Application of a gene derived from moso bamboo and its encoded protein

By isolating the PeDHN4 and PeDHN8 genes from moso bamboo and transforming them into rice, the problem of moso bamboo's intolerance to salt and alkali was solved, and the salt stress tolerance of rice was significantly improved.

CN120400216BActive Publication Date: 2025-11-14INT CENT FOR BAMBOO & RATTAN
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
CN202510562847.7
Authority / Receiving Office
CN · China
Patent Type
Patents(China)
Current Assignee / Owner
Filing Date
2025-04-30
Publication Date
2025-11-14
Estimated Expiration
2045-04-30

AI Technical Summary

Technical Problem

Most existing moso bamboo varieties are not tolerant of saline-alkali soils, and soil salinization seriously threatens their yield. There is a lack of salt-tolerant varieties and molecular design breeding technology.

Method used

PeDHN4 and PeDHN8 genes were isolated from moso bamboo and their key roles in salt stress response were verified by transforming rice, thereby enhancing the salt tolerance of the plant.

Benefits of technology

Transgenic rice exhibits increased germination rate and root length under salt stress, with no inhibition of aboveground growth, significantly enhancing its salt tolerance.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN120400216B_ABST
    Figure CN120400216B_ABST
Patent Text Reader

Abstract

This invention discloses a gene derived from moso bamboo and the application of its encoded protein, belonging to the field of genetic engineering technology. The gene derived from moso bamboo includes the PeDHN4 gene and the PeDHN8 gene; the nucleotide sequence of the PeDHN4 gene is shown in SEQ ID NO.15; and the nucleotide sequence of the PeDHN8 gene is shown in SEQ ID NO.17. The PeDHN4 and PeDHN8 genes cloned from moso bamboo in this invention show that their expression is significantly upregulated under salt, drought, and abscisic acid (ABA) stress. Furthermore, after being introduced into rice using transgenic technology, they significantly improved the germination rate and root growth capacity of rice under salt stress. This invention provides key gene resources and technical support for the molecular design breeding of salt-tolerant crops.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] This invention relates to the field of genetic engineering technology, and in particular to the application of a gene derived from moso bamboo and its encoded protein. Background Technology

[0002] Salt stress is one of the most serious abiotic stresses, and secondary salinization caused by improper agricultural irrigation and fertilizer use is intensifying. Therefore, cultivating salt-tolerant varieties and developing and utilizing saline-alkali land are important strategic needs to ensure food security.

[0003] Moso bamboo (Phyllostachy edulis) is a high-yielding, highly adaptable, high-quality, and versatile species. It possesses strong vitality and adaptability, capable of growing in diverse environments, and grows very rapidly, averaging 2-3 meters in height annually. It primarily reproduces through the expansion of underground rhizomes and the production of new shoots, making it an ideal species for ecological restoration. However, most current moso bamboo varieties are not salt-tolerant, and with the increasing severity of soil salinization, moso bamboo yields are seriously threatened. Therefore, identifying key salt-tolerant varieties and employing molecular design breeding to cultivate salt-tolerant varieties is of paramount importance. Summary of the Invention

[0004] The purpose of this invention is to provide an application of a gene derived from moso bamboo and its encoded protein to address the problems existing in the prior art. This invention isolates the PeDHN4 and PeDHN8 genes from moso bamboo, reveals their key roles in salt stress response, and verifies their application value in significantly improving salt tolerance through transformation of rice.

[0005] To achieve the above objectives, the present invention provides the following solution:

[0006] Technical Solution 1: Application of genes or their encoded proteins derived from moso bamboo in enhancing plant stress resistance, wherein the genes derived from moso bamboo include the PeDHN4 gene and the PeDHN8 gene; the nucleotide sequence of the PeDHN4 gene is shown in SEQ ID NO. 15; and the nucleotide sequence of the PeDHN8 gene is shown in SEQ ID NO. 17.

