5T4 binders and uses thereof
By developing 5T4 binders, especially antibodies and ADCs, the difficulty of targeting 5T4 protein has been solved, and effective killing and therapeutic effects on tumor cells have been achieved.
Patent Information
- Application Number
- CN202510753500.0
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Priority Date
- 2022-05-13
- Filing Date
- 2023-05-10
- Publication Date
- 2025-09-09
AI Technical Summary
Existing technologies have not been able to effectively target 5T4 protein to treat related diseases, especially cancers mediated by 5T4 expressed in tumor cells.
Provided are 5T4 binding agents, including antibodies and antibody-drug conjugates (ADCs), which can specifically bind to the 5T4 protein and are used to treat, prevent, or alleviate 5T4-mediated diseases.
By targeting the 5T4 protein, tumor cells can be effectively killed and removed, providing a new method for treating cancer.
Smart Images

Figure CN120607619A_ABST
Abstract
Description
[0001] CROSS-REFERENCE TO RELATED APPLICATIONS
[0002] This application is a divisional application of the Chinese invention patent application filed on January 13, 2025, with the invention name “5T4 binder and its use” and application number 202380053588.4.
[0003] This application claims the benefit of U.S. Provisional Patent Application No. 63 / 341,944, filed May 13, 2022, the disclosure of which is incorporated herein by reference in its entirety.
[0004] Sequence Listing
[0005] This application contains a computer-readable sequence listing submitted with this application in XML file format, the entire contents of which are incorporated herein by reference in their entirety. The sequence listing XML file submitted with this application is named "14529-107-228_SEQ_LISTING.xml", was created on May 8, 2023, and is 102,425 bytes in size. field
[0006] The present disclosure generally relates to binding agents, such as antibodies or fragments thereof, that bind 5T4, including human 5T4, and methods of use thereof. background
[0007] 5T4 is an N-glycosylated transmembrane 72kDa glycoprotein containing 8 leucine-rich repeats. 5T4, also known as Wnt-activated inhibitory factor 1 or WAIF1, is commonly referred to as carcinoembryonic antigen or trophoblast glycoprotein (TPBG) due to its expression in the fetal trophoblast (where it was first discovered). 5T4 is present in tumors including colorectal tumors, ovarian tumors, and gastric tumors. Its expression is used as a prognostic aid. 5T4 expression in normal tissues is very limited, but it is widely present throughout the development of malignant tumors. Although its limited expression seems to make 5T4 a target for cancer treatment, the treatment success of binding agents and vaccines targeting 5T4 has not yet been achieved.
[0008] Thus, there remains a need in the art for agents that can target 5T4 to treat, prevent, or ameliorate 5T4-mediated diseases, disorders, or conditions, including those involving tumor cells expressing 5T4. Overview
[0009] The present disclosure provides 5T4 binding agents, including human 5T4 binding agents. Such agents include antibodies that bind to 5T4, such as monospecific or multispecific (e.g., bispecific) antibodies and antibody-drug conjugates (ADCs) that bind to 5T4. In some embodiments, such binding agents bind to the same epitope of human 5T4 as antibodies comprising the CDRs described herein (e.g., Tables 1-3). In some embodiments, such binding agents bind to the same epitope of human 5T4 as antibodies comprising the heavy chain variable region and light chain variable region described herein (e.g., Tables 1-3).
[0010] The present disclosure also provides compositions comprising 5T4 binding agents. In some embodiments, such compositions include antibodies that bind to 5T4, such as monospecific or multispecific (e.g., bispecific) antibodies and ADCs that bind to 5T4. In some embodiments, such compositions include antibodies and ADCs that bind to substantially the same epitope of human 5T4 as an antibody comprising a CDR described herein (e.g., Tables 1-3). In some embodiments, such compositions include antibodies and ADCs that bind to substantially the same epitope of human 5T4 as an antibody comprising a heavy chain variable region and a light chain variable region described herein (e.g., Tables 1-3).
