colloid to obtain it.

[0013] The present invention also provides a preparation method of the anti-aging composition, comprising the following steps:

[0014] S1. Mix rGDF11, acetyl hexapeptide-8, and chitosan nanoparticles, add 500-800 μL of water to dissolve, heat up to 55-60 °C, and then add Tween-20 thereto, stir and mix evenly to obtain mixture I;

[0015] S2. Mix grape seed extract and sanguisorba officinalis extract, add 300 - 500 μL of water to dissolve, heat up to 40 - 50 °C, mix and stir evenly to obtain Mixture II.

[0016] S3. Add pearl powder and sodium alginate to the Mixture II obtained in Step S2 and mix evenly, then cool down to 25 - 30 °C, add the Mixture I obtained in Step S1 thereto, make up the volume to 10 mL with water, mix and stir evenly, and concentrate at -10 - -5 °C to obtain the product.

[0017] Preferably, the condition for mixing and stirring evenly in Step S1 is to stir at a rotation speed of 500 - 800 rpm for 30 - 40 min, the mixing and stirring evenly in Step S2 is to stir at a rotation speed of 800 - 1000 rpm for 10 - 15 min, and the mixing and stirring evenly in Step S3 is to mix and stir at a rotation speed of 500 - 600 rpm for 20 - 30 min.

[0018] The present invention also provides an application of the anti-aging composition in the preparation of freeze-dried products.

[0019] Preferably, the freeze-dried products include freeze-dried facial masks and freeze-dried powders.

[0020] Preferably, the addition amount of the anti-aging composition in the freeze-dried products is 2 - 5%.

[0021] In the present invention, after truncating GDF11 to select rGDF11, it can still improve the anti-ultraviolet damage ability of cells, inhibit skin inflammation and wrinkle formation caused by photoaging, has a moisturizing effect after photoaging, and the effect is stronger than that of full-length GDF11.

[0022] In the present invention, by adding two active ingredients, rGDF11 and acetyl hexapeptide-8, simultaneously, it can effectively alleviate the degradation of aging skeletal muscle and the effect on epidermal tissue, delay aging. Moreover, when used in the composition, the inventor attaches these two active ingredients to nanoparticles, so that the functional activities of rGDF11 and acetyl hexapeptide-8 can be maintained for a long time. When used in product preparation, using the anti-aging composition of the present invention in freeze-dried products helps to further ensure the activities of these two functional ingredients and helps to prevent facial aging collapse, skin relaxation and deep wrinkles.

[0023] Meanwhile, the addition of Tween-20 helps to fully dissolve each component and prevent the loss of active ingredients. The combined use of grape seed extract and sanguisorba officinalis extract can further improve the anti-aging effect of the composition and also inhibit the growth of bacteria, preventing the skin from getting acne due to bacterial infection when applying skin care products containing the composition on the skin during use. The addition of a small amount of pearl powder effectively improves the anti-aging function and antibacterial effect of the anti-aging composition.

[0024] Compared with the prior art, the anti-aging composition provided by the present invention has the following advantages:

[0025] (1) For the anti-aging composition provided by the present invention, rGDF11 and acetyl hexapeptide-8 are used in combination to achieve the effects of preventing skin aging and deepening of wrinkles;

[0026] (2) For the anti-aging composition provided by the present invention, grape seed extract, sanguisorba extract and pearl powder are added at the same time. These components are used in combination with rGDF11 and acetyl hexapeptide-8. On the basis of improving the anti-aging function of the composition, it can effectively inhibit the growth of bacteria and prevent adverse effects on the skin;

[0027] (3) For the anti-aging composition provided by the present invention, the preparation process is simple and the cost is low. It can be used for the preparation of freeze-dried products, which is beneficial to maintaining the activity of each functional component. Detailed implementation mode

[0028] The present invention will be further explained below with reference to specific embodiments. However, it should be noted that the following embodiments are only used to explain the present invention and cannot be used to limit the present invention. All technical solutions identical or similar to the present invention are within the protection scope of the present invention. For those not specifying specific techniques or conditions in this embodiment, operations shall be performed according to the conventional technical methods and instrument instruction manuals in the art; for those reagents or instruments not specifying the manufacturer, they are all conventional products that can be obtained through commercial purchase.