[0007] Furthermore, the sequence of the protein encoded by the PeDHN4 gene is shown in SEQ ID NO.16; the sequence of the protein encoded by the PeDHN8 gene is shown in SEQ ID NO.18.

[0008] Technical Solution 2: A plant expression vector containing the PeDHN4 or PeDHN8 gene.

[0009] Furthermore, the plant expression vector is constructed by fusing a pHG vector with EGFP and the PeDHN4 or PeDHN8 gene.

[0010] Technical Solution 3: A primer set for detecting the expression of the PeDHN4 gene, the primer set sequences of which are shown in SEQ ID NO.9 and SEQ ID NO.10.

[0011] Technical Solution 4: A primer set for detecting the expression of the PeDHN8 gene, the primer set sequence being shown in SEQ ID NO.11 and SEQ ID NO.12.

[0012] Technical Solution 5: A method for detecting PeDHN4 gene expression in plants, comprising real-time quantitative PCR analysis using the primer set described above.

[0013] Technical Solution Six: A method for detecting PeDHN8 gene expression in plants, comprising real-time quantitative PCR analysis using the primer set described above.

[0014] Technical Solution 7: A method for improving the salt stress tolerance of plants, comprising introducing a gene or its encoded protein derived from moso bamboo into a target plant; wherein the gene derived from moso bamboo includes the PeDHN4 gene or the PeDHN8 gene; the nucleotide sequence of the PeDHN4 gene is shown in SEQ ID NO.15; the nucleotide sequence of the PeDHN8 gene is shown in SEQ ID NO.17; the sequence of the protein encoded by the PeDHN4 gene is shown in SEQ ID NO.16; and the sequence of the protein encoded by the PeDHN8 gene is shown in SEQ ID NO.18.

[0015] The present invention discloses the following technical effects:

[0016] This invention is the first to isolate the PeDHN4 and PeDHN8 genes from moso bamboo and clarify their key roles under salt stress. Results showed that the germination rate of transgenic rice increased to 35%-40% and 80% under 80mM NaCl and 8μM MABA stress, respectively, demonstrating a significant advantage over the wild type; root length increased by more than 20% under continuous stress, while aboveground growth was not inhibited. This invention reveals the crucial role of the PeDHN4 and PeDHN8 genes in salt stress response and verifies their application value in significantly enhancing salt tolerance through rice transformation, filling a technological gap in this field. Attached Figure Description

[0017] To more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the drawings used in the embodiments will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For those skilled in the art, other drawings can be obtained based on these drawings without creative effort.

[0018] Figure 1 This diagram illustrates the subcellular localization of PeDHN4 and PeDHN8 in tobacco leaf cells. The positive control is an empty 35S::EGFP vector. The positive control 35S::EGFP fusion protein is expressed in both the nucleus and cytoplasm. Staining of tobacco leaf cells shows the location of the fusion protein; green fluorescence indicates the location of the fusion protein, blue fluorescence represents nuclear signal markers, and red fluorescence represents cytoplasmic signal markers.

[0019] Figure 2 The figure shows the expression patterns of PeDHN4 in moso bamboo after treatment with ABA, NaCl, and PEG. Green represents ABA treatment; yellow represents NaCl treatment; and orange represents PEG treatment.

[0020] Figure 3 The expression patterns of PeDHN8 in moso bamboo after treatment with ABA, NaCl, and PEG; Figure caption: green, ABA treatment; yellow, NaCl treatment; orange, PEG treatment;

[0021] Figure 4 Identification of positive strains of pHG-PeDHN4 transgenic rice; Figure caption: +, positive control; M, marker; -O, negative control; 1-11 are transgenic lines;

[0022] Figure 5 Identification of positive strains of pHG-PeDHN8 transgenic rice; Figure caption: +, positive control; M, marker; -O, negative control; 1-11 are transgenic lines;

[0023] Figure 6 The growth status of wild-type rice (WT) and transgenic rice (OE-PeDHN4) after 50 days of no treatment (A), NaCl stress (B), and ABA treatment (C). Detailed Implementation

[0024] Various exemplary embodiments of the present invention will now be described in detail. This detailed description should not be considered as a limitation of the present invention, but rather as a more detailed description of certain aspects, features, and embodiments of the present invention.