[0011] The present disclosure also provides methods for treating, preventing, or ameliorating 5T4-mediated diseases, disorders, or conditions (including one or more symptoms of 5T4-mediated diseases, disorders, or conditions) using 5T4-binding agents or compositions comprising such agents. Such compositions include antibodies that bind to 5T4, such as monospecific or multispecific (e.g., bispecific) antibodies and ADCs that bind to 5T4. BRIEF DESCRIPTION OF THE DRAWINGS
[0012] Figure 1A and Figure 1B Sequence alignment of the heavy and light chain variable regions (including VHCDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3) of mAbA4, mAbA15, and mAbA17 is shown. The boundaries of the CDRs are indicated by Kabat, AbM, Chothia, Contact, IMGT, and AHon numbering. Detailed description
[0013] The present disclosure provides 5T4 binding agents. Such agents include antibodies (e.g., monospecific or multispecific, including bispecific) and ADCs that bind to 5T4, including antibodies and ADCs that bind to human 5T4. Such binding agents can be used to treat, prevent, or alleviate 5T4-mediated diseases, disorders, or conditions (including one or more symptoms of the disease, disorder, or condition) compositions and methods. 5T4-mediated diseases, disorders, and conditions include a variety of cancers, including but not limited to any cancer in which tumor cells express or overexpress 5T4. As used herein, the term "overexpression" means that more genetic products are transcribed and translated than normal (such as in normal cells), a process that is generally characteristic of cancer cells. In addition, the 5T4 binding agents described herein, such as 5T4-binding antibodies (e.g., monospecific or multispecific antibodies, including bispecific antibodies) and 5T4-binding ADCs can be used to kill and / or remove tumor cells. The 5T4 binding agents described herein, such as 5T4-binding antibodies (e.g., monospecific or multispecific antibodies, including bispecific antibodies) and 5T4-binding ADCs can be used to treat cancer compositions and methods.
[0014] Unless otherwise indicated, the term "5T4" refers to a polypeptide ("polypeptide" and "protein" are used interchangeably herein) or any native 5T4 from any vertebrate source, including mammals, such as primates (e.g., humans, cynomolgus monkeys (cynomolgus monkeys), dogs, and rodents (e.g., mice and rats). 5T4, also known as "5T4 oncotrophoblast glycoprotein" or "Wnt activation inhibitory factor 1" or "5T4 oncotrophoblast glycoprotein" or "5T4 carcinoembryonic antigen" or "WAIF1" or "M6P1" or "5T4-AG" or "5T4AG" or "TPBG," is a glycoprotein encoded by the TPBG gene. The term 5T4 encompasses "full-length" 5T4, as well as any form of 5T4 or any fragment thereof produced by processing in a cell. In some embodiments, 5T4 comprises a signal sequence. In some embodiments, 5T4 does not comprise a signal sequence. In some embodiments, the term 5T4 refers to a fragment of full-length 5T4 that comprises the 5T4 extracellular domain. The term 5T4 also encompasses naturally occurring 5T4 variants, such as SNP variants, splice variants, and allelic variants.
[0015] The full-length amino acid sequence of human 5T4 is provided below (exemplary signal sequence = italicized text; exemplary extracellular domain = underlined text):
[0016]
[0017] The full-length amino acid sequence of cynomolgus monkey (cyno) 5T4 is provided below (exemplary signal sequence = italicized text; exemplary extracellular domain = underlined text):
[0018]
[0019]
[0020] The full-length amino acid sequence of mouse 5T4 is provided below (exemplary signal sequence = italicized text; exemplary extracellular domain = underlined text):
[0021]
[0022] As used herein, the term "binding agent" or its grammatical equivalents refers to a molecule (e.g., an antibody) having one or more antigen binding sites that bind an antigen. In some embodiments, the 5T4 binding agents described herein are antibodies, antibody fragments, or other peptide-based molecules that bind to 5T4 (such as human 5T4), as well as conjugates of antibodies, antibody fragments, or peptide-based molecules (e.g., ADCs).