[0029] The acetyl hexapeptide-8 can be purchased from Hubei Bojie Biotechnology Co., Ltd., with the CAS number 616204-22-9; the GDF11 can be purchased from Shanghai Kanglang Biotechnology Co., Ltd., with the product number KL11365RP; the grape seed extract can be purchased from Shaanxi Bolin Biotechnology Co., Ltd., with the extraction source being grape seeds and the product specification being 10:1; the sanguisorba extract can be purchased from Shaanxi Bolin Biotechnology Co., Ltd., with the extraction source being the dried root of sanguisorba and the product specification being 10:1.

[0030] Example 1 An anti-aging composition

[0031] The anti-aging composition comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 40 ng / mL, the final concentration of acetyl hexapeptide-8 is 40 ppm, the final concentration of glucomannan / chitosan nanoparticles is 80 μg / mL, the final concentration of Tween-20 is 0.05 μg / mL, the final concentration of grape seed extract is 0.01 μg / mL, the final concentration of sanguisorba officinalis extract is 0.05 μg / mL, the pearl powder is 10 ng / mL, and the sodium alginate is 100 ng / mL; the preparation process of the chitosan nanoparticles is as follows: chitosan is added to water and dissolved to prepare a 0.5 g / L solution with a total of 3 mL prepared, then an aqueous solution of 0.3 g / L sodium tripolyphosphate is slowly added thereto, and it is slowly stirred with a glass rod at 24 °C, and the transparent colloid is collected to obtain the product.

[0032] The preparation method of the anti-aging composition comprises the following steps:

[0033] S1. rGDF11, acetyl hexapeptide-8, and chitosan nanoparticles are mixed and dissolved in 500 μL of water, and the temperature is raised to 55 °C, then Tween-20 is added thereto, and it is stirred at a rotation speed of 500 rpm for 30 min and stirred and mixed evenly to obtain mixture I;

[0034] S2. The grape seed extract and the sanguisorba officinalis extract are mixed, dissolved in 300 μL of water, the temperature is raised to 40 °C, and it is stirred at a rotation speed of 800 rpm for 10 min and stirred and mixed evenly to obtain mixture II;

[0035] S3. Pearl powder and sodium alginate are added to the mixture II obtained in step S2 and mixed evenly, then the temperature is lowered to 25 °C, the mixture I obtained in step S1 is added thereto, water is added to make up the volume to 10 mL, and it is mixed and stirred at a rotation speed of 500 rpm for 20 min and stirred and mixed evenly, and it is concentrated at -10 °C to obtain the product.

[0036] Example 2 An anti-aging composition

[0037] The anti-aging combination comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 60 ng / mL, the final concentration of acetyl hexapeptide-8 is 260 ppm, the final concentration of glucomannan / chitosan nanoparticles is 200 μg / mL, the final concentration of Tween-20 is 0.1 μg / mL, the final concentration of grape seed extract is 0.02 μg / mL, the final concentration of sanguisorba officinalis extract is 0.07 μg / mL, the pearl powder is 50 ng / mL, and the sodium alginate is 300 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0038] The preparation method of the anti-aging composition comprises the following steps:

[0039] S1. Mix rGDF11, acetyl hexapeptide-8, and chitosan nanoparticles, dissolve them in 800 μL of water, heat up to 60 °C, then add Tween-20 thereto, and stir at a speed of 800 rpm for 40 min, and stir and mix evenly to obtain Mixture I;

[0040] S2. Mix the grape seed extract and the sanguisorba officinalis extract, dissolve them in 500 μL of water, heat up to 50 °C, and stir at a speed of 1000 rpm for 15 min, and stir and mix evenly to obtain Mixture II;

[0041] S3. Add pearl powder and sodium alginate to the Mixture II obtained in Step S2 and mix evenly, then cool down to 30 °C, add the Mixture I obtained in Step S1 thereto, make up the volume to 10 mL with water, and stir and mix at a speed of 550 rpm for 25 min, and stir and mix evenly, and concentrate at -5 °C to obtain the product.

[0042] Example 3 An anti-aging composition

[0043] The anti-aging composition comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, the pearl powder is 30 ng / mL, and the sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0044] The preparation method of the anti-aging composition comprises the following steps:

[0045] S1. Mix rGDF11, acetyl hexapeptide-8, and chitosan nanoparticles, dissolve them in 650 μL of water, heat the solution to 57 °C, then add Tween-20 to it, and stir at a speed of 650 rpm for 35 min until well mixed to obtain Mixture I.

[0046] S2. Mix grape seed extract and sanguisorba officinalis extract, dissolve them in 400 μL of water, heat the solution to 45 °C, and stir at a speed of 900 rpm for 13 min until well mixed to obtain Mixture II.