[0025] It should be understood that the terminology used in this invention is merely for describing particular embodiments and is not intended to limit the invention. Furthermore, with respect to numerical ranges in this invention, it should be understood that each intermediate value between the upper and lower limits of the range is also specifically disclosed. Any stated value or intermediate value within a stated range, as well as each smaller range between any other stated value or intermediate value within said range, is also included in this invention. The upper and lower limits of these smaller ranges may be independently included or excluded from the range.

[0026] Unless otherwise stated, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. While only preferred methods and materials have been described herein, any methods and materials similar or equivalent to those described herein may be used in the implementation or testing of this invention. All references to this specification are incorporated by way of citation to disclose and describe methods and / or materials associated with those references. In the event of any conflict with any incorporated reference, the content of this specification shall prevail.

[0027] Various modifications and variations can be made to the specific embodiments described in this specification without departing from the scope or spirit of the invention, as will be apparent to those skilled in the art. Other embodiments derived from this specification will also be apparent to those skilled in the art. This specification and embodiments are merely exemplary.

[0028] The terms “include,” “including,” “have,” “contain,” etc., used in this article are all open-ended terms, meaning that they include but are not limited to.

[0029] Example 1

[0030] 1. Materials

[0031] This invention uses bamboo seedlings from Guilin, China as material. Bamboo seedlings were cultivated to 6 months of age in an artificial climate chamber (temperature 25℃, relative humidity 80%, 16 hours light, 8 hours darkness). Sixty uniformly growing bamboo seedlings were selected, and after root cleaning, they were transferred to Kimura nutrient solution for 4 weeks of hydroponic cultivation. Stress treatments were applied using Kimura nutrient solution (Huogelan, Hunan, China) containing 20% ​​PEG-6000 (simulated drought), 300mM NaCl (salt stress), and 100μM ABA (hormone treatment). Leaf samples were collected at 0, 1, 3, 6, 9, 12, and 24 hours, flash-frozen in liquid nitrogen, and stored at -80℃ for later use.

[0032] The transgenic rice experiment was conducted simultaneously, with plant culture conditions of 24±1℃, 75% relative humidity, light intensity of 40 μmol·m⁻²·s⁻¹, and photoperiod of 16h / 8h (light / dark). The germination bag stress sensitivity of positive T1 generation rice seeds was tested by preparing Kimura nutrient solutions containing 80 mM NaCl or 8 μM ABA.

[0033] 2. Gene cloning and vector construction

[0034] RNA was extracted from bamboo leaves using the Quick RNA Isolation Kit (Hua Yueyang, Beijing, China). RNA concentration was determined using a micro-volume spectrophotometer (Thermo Scientific, Waltham, MA, USA), and RNA integrity and quality were assessed by 1% agarose gel electrophoresis (Bio-Rad, Hercules, CA, USA). First-strand cDNA was synthesized using the extracted RNA as a template via a reverse transcription kit (TaKaRa, Kusatsu, Japan).

[0035] Using cDNA as a template, specific primers F1 and R1 for PeDHN4 and specific primers F2 and R2 for PeDHN8 were designed using Snap Gene software (San Diego, CA, USA).

[0036] PeDHN4 specific primer F1: ATGGAGGATGAGAGGAACACC (SEQ ID NO.1);

[0037] PeDHN4 specific primer R1: TTAAGAGCTGGTCTTGTGCTC (SEQ ID NO.2);

[0038] PeDHN8 specific primer F2: ATGGAGGATGAGAGGAACACC (SEQ ID NO.3);

[0039] PeDHN8 specific primer R2: TTAAGAGCTGGTCTTGTGCTC (SEQ ID NO.4).