[0023] The terms "antibody," "immunoglobulin," or "Ig" are used interchangeably herein and in the broadest sense, and specifically encompass, for example, polyclonal antibodies, monoclonal antibodies (including agonists, antagonists, neutralizing antibodies, full-length monoclonal antibodies), antibody compositions with multiple or single epitope specificity, recombinantly produced antibodies, single domain (e.g., VHH) antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), synthetic antibodies, chimeric antibodies, humanized antibodies, or human antibody forms with full-length heavy and / or light chains. As used herein, VHH refers to a domain antibody derived from the variable region of a heavy chain antibody only. Exemplary single domain antibodies include, but are not limited to, antibodies naturally lacking light chains, such as those from camelid species (e.g., llamas), single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies, and single domain scaffolds other than those derived from antibodies. Single domain antibodies can be derived from any species, including but not limited to mice, humans, camels, llamas, goats, rabbits, and cows. VHH can also be derived from species other than Camelidae, which can produce heavy chain antibodies that naturally lack light chains. Antibodies also include antibody fragments (and / or polypeptides comprising antibody fragments) that retain 5T4 binding characteristics. Non-limiting examples of antibody fragments include the antigen-binding region and / or effector region of an antibody, for example, Fab, Fab', F(ab')2, Fv, scFv, (scFv)2, single-chain antibody molecules, dual variable domain antibodies, single variable domains, linear antibodies, V regions, multispecific antibodies formed by antibody fragments, F(ab)2, Fd, Fc, diabodies, double diabodies, disulfide-linked Fv (dsFv), single domain antibodies (e.g., nanobodies) or other fragments (e.g., fragments consisting of variable regions of heavy and light chains that are non-covalently coupled). In general, the variable (V) region domain can be any suitable arrangement of immunoglobulin heavy chain (VH) and / or light chain (VL) variable domains. For example, antibodies also include tetrameric antibodies comprising two heavy chains and two light chain molecules, antibody light chain monomers and antibody heavy chain monomers. Therefore, for example, the V region domain can be a dimer and contain VHH-VHH, VH-VH, VH-VL or VL-VL dimers in conjunction with 5T4. If desired, VH and VL can be covalently coupled directly or through a linker to form single-chain Fv (scFv). For ease of reference, scFv protein is referred to herein as being included in the category "antibody fragment". Another form of antibody fragment is a peptide comprising one or more complementary determining regions (CDRs) of an antibody. CDR (also referred to as "minimum recognition unit" or "hypervariable region") can be obtained by constructing a polynucleotide encoding one or more CDRs of interest.Such polynucleotides are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA from antibody-producing cells as a template (see, e.g., Larrick et al., Methods: A Companion to Methods in Enzymology, 2: 106 (1991); Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies," in Monoclonal Antibodies Production, Engineering and Clinical Application, Ritter et al. (eds.), p. 166, Cambridge University Press (1995); and Ward et al., "Genetic Manipulation and Expression of Antibodies," in Monoclonal Antibodies: Principles and Applications, Birch et al., (eds.), p. 137, Wiley-Liss, Inc. (1995)). Antibody fragments can be incorporated into, for example, single domain antibodies, maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, variable domains of novel antigen receptors (v-NARs), and dual single chain Fv regions (see, for example, Hollinger and Hudson, Nature Biotechnology, 23(9): 1126-1136, 2005). In some embodiments, the antibodies comprising VH and / or VL contain light chain and / or heavy chain constant regions, for example, one or more constant regions, including one or more IgG1, IgG2, IgG3, and / or IgG4 constant regions. In some embodiments, the antibodies may include epitope binding fragments of any of the above. The antibodies described herein may be of any class (e.g., IgG, IgE, IgM, IgD, and IgA) or any subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2) of immunoglobulin molecules.
[0024] The term "monospecific" when referring to a binding agent (eg, an antibody or ADC) as used herein refers to a binding agent that has one or more binding sites that each bind to the same epitope of the same antigen.