[0047] S3. Add pearl powder and sodium alginate to the Mixture II obtained in Step S2 and mix well, then cool the temperature to 28 °C, add the Mixture I obtained in Step S1 to it, make up the volume to 10 mL with water, and stir at a speed of 550 rpm for 25 min until well mixed, and then concentrate it at -7 °C to obtain the product.

[0048] Comparative Example 1 An anti-aging composition

[0049] The anti-aging composition comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, the concentration of pearl powder is 30 ng / mL, and the concentration of sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1.

[0050] The preparation method of the anti-aging composition is similar to that in Example 3.

[0051] The difference from Example 3 is that Comparative Example 1 does not contain Tween-20.

[0052] Comparative Example 2 An anti-aging composition

[0053] The anti-aging composition comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, tremella powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, the tremella powder is 30 ng / mL, and the sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0054] The preparation method of the anti-aging composition is similar to that in Example 3;

[0055] The difference from Example 3 is that in Comparative Example 2, the pearl powder is replaced with tremella powder and the dosage remains unchanged.

[0056] Comparative Example 3 An anti-aging composition

[0057] The anti-aging composition comprises the following components: rGDF11, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 50 ng / mL, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, the pearl powder is 30 ng / mL, and the sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0058] The preparation method of the anti-aging composition is similar to that in Example 3;

[0059] The difference from Example 3 is that Comparative Example 3 does not contain acetyl hexapeptide-8.

[0060] Comparative Example 4 An anti-aging composition

[0061] The anti-aging composition comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, the pearl powder is 30 ng / mL, and the sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0062] The preparation method of the anti-aging composition is as follows: at 25°C, mix each component and stir evenly, and then concentrate at -7°C.

[0063] Comparative Example 5 An anti-aging composition

[0064] The anti-aging composition comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of rGDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of sanguisorba officinalis extract is 0.075 μg / mL, the pearl powder is 30 ng / mL, and the sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0065] The preparation method of the anti-aging composition is similar to that in Example 3;

[0066] The difference from Example 3 is that Comparative Example 5 does not contain grape seed extract, and at the same time, the addition amount of sanguisorba officinalis extract is increased to 0.075 μg / mL.

[0067] Comparative Example 6 An anti-aging composition

[0068] The anti-aging composition comprises the following components: GDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, sanguisorba officinalis extract, pearl powder, sodium alginate, and water; wherein, the final concentration of GDF11 is 50 ng / mL, the final concentration of acetyl hexapeptide-8 is 170 ppm, the final concentration of chitosan nanoparticles is 140 μg / mL, the final concentration of Tween-20 is 0.08 μg / mL, the final concentration of grape seed extract is 0.015 μg / mL, the final concentration of sanguisorba officinalis extract is 0.06 μg / mL, the pearl powder is 30 ng / mL, and the sodium alginate is 200 ng / mL; the preparation process of the chitosan nanoparticles is the same as that in Example 1;

[0069] The preparation method of the anti-aging composition is similar to that in Example 3;

[0070] The difference from Example 3 is that in Comparative Example 6, rGDF11 is replaced with full-length GDF11 protein.

[0071] Test Example 1 Antibacterial Test

[0072] 1. Test samples: The anti-aging compositions prepared in Examples 1-3 and Comparative Examples 1-6;

[0073] 2. Test bacteria strains: Staphylococcus aureus, Streptococcus hemolyticus type B, Escherichia coli;

[0074] 3. Test method: The paper disk method is adopted to detect the antibacterial performance of the test samples. The Staphylococcus aureus, Streptococcus hemolyticus type B, and Escherichia coli strains are resuscitated respectively, 10 μL is taken and added to the LB liquid medium, and cultured at 35 °C for 24 h until the logarithmic phase. Then it is taken out and diluted to 1×10 6 CFU / mL. 0.2 mL of the bacterial liquid is evenly spread on the solid agar plate, and then the drug-containing paper disks (1 g of the composition is added to each mL of the bacterial liquid) are placed on the bacterial plate respectively, and continue to culture at 35 °C for 22 hours. The diameter of the antibacterial zone is measured with a vernier caliper.

[0075] 4. Test results: See Table 1 for the specific test results.