[0040] use The target sequence was amplified using the Max Master Mix kit (Vazyme, Nanjing, China). Then, it was purified using a DNA purification and recovery kit (Tiangen, Beijing, China). The target sequence was inserted into the pCE2TA / Blunt-Zero vector (Vazyme, Nanjing, China) using a cloning kit in a 25°C metal bath. The ligation product was then transformed into *E. coli* DH5α competent cells (Coolaber, Beijing, China) for colony PCR. Positive colonies were picked from the colony PCR results and sent for Sanger DNA sequencing to Suzhou Azenta. Sequence alignment was performed using SnapGene software. Finally, plasmids were extracted using a plasmid extraction kit (Tiangen, Beijing, China) and stored at -20°C for later use.

[0041] Seamless cloning-specific primers for PeDHN4 and PeDHN8 were designed using SnapGene software; their sequences are shown in Table 1. Using pCE2TA / Blunt-Zero vector plasmids containing PeDHN4 or PeDHN8 fragments as templates, the CDS sequence of the PeDHNs gene was fused with an enhanced green fluorescent protein (EGFP) tag into the pHG vector using a 2×Phanta Max MasterMix high-fidelity enzyme kit (Vazyme, Nanjing, China).

[0042] Table 1 Seamless Cloning Specific Primers

[0043]

[0044] (1) Subcellular localization

[0045] The constructed plant expression vector plasmid was transformed into Agrobacterium competent cells GV3101 (Weidibio, Shanghai, China) using the heat shock method. The cells were cultured for 2 days at 28°C on LB solid medium containing kanamycin (Kan, 50 μg / mL) and rifampin (Rif, 50 μg / mL). Single colonies that tested positive by PCR were picked and inoculated into 25 mL of LB liquid medium, and cultured at 28°C with shaking at 200 rpm / min for 16 h. The samples were centrifuged at 4000 rpm for 10 min at room temperature to collect bacterial cells. The supernatant was discarded, and the cells were resuspended in a suspension (10 mM MES-KOH, 10 mM MgCl2, 200 μM acetosyringone, pH 5.7) to prepare an optical density (OD) reading. 600 The infection solution reached a concentration of approximately 0.6. After standing for 3 hours, the infection solution was injected into the back of the tobacco plant using a 1 mL syringe. After infection, the plants were thoroughly watered and incubated in the dark at 25°C for 1 day, followed by 2 days of light incubation. A 1 cm section of the infected tobacco leaf was then cut off. 2 Small square pieces were stained with 4′,6-diamidino-2-phenylindole (DAPI) solution (10 mg / mL) at room temperature for 10–15 min, and then rinsed 5 times with sterile water. The fluorescence signals of DAPI and EGFP were observed and photographed using an Axio Imager M2 microscope (Zeiss, Oberkochen, Germany) under light excitation of 465 and 509 nm, respectively.

[0046] (2) Real-time quantitative PCR under stress treatment

[0047] Primers for quantitative PCR of the PeDHN4 and PeDHN8 genes were designed using Primer Premier v6, and the sequences are as follows:

[0048] PeDHN4-F:TCGGCAAGAAGAAGGAAGAGGAGAA (SEQ ID NO. 9);

[0049] PeDHN4-R:GAGCTGGAGCTGGATCGGTGTA (SEQ ID NO. 10);

[0050] PeDHN8-F:ATCAGGTGGAGGTGGAGGACAG (SEQ ID NO. 11);

[0051] PeDHN8-R:TGGATCGGTGCAGCTTGGAGA (SEQ ID NO. 12).