[0025] When used with respect to a binding agent (e.g., an antibody or ADC), the term "bispecific" refers to a binding agent that is capable of specifically binding to at least two different antigenic determinants, such as two binding sites, each formed by a pair of antibody heavy chain variable domains (VH) and antibody light chain variable domains (VL), or each binding site formed by a pair of VHH domains that bind to different antigens or different epitopes on the same antigen. Such bispecific binding agents (e.g., antibodies or ADCs) may have a 1+1 format (comprising one binding site for a first antigen or epitope and one binding site for a second antigen or epitope). Other bispecific binding agent (e.g., antibody or ADC) formats may be 2+1 or 1+2 formats (comprising two binding sites for a first antigen or epitope and one binding site for a second antigen or epitope) or 2+2 formats (comprising two binding sites for a first antigen or epitope and two binding sites for a second antigen or epitope). When a bispecific binding agent (e.g., an antibody or ADC) comprises two antigen binding sites, each can bind to a different antigenic determinant. Such bispecific binding agents (eg, antibodies or ADCs) can bind to two different epitopes on the same antigen (eg, epitopes on 5T4).
[0026] In the context of two or more nucleic acids or polypeptides, the term "identical" or percentage "identity" refers to two or more sequences or subsequences that, when compared and aligned (if necessary, introducing gaps) to obtain maximum correspondence, are identical or have a specified percentage of identical nucleotides or amino acid residues, without considering any conservative amino acid substitutions as part of sequence identity. Percent identity can be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software that can be used to obtain amino acid or nucleotide sequence alignments are well known in the art. These include but are not limited to BLAST, ALIGN, Megalign, BestFit, GCG Wisconsin Package and variants thereof. In some embodiments, when compared and aligned using a sequence comparison algorithm or by visual inspection to measure maximum correspondence, two nucleic acids or polypeptides are substantially identical, meaning that they have at least 70%, at least 75%, at least 80%, at least 85% or at least 90%, and in some embodiments at least 95%, 96%, 97%, 98% or 99% nucleotide or amino acid residue identity. In some embodiments, the length that identity is present in amino acid sequence is at least about 10 residues, at least about 20 residues, at least about 40-60 residues, at least about 60-80 residues or any integer value therebetween.In some embodiments, identity is present in the region longer than 60-80 residues, for example, at least about 80-100 residues, and in some embodiments, sequence is substantially identical on the total length of the sequence being compared, for example, the coding region of target protein or antibody.In some embodiments, the length that identity is present in nucleotide sequence is at least about 10 bases, at least about 20 bases, at least about 40-60 bases, at least about 60-80 bases or any integer value therebetween.In some embodiments, identity is present in the region longer than 60-80 bases, for example, at least about 80-1000 bases or more, and in some embodiments, described sequence is substantially identical on the total length of the sequence being compared (for example, the nucleotide sequence encoding target protein).
[0027] A "conservative amino acid substitution" is one in which an amino acid residue is replaced by another amino acid residue having a side chain with similar chemical properties. Families of amino acid residues with similar side chains have been generally defined in the art, including basic side chains (e.g., lysine, arginine, or histidine), acidic side chains (e.g., aspartic acid or glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, or cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, or tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, or histidine). For example, a substitution of phenylalanine for tyrosine is a conservative substitution. Generally, conservative substitutions in the sequence of a polypeptide, soluble protein, and / or antibody of the present disclosure will not eliminate binding of the polypeptide, soluble protein, or antibody containing the amino acid sequence to the target binding site. Methods for identifying conservative amino acid substitutions that do not eliminate binding are well known in the art.
[0028] The term "polypeptide" refers to a polymer of amino acids of any length. The polymer can be linear or branched, it can contain modified amino acids, and it can include non-amino acids (e.g., interrupted by non-amino acids). The term also encompasses amino acid polymers that are natural or modified by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as connection or conjugation (directly or indirectly) to a moiety such as a labeling component or a drug (e.g., a toxin). This definition also includes, for example, polypeptides containing one or more amino acid analogs (including, for example, non-natural amino acids) and other modifications known in the art. It should be understood that because the polypeptides of the present disclosure can be based on antibodies or other members of the immunoglobulin superfamily, in some embodiments, the polypeptides can exist as single chains or single-chain dimers.
[0029] As used herein, an "antigen" is a moiety or molecule that contains an epitope to which a binding agent (e.g., an antibody or ADC) can bind. Thus, an antigen can be bound by an antibody. In some embodiments, the antigen to which a binding agent (e.g., an antibody or ADC) described herein binds is 5T4 (e.g., human 5T4) or a fragment thereof, including fragments comprising one or more domains of 5T4.