[0076] Table 1 Comparison of the diameters of antibacterial zones of different test samples

[0077]

[0078] As can be seen from Table 1 above, compared with the comparative example group, the diameters of the antibacterial zones of the anti-aging compositions prepared in Example Groups 1-3 of the present invention for 3 kinds of bacteria are significantly larger, and these 3 kinds of bacteria are all common strains that can cause skin infections, indicating that the anti-aging compositions of Example Groups 1-3 of the present invention have a significant antibacterial effect. However, in the comparative example group, due to the disruption of the interaction between the components of the present invention or the change of the preparation method, the diameter of the antibacterial zone is significantly reduced and the antibacterial effect is significantly decreased.

[0079] Test Example 2 Wrinkle-Removing Effect Test

[0080] 1. Test samples: The anti-aging compositions prepared in Example Groups 1-3 and Comparative Example Groups 1-6;

[0081] 2. Test subjects: 100 volunteer women with obvious wrinkles, aged 50±3 years old, were randomly divided into 10 groups, with 10 people in each group. Requirements: The volunteers are in good health and have no other obvious diseases;

[0082] 3. Test process: The compositions of Example Groups 1-3 and Comparative Example Groups 1-6 were respectively added to freeze-dried masks (the masks are skin-nourishing and moisturizing freeze-dried masks, which can be purchased from the Guangzhou Branch of Guangzhou Raynaud Biotechnology Co., Ltd.), and mixed evenly. The addition amounts of each group are as follows: the addition amount of the composition of Example 1 is 2%, the addition amount of the composition of Example 2 is 5%, the addition amount of the composition of Example 3 is 3.5%, and the addition amounts of the compositions of Comparative Example Groups 1-6 are 3.5%; after each volunteer washes their face with clean water in the morning and evening, they respectively apply the freeze-dried masks added with different test samples of the present invention, and the control group only applies the mask (without added ingredients). After continuous application for 15 days, the wrinkle-removing effects of each group were observed.

[0083] 4. Test results: It was found that when comparing the volunteers in each group, it was found that the wrinkles of the volunteers who applied the compositions prepared in Example Groups 1-3 and Comparative Example Group 6 of the present invention showed an obvious trend of fading. For the volunteers who applied the composition prepared in Comparative Example Group 1 of the present invention, the wrinkles also decreased slightly, but the effect was significantly inferior to that of Example Groups 1-3. For the volunteers who applied the freeze-dried masks containing the compositions prepared in Comparative Example Groups 2-5, a slight fading of fine wrinkles could be seen upon careful inspection, but the effect was not obvious. For the volunteers who applied the control group mask, there was no obvious change in the facial wrinkles.

[0084] Test Example 3 Anti-Aging Effect

[0085] 1. Test samples: The anti-aging compositions prepared in Example Groups 1-3 and Comparative Example Groups 1-6;

[0086] 2. Test method: Take 10 mg of each of the above test samples, dissolve them separately in absolute ethanol and make up the volume to 100 mL to obtain the test sample solutions to be measured; Similarly, weigh 10 mg of DPPH (1,1-diphenyl-2-picrylhydrazyl), dissolve it in absolute ethanol and make up the volume to 100 mL to prepare the DPPH solution;

[0087] Group a: Take 2 mL of each test sample to be measured, add them into different test tubes respectively, and then add 2 mL of the above DPPH solution into each test tube and mix well;

[0088] Group b: Add 2 mL of absolute ethanol and 2 mL of DPPH solution into the test tube and mix well;

[0089] Group c: Add 2 mL of absolute ethanol and 2 mL of the test solution to each test tube and mix well;

[0090] Then place each test tube in a constant temperature reaction at 36 °C for 1 h, measure the absorbance of each group at a wavelength of 519 nm by spectrophotometry, and calculate the scavenging rate of DPPH free radicals through the following formula:

[0091] [1 - (a - c)] / b × 100%; where a, b, and c respectively represent the absorbances measured in groups a, b, and c; 3. Test results: See Table 3 for the specific test results.

[0092] Table 3 Comparison of the effects of different test samples on scavenging DPPH free radicals

[0093] Test sample Free radical scavenging rate / % Example 1 75.32 Example 2 74.65 Example 3 76.81 Comparative example 1 71.43 Comparative example 2 69.52 Comparative example 3 63.78 Comparative example 4 68.35 Comparative example 5 67.71 Comparative example 6 76.92

[0094] As can be seen from Table 3 above, the free radical scavenging rates of the compositions in Example 1-3 groups and Comparative Example 6 group of the present invention are all about 75%, indicating that the effects of using rGDF11 and GDF11 in the present invention are equivalent. Compared with Comparative Example 1-5 groups, the highest increase is 13 percentage points. Therefore, the anti-aging effects of Example 1-3 groups of the present invention are significantly higher than those of the comparative example groups. However, in the comparative example groups, due to the destruction of the synergistic effect between the components in the present invention, the anti-aging effect is greatly reduced. Especially in Comparative Example 3 and Comparative Example 5 groups, acetyl hexapeptide-8 and grape seed extract are removed respectively, resulting in a significant reduction in the anti-aging effect.