[0052] Seven-month-old bamboo seedlings were used as material and treated with Kimura nutrient solution, nutrient solution containing 80mM MABA, nutrient solution containing 100mM NaCl, and nutrient solution containing 20% ​​PEG for 0h, 3h, 6h, 9h, 12h, and 24h, respectively. The second leaf from the top was collected at each time point for qRT-PCR. Real-time quantitative PCR (qRT-PCR) was performed using TB Green & Premix Ex TaqTMII (TaKaRa, Kusatsu, Japan) on a qTOWER RT-PCR system (Analytik, Jena, Germany). GAPDH was used as an internal reference gene (GAPDH forward primer: CAAGGCTGTTGGCAAGGTTC (SEQ ID NO.13), reverse primer R: CATATGAGGCAGACTTCTCGATTC (SEQ ID NO.14)). A 2 -ΔΔCT The relative gene expression levels in moso bamboo tissues after different treatments were analyzed, with the expression level in moso bamboo leaf tissues at 0d serving as the control group.

[0053] 3. Transformation and stress treatment of rice

[0054] (1) Transformation of Agrobacterium tumefaciens

[0055] Add 1 μL of plasmid to 50 μL of EHA105 Agrobacterium competent cells, mix thoroughly, and then transfer to an electroporation cuvette. After electroporation, add 1 mL of LB liquid medium, mix thoroughly, and then transfer to a 1.5 mL centrifuge tube. Incubate at 30°C and 180 rpm for 30 min on a shaker. Then, inoculate 50 μL of the activated Agrobacterium culture onto LB solid medium and incubate in the dark at 30°C for 48 h.

[0056] 1) Agrobacterium detection

[0057] Prepare the PCR amplification system, mix thoroughly after preparation, and perform amplification using a PCR instrument. Set the amplification program according to the primer information, etc. The reaction system is as follows: forward primer (10 μM), 1 μL; reverse primer (10 μM), 1 μL; 2×Taq PCRMix, 10 μL; ddH2O, 7 μL; template, 1 μL; total 20 μL).

[0058] For gel electrophoresis detection, prepare a 1% agarose gel (weigh 1.5g of agarose powder and dissolve it in 150mL of 1×TAE buffer, microwave for about 3 minutes until the liquid becomes transparent. Add EB to the gel casting plate, pour the dissolved agarose liquid into the plate, mix well, insert a comb, and let stand for 40 minutes until the gel turns milky white), spot the sample, and complete the electrophoresis process; check the PCR amplification results. If the electrophoretic bands of the positive control and the sample are clear and of the correct size, and the negative control has no band, the sample can proceed to the next step.

[0059] 2) Rice genetic transformation

[0060] A. Induction of rice callus: Select rice grains without mold spots and with normal bud openings, disinfect with 75% alcohol for 1 min, rinse with sterile water for 1 min / time; disinfect with 15% sodium hypochlorite for 20 min, rinse with sterile water 3 times, 1 min / time; inoculate the disinfected rice grains into the induction medium, and culture at 26℃ under light for 20 days to induce callus.

[0061] B. Agrobacterium infection: Agrobacterium was picked up and placed in the infection solution to prepare OD. 600 =0.2% Agrobacterium resuspension, pick the callus into an Erlenmeyer flask, add Agrobacterium resuspension, infect for 10-15 min and discard the bacterial solution, inoculate the callus into co-culture medium and co-culture at 20℃ for 48-72 h;

[0062] C. Screening of positive callus: Inoculate the co-cultured callus into the screening medium and incubate in the dark at 26°C for 20-30 days; inoculate the positive callus into the secondary screening medium, and be sure to select single-clonal callus during the callus picking process, and incubate in the dark at 26°C for 7-10 days.

[0063] D. Differentiation and rooting: Inoculate positive callus into differentiation medium and culture at 25-27℃ under light for 15-20 days. After the shoots of 2-5cm have differentiated, inoculate them into rooting medium and culture at 30℃ under light for 7-10 days.

[0064] E. Identification of positive seedlings: Rice genomic DNA was extracted using the CTAB method and then detected by PCR. The detection method was the same as that for Agrobacterium detection.

[0065] For details of the components of each culture medium used above, please refer to Shi Lei, Optimization of Rapid Conversion System for Rice [D]. Hubei: Huazhong Agricultural University, 2023.