[0030] As used herein, "epitope" is a term in the art and refers to a local region of an antigen to which an antibody can bind. An epitope can be a linear epitope or a conformational, non-linear or discontinuous epitope. For example, in the case of a polypeptide antigen, an epitope can be the continuous amino acids of a polypeptide (a "linear" epitope), or an epitope can comprise amino acids from two or more discontinuous regions of a polypeptide (a "conformational", "non-linear" or "discontinuous" epitope), such as human 5T4. It will be understood by those skilled in the art that, in general, a linear epitope may or may not depend on secondary, tertiary or quaternary structure. For example, in some embodiments, an antibody binds to a group of amino acids, whether or not they are folded in a native three-dimensional protein structure. In other embodiments, an antibody requires that the amino acid residues constituting the epitope exhibit a specific conformation (e.g., bend, twist, turn or fold) in order to recognize and bind the epitope.
[0031] An antibody binds to an "epitope" or "substantially the same epitope" or "the same epitope" as a reference antibody when the two antibodies recognize the same, overlapping, or adjacent epitopes in three-dimensional space. The most widely used and rapid method for determining whether two antibodies bind to the same, overlapping, or adjacent epitopes in three-dimensional space is a competition assay, which can be configured in many different formats, for example, using labeled antigens or labeled antibodies. In some assays, the antigen is immobilized on a 96-well plate or expressed on the surface of cells, and a radioactive, fluorescent, or enzymatic label is used to measure the ability of an unlabeled antibody to block the binding of the labeled antibody.
[0032] "Epitope binning" is the process of grouping antibodies based on the epitope they recognize. More specifically, epitope binning includes methods and systems for distinguishing the epitope recognition properties of different antibodies, using competitive assays combined with computational processes to cluster antibodies based on their epitope recognition properties and identify antibodies with different binding specificities. As shown in Example 5, additional details about epitope binning and methods for determining epitope binding of antibodies are described herein.
[0033] As used herein, the terms "specifically bind," "specifically recognize," "immunospecifically bind," "selectively bind," "immunospecifically recognize," and "immunospecific" are analogous terms in the context of antibodies and refer to molecules that bind to an antigen (e.g., an epitope) as such binding is understood by those skilled in the art. In some embodiments, "specifically binds" means that, for example, a polypeptide or molecule interacts with an epitope, protein, or target molecule more frequently, more rapidly, with a longer duration, with greater affinity, or some combination thereof, than with alternative substances (including related and unrelated proteins). For example, a molecule that specifically binds to an antigen may bind to other peptides or polypeptides, typically with lower affinity, as determined by, for example, immunoassays, Biacore TM , KinExA 3000 instrument (SapidyneInstruments, Boise, ID), OctetQK384 system (ForteBio, Menlo Park, CA) or other determinations known in the art are determined. In some embodiments, when antibody or antigen-binding domains bind antigen with an affinity higher than any cross-reactive antigen, as determined using experimental techniques such as radioimmunoassay (RIA) and enzyme-linked immunosorbent assay (ELISA), antibody or antigen-binding domains bind or specifically bind antigen. Typically, specific or selective reaction will be at least twice the background signal or noise, and can be more than 10 times the background. See, for example, Fundamental Immunology 332-36 (Paul ed., 2nd edition 1989) for discussion on antibody specificity. In some embodiments, the degree of binding of antibody or antigen-binding domains to "non-target" protein is less than about 10% of the combination of antibody or antigen-binding domains with its specific target antigen, for example, as determined by fluorescence activated cell sorting (FACS) analysis or RIA. In some embodiments, a molecule that specifically binds to an antigen has a Ka of at least 2 logs, 2.5 logs, 3 logs, 4 logs, or greater than the Ka of the molecule for binding to another antigen. In some embodiments, a molecule that specifically binds to an antigen does not cross-react with other proteins. In another specific embodiment, a molecule that specifically binds to an antigen does not cross-react with other non-5T4 proteins. In some embodiments, "specifically binds" means, for example, that a polypeptide or molecule binds to an antigen with a Ka of about 0.1 mM or less, but more typically less than about 1 μM. D In some embodiments, "specifically binds" means that a polypeptide or molecule binds to a protein or target with a K of at least about 0.1 μM or less, at least about 0.01 μM or less, or at least about 1 nM or less. DBinding to a target. Due to the sequence identity between homologous proteins in different species, specific binding can include polypeptides or molecules that recognize proteins or targets in more than one species. Similarly, due to the homology within certain regions of the polypeptide sequences of different proteins, specific binding can include polypeptides or molecules that recognize more than one protein or target. It should be understood that in some embodiments, a polypeptide or molecule that specifically binds to a first target may or may not specifically bind to a second target. Therefore, "specific binding" does not necessarily require (although it can include) exclusive binding, such as binding to a single target. Therefore, in some embodiments, a polypeptide or molecule can specifically bind to more than one target. In some embodiments, multiple targets can be bound by the same antigen binding site on a polypeptide or molecule. For example, in some cases, an antibody can include two identical antigen binding sites, each of which specifically binds to the same epitope on two or more proteins. In certain alternative embodiments, an antibody can be bispecific and include at least two antigen binding sites with different specificities. Typically, but not necessarily, reference to "binding" means "specific binding."