[0095] Finally, it should be noted that the above description of the embodiments is for the convenience of those of ordinary skill in the art to understand and use the invention. Those skilled in the art can obviously make various modifications to these embodiments easily and apply the general principles described herein to other embodiments without creative labor. Therefore, the present invention is not limited to the above embodiments, and the improvements and modifications made by those skilled in the art without departing from the scope of the present invention should be within the protection scope of the present invention.

Claims

1. An anti-aging composition, characterized in that The invention comprises the following components: rGDF11, acetyl hexapeptide-8, chitosan nanoparticles, Tween-20, grape seed extract, Sanguisorba officinalis extract, pearl powder, sodium alginate and water; wherein the final concentration of rGDF11 is 40-60 ng / mL, the final concentration of acetyl hexapeptide-8 is 40-260 ppm, the final concentration of chitosan nanoparticles is 80-200 μg / mL, the final concentration of Tween-20 is 0.05-0.1 μg / mL, the final concentration of grape seed extract is 0.01-0.02 μg / mL, the final concentration of Sanguisorba officinalis extract is 0.05-0.07 μg / mL, pearl powder is 10-50 ng / mL and sodium alginate is 100-300 ng / mL.

2. The anti-aging composition according to claim 1, characterized in that The final concentration of each component was 50 ng / mL for rGDF11, 170 ppm for acetyl hexapeptide-8, 140 μg / mL for chitosan nanoparticles, 0.08 μg / mL for Tween-20, 0.015 μg / mL for grape seed extract, 0.06 μg / mL for Sanguisorba officinalis extract, 30 ng / mL for pearl powder, and 200 ng / mL for sodium alginate.

3. The anti-aging composition according to claim 1 or 2, characterized in that: The amino acid sequence of rGDF11 is shown in SEQ ID NO.

1.

4. The anti-aging composition according to claim 1 or 2, characterized in that: The addition ratio of the grape seed extract to the Sanguisorba officinalis extract is in the range of 1-3:3-5.

5. The anti-aging composition according to claim 1 or 2, characterized in that: The preparation process of the chitosan nanoparticles is as follows: chitosan is added into water to dissolve, and a total of 3 mL of a 0.5 g / L solution is prepared, and then a 0.3 g / L sodium tripolyphosphate aqueous solution is slowly added thereto, and the mixture is slowly stirred with a glass rod at 24° C., and a transparent colloid is collected to obtain the chitosan nanoparticles.

6. A method for preparing the anti-aging composition according to any one of claims 1 to 5, characterized in that: The steps include: S1, rGDF11, acetyl hexapeptide-8, and chitosan nanoparticles were mixed, 500-800 μL of water was added to dissolve, the mixture was heated to 55-60° C., Tween-20 was added thereto, and the mixture was stirred and mixed to obtain a mixture I; S2, mixing the grape seed extract and the Sanguisorba officinalis extract, adding 300-500 μL of water to dissolve, heating to 40-50° C., mixing and stirring evenly to obtain a mixture II; S3, add pearl powder and sodium alginate to the mixture II obtained in step S2, mix well, then cool to 25-30°C, add the mixture I obtained in step S1, Add water to make up to 10 mL, mix and stir evenly, and concentrate at -10 to -5°C to obtain the product.

7. The preparation method according to claim 6, characterized in that: The stirring and mixing conditions in step S1 are stirring at a speed of 500-800 rpm for 30-40 minutes, the stirring and mixing conditions in step S2 are stirring at a speed of 800-1000 rpm for 10-15 minutes, and the stirring and mixing conditions in step S3 are stirring at a speed of 500-600 rpm for 20-30 minutes.

8. Use of the anti-aging composition according to claim 1 in preparing freeze-dried products.

9. The use according to claim 8, characterized in that The freeze-dried products include freeze-dried facial masks and freeze-dried powders.

10. The use according to claim 8, characterized in that The anti-aging composition is added in an amount of 2-5% in the freeze-dried product.

Images