[0066] 4. Experimental Results

[0067] (1) The CDS and protein sequences of the PeDHN4 and PeDHN8 genes were cloned.

[0068] The CDS sequence of PeDHN4 obtained by cloning is as follows:

[0069] ATGGAGGATGAGAGGAACACCCAGTTCCACCAGGGTGGTGAGGCCGTGGAGAAGGCCGATGATCAGGTGGAGGTGAAGGACAGGGGACTCTTCGACAGCCTCCTCGGCAAGAAGAAGGAAGAGGAGAAGAAGCAGGAGGAGGCGCTGACCACCGGCATGGAGAAGGTCTCGGTGGCAGAGCCCGAGGTGAAGAAGGAGGAGCACGAGGCCGGCCAGAGGAAGGAGAGCCTCCTCTCCAAGCTACACCGATCCAGCTCCAGCTCCAGCTCCTCGAGTGACGAGGAAGAGGAAGTGATCGATGAGAACGGTCAGGTGGTCAAGAGGAAGAAGAAGGGTCTCAAGGAGAAGATCAAGGAGAAGCTGCCCGGACACAAGTACCAAGAGGGCGGGCACAAGACGGCCGCACCCGCACCGGCCCCCGCGCCTGTGGTGACTCACGGCGGCCACCATGACACCGCCGTCGCCGTCGAGAAGATCGAGGGTGACGTGAAGACACAGCTGCCACCAGCACCAGAGGAGGAGAAGAAAGGTCTCTTGGACAAGACCAAGGAGAAGCTGTCCGGCGGCTACAAGAAGCCGGAAGAATGTGCAGCAGCGCCGGCCGCACCGGCTGCTCCAGCCCCGGCGCCAGCCACCGAGGAGGTGAGCAGCCCTGATGCGAAGGAGAAGAAGGGCATCCTAGGCAAGATCATGGAGAAGCTGCCTGGCTACCACAAGGGCGCCGGGAAGGAAGACAAGACGGCCGCCACCGCCCCTGCCGGCGAGCACAAGACCAGCTCTTAA(SEQ ID NO.15);

[0070] The protein sequence of PeDHN4 is as follows:

[0071] MEDERNTQFHQGGEAVEKADDQVEVKDRGLDFDSLLGKKKEEEKKQEEALTTGMEKVSVAEPEVKKEEHEAGQRKESLLSKLHRSSSSSSSSDEEEEVIDENGQVVKRKKKGLKEKIKEKLPGHKYQEGGHKTAAPAPAPAPVVTHGGHHDTAVAVEKIEGDVKTQLPPAPEEEKKGLLDKTKEKLSGGYKKPEECAAAPAAPAAPAPATEEVSSPDAKEKKGILGKIMEKLPGYHKGAGKEDKTAATAPAGEHKTSS(SEQ ID NO.16);

[0072] Clone obtain PeDHN8's CDS sequence for:

[0073] ATGGAGGATGAGAGGAACACCCAGTCCCACCAGGGTGGTGAGGCCGCCGATCAGGTGGAGGTGGAGGACAGGGGCCTCTTCGACAGCCTGCTCGGTAAGAAGAAGGAAGAGGAGAAGAAGCAGGACGAGGTGCTAGTCACCGGCATGGAGAAGGTCTCGTTGGCCGAGCCCGAGGTGAAGGAGGACCACGATGCCGGCGAGAAGAAGGAGAGCCTCCTCTCCAAGCTGCACCGATCCAGCTCCAGCTCCAGCTCGTCGAGTGACGAGGAAGAGGAGGTGATCGATGAGAACGGCGAGGTGGTCAAGAGGAAGAAGAAGGGGCTCAAGGAGAAGATCAAGGAGAAGCTGCCCGGTCACAAGGACCCCGAGGGCGAGCACAAGACGGCCGCACCCGCACCTGCCCCCGCGCCTGTGGTGACTCAAGGCGGCCACCATGACACCGCCGTCGCCGTCGGGAAGATCGAGGGTGACGCGAAGACGGAGGCGCCACCGGCACCAGAGGAGGAGAAAGGGCTCTTGGACAAGATCAAGGAGAAGCTGCCCGGCGGCCACAAGAAGCCGGAAGATGCTGCTGCAGCACCGGCTGCTCCTACTCCAGCGCCAGCACCGACGCCGGCCACCGAGGAGGTGAGCAGCCCGGATGGCAAGGAGAAGAAGGGCATCCTGGGCAAGATCATGGAGAAGCTGCCTGGCTACCACAAGAGCGCCGGGGAGGAAGACAAGGCGGCCGCCGCCGCTGCCGGCGAGCACAAGACCAGCTCTTAA(SEQ ID NO.17)