[0034] "Binding affinity" generally refers to the strength of the sum of non-covalent interactions between a single binding site of a molecule (e.g., a binding agent, such as an antibody or ADC) and its binding partner (e.g., an antigen, such as 5T4). Unless otherwise indicated, as used herein, "binding affinity" refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., an antibody and an antigen). The affinity of a binding molecule X for its binding partner Y can generally be expressed in terms of the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including the methods described herein. Low-affinity antibodies generally bind antigen more slowly and tend to dissociate easily, while high-affinity antibodies generally bind antigen more quickly and tend to remain bound longer. Various methods for measuring binding affinity are known in the art, any of which can be used for the purposes of the present disclosure. In one embodiment, "K D ” or “K D The K value can be measured by biolayer interferometry (BLI) using, for example, the Octet QK384 system (ForteBio, Menlo Park, CA). Alternatively, K can also be measured in a radiolabeled antigen binding assay (RIA). D For example, the Fab form of the antibody of interest can be used to bind to its antigen (Chen et al. (1999) J. Mol Biol 293: 865-881), or Biacore TM Surface plasmon resonance (SPR) assays using, for example, Biacore TM -2000 or Biacore TM-3000(Biacore TM , Inc., Piscataway, NJ). "On-rate" or "rate of association" or "association rate" or "k on and “off-rate” or “rate of dissociation” or “dissociation rate” or “k off " can also be used, for example, the OctetQK384 system (ForteBio, Menlo Park, CA) or Biacore TM -2000 or Biacore TM -3000(Biacore TM , Inc., Piscataway, NJ) were measured using the same SPR or BLI technology as described above.
[0035] When used in the context of a 5T4 binder (e.g., an antibody or ADC), the term "competition" means a binder that competes for the same epitope or binding site on a target, including competition between such binders as determined by an assay in which the binder under investigation prevents or inhibits specific binding of a reference molecule (e.g., a reference ligand or a reference antigen-binding protein, such as a reference antibody) to a common antigen (e.g., 5T4). Many types of competitive binding assays can be used to determine whether a test binder competes with a reference molecule for binding to 5T4 (e.g., human 5T4). Examples of assays that can be employed include solid phase direct or indirect radioimmunoassays (RIA); solid phase direct or indirect enzyme immunoassays (EIA); sandwich competition assays (see, e.g., Stahli et al., (1983) Methods in Enzymology 9:242-253); solid phase direct biotin-avidin EIA (see, e.g., Kirkland et al., (1986) J. Immunol. 137:3614-3619 or Cheung et al., (1990) Virology 176:546-552); solid phase direct label assays; solid phase direct label sandwich assays (see, e.g., Harlow and Lane, (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1992). Press); direct labeling RIA using solid phase labeled with I-125 (see, e.g., Morel et al. (1988) Molec. Immunol. 25: 7-15) and direct labeling RIA (Moldenhauer et al. (1990) Scand. J. Immunol. 32: 77-82). Typically, such assays involve the use of purified antigen (e.g., 5T4, such as human 5T4) bound to a solid surface or cells that carry an unlabeled test antigen binding protein (e.g., a test 5T4 antibody or ADC) or a labeled reference antigen binding protein (e.g., a reference 5T4 antibody or ADC). Competitive inhibition can be measured by determining the amount of label bound to the solid surface or cells in the presence of the test antigen binding protein. Typically, the test antigen binding protein is present in excess. Antibodies identified by competition assays (competing antibodies) include antibodies that bind to the same epitope as the reference antibody and / or antibodies that bind to an adjacent epitope (e.g., a similar epitope or overlapping epitope) that is sufficiently close to the epitope bound by the reference antibody to allow steric hindrance of the antibodies to occur. Typically, when the competing antibody is present in excess, it will inhibit specific binding of the reference antibody to the common antigen by at least 20%, e.g., at least 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, or 75%.In some cases, binding is inhibited by at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more.