[0074] The protein sequence of PeDHN8 is as follows:

[0075] MEDERNTQSHQGGEAADQVEVEDRGLFDSLLGKKKEEEKKQDEVLVTGMEKVSLAEPEVKEDHDAGEKKESLLSKLHRSSSSSSSDEEEEVIDENGEVVKRKKKGLKEKIKEKLPGHKDPEGEHKTA APAPAPAPVVTQGGHHDTAVGKIEGDAKTEAPPAPEEEKGLLDKIKEKLPGGHKKPEDAAAAPAAPTPAPAPTPATEEVSSPDGKEKKGILGKIMEKLPGYHKSAGEEDKAAAAAAAGEHKTSS(SEQ ID NO.18).

[0076] (2) Subcellular localization

[0077] Subcellular localization results of PeDHN4 and PeDHN8 are shown in […]. Figure 1 The results showed that PeDHN4 and PeDHN8 were located in the cytoplasmic membrane.

[0078] (3) Expression trends of PeDHN4 and PeDHN8 genes in the stress response of moso bamboo

[0079] The expression patterns of PeDHN4 and PeDHN8 in moso bamboo after treatment with ABA, NaCl, and PEG are shown in the figure. Figure 2 and Figure 3 It can be seen that under the conditions of 100 μM ABA treatment of moso bamboo seedlings for 0h, 1h, 3h, 6h, 9h, 12h and 24h, PeDHN4 and PeDHN8 responded rapidly to ABA treatment for 1h, showing high expression levels, stable expression from 3 to 12h, and finally high expression at 24h. After treatment with 300 mM NaCl for 0h, 1h, 3h, 6h, 9h, 12h and 24h, PeDHN4 and PeDHN8 responded rapidly to stress from 1h to 12h, with expression levels gradually increasing, reaching a peak at 12h, but showing a decreasing trend at 24h. After treatment with 20% PEG for 0h, 1h, 3h, 6h, 9h, 12h and 24h, PeDHN4 and PeDHN8 showed a similar expression trend of first increasing, then decreasing and then increasing again. Under PEG treatment, the expression level gradually increased from 1h to 9h, but suddenly decreased at 12h, and then increased again at 24h.

[0080] (4) Rice overexpressing PeDHN4 and PeDHN8 acquires strong salt tolerance

[0081] The results of rice identification for overexpression of PeDHN4 and PeDHN8 are shown below. Figure 4 and Figure 5To evaluate the seed germination and early seedling growth of transgenic lines under different stress conditions, this invention employed double-germination bag hydroponics to culture transgenic rice in groups, setting NaCl (80 mM) and ABA (8 μM) as stress conditions. Three biological replicates were set up, named OE-PeDHN4 and WT1 / 2 / 3 (Wild-Type), respectively.

[0082] Germination rates of OE-PeDHN4 and OE-PeDHN8 transgenic rice seeds were investigated by treating them with NaCl and ABA. After 7 days of NaCl treatment, the germination rates of WT and transgenic rice seeds were observed. The results showed that under normal conditions, the germination rates of both WT and transgenic rice seeds were close to 100%. However, under NaCl treatment, the germination rate of WT seeds significantly decreased to 25%, exhibiting obvious sensitivity to salt stress. The germination rate of OE-PeDHN4 reached 35%, significantly higher than that of WT, indicating that PeDHN4 imparts a salt-stress-tolerant phenotype to rice. The germination rate of OE-PeDHN8 was 40%, indicating that both PeDHN4 and PeDHN8 can improve the salt stress tolerance of rice. After 7 days of 8 μMABA stress treatment, the germination rate of WT decreased to 55%, while the germination rates of OE-PeDHN4 and OE-PeDHN8 were both 80%, which was much higher than that of the control group. This indicates that PeDHN4 and PeDHN8 have significant advantages in improving the stress tolerance of rice and play a key role in regulating rice seed germination and stress resistance.

[0083] The growth status of transgenic rice after 50 days under no treatment, NaCl stress, and ABA treatment is shown in the figure. Figure 6 It was observed that after 50 days of continuous NaCl treatment, the aboveground parts of WT plants wilted and died, while the aboveground parts of PeDHN4 and PeDHN8 overexpressing lines grew normally. Root growth in WT plants was stagnant, while the roots of PeDHN4 and PeDHN8 overexpressing rice lines were longer and thicker. After 50 days of continuous ABA stress treatment, there were no significant phenotypic differences in the aboveground parts of the control and transgenic lines, but the roots of the PeDHN4 and PeDHN8 transgenic lines were significantly longer and thicker than the control, indicating that overexpression of PeDHN4 and PeDHN8 endowed rice with strong resistance to NaCl and ABA.

[0084] The embodiments described above are merely preferred embodiments of the present invention and are not intended to limit the scope of the present invention. Various modifications and improvements made by those skilled in the art to the technical solutions of the present invention without departing from the spirit of the present invention should fall within the protection scope defined by the claims of the present invention.

Claims

1. The application of overexpression of genes derived from moso bamboo or their encoded proteins in enhancing plant salt tolerance, characterized in that, The gene derived from the moso bamboo is the PeDHN4 gene or the PeDHN8 gene; the nucleotide sequence of the PeDHN4 gene is shown in SEQ ID NO.15; the nucleotide sequence of the PeDHN8 gene is shown in SEQ ID NO.17; the plant is moso bamboo or rice.

2. The application according to claim 1, characterized in that, The amino acid sequence of the protein encoded by the PeDHN4 gene is shown in SEQ ID NO.16; the amino acid sequence of the protein encoded by the PeDHN8 gene is shown in SEQ ID NO.

18.

3. The application according to claim 1, characterized in that, Construct a plant expression vector containing the PeDHN4 gene or the PeDHN8 gene.

4. The application according to claim 3, characterized in that, The plant expression vector was constructed by fusing a pHG vector with EGFP and either the PeDHN4 or PeDHN8 gene.

5. The application according to claim 1, characterized in that, The nucleotide sequences of the primer set used to detect PeDHN4 gene expression are shown in SEQ ID NO.9 and SEQ ID NO.

10.

6. The application according to claim 1, characterized in that, The nucleotide sequences of the primer set used to detect PeDHN8 gene expression are shown in SEQ ID NO.11 and SEQ ID NO.

12.

7. The application according to claim 5 or 6, characterized in that, This includes analyzing gene expression levels using real-time quantitative PCR.

8. A method for improving the salt stress tolerance of plants, characterized in that, The method includes introducing a gene or its encoded protein from moso bamboo into a target plant; the gene from moso bamboo is the PeDHN4 gene or the PeDHN8 gene; the nucleotide sequence of the PeDHN4 gene is shown in SEQ ID NO.15; the nucleotide sequence of the PeDHN8 gene is shown in SEQ ID NO.17; the amino acid sequence of the protein encoded by the PeDHN4 gene is shown in SEQ ID NO.16; the amino acid sequence of the protein encoded by the PeDHN8 gene is shown in SEQ ID NO.18; and the plant is moso bamboo or rice.