[0036] As used herein, the term "constant region" or "constant domain" is an antibody term well known in the art and refers to the portion of an antibody, such as the carboxyl terminal portion of a light chain and / or a heavy chain, that is not directly involved in binding the antibody to an antigen but can exhibit various effector functions, such as interactions with Fc receptors. The term includes portions of immunoglobulin molecules that have amino acid sequences that are generally more conserved than immunoglobulin variable domains.
[0037] In some embodiments, antibody "effector functions" refer to those biological activities attributable to the Fc region (e.g., a native sequence Fc region or amino acid sequence variant Fc region) of an antibody and vary with the antibody isotype. Examples of antibody effector functions include: C1q binding and complement-dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; downregulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
[0038] The term "Fc region" herein is used to define the C-terminal region of a heavy chain immunoglobulin, including, for example, native sequence Fc regions, recombinant Fc regions, and variant Fc regions. Although the boundaries of the Fc regions of heavy chain immunoglobulins may be different, human IgG heavy chain Fc regions are generally defined as extending from the amino acid residue at position Cys226 (according to the EU numbering system) or from Pro230 (according to the EU numbering system) to its carboxyl terminus. For example, during the production or purification of an antibody, or by recombinant engineering of the nucleic acid encoding the heavy chain of an antibody, the C-terminal lysine (according to the residue 447 of the EU numbering system) in the Fc region can be removed. Exemplary Fc region sequences (CH2 domains = bold text; CH3 domains = underlined text) are provided below:
[0039]
[0040] A "functional Fc region" possesses the "effector functions" of a native sequence Fc region. Exemplary "effector functions" include C1q binding; complement-dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; downregulation of cell surface receptors (such as B cell receptor; BCR), etc. Such effector functions generally require the Fc region to be combined with a binding region or binding domain (e.g., an antibody variable region or domain) and can be assessed using various assays as disclosed.
[0041] A "native sequence Fc region" includes an amino acid sequence that is identical to the amino acid sequence of an Fc region found in nature and has not been manipulated, modified, and / or altered by humans (e.g., isolated, purified, selected, including or combined with other sequences, such as variable region sequences). Native sequence human Fc regions include native sequence human IgG1 Fc regions (non-A allotypes and A allotypes); native sequence human IgG2 Fc regions; native sequence human IgG3 Fc regions; and native sequence human IgG4 Fc regions, as well as naturally occurring variants thereof.
[0042] " Variant Fc region " comprises an amino acid sequence that is different from the native sequence Fc region due to at least one amino acid modification (e.g., substitution, addition or deletion), preferably one or more amino acid substitutions. In some embodiments, the variant Fc region has at least one amino acid substitution compared to the Fc region of the native sequence Fc region or the parent polypeptide, for example, about one to about ten amino acid substitutions in the Fc region of the native sequence Fc region or the parent polypeptide, and preferably about one to about five amino acid substitutions. The variant Fc region herein can have at least about 80% homology with the native sequence Fc region and / or with the Fc region of the parent polypeptide, or at least about 90% homology thereto, for example, at least about 95% homology thereto. The variant Fc region described herein can have a loss of effector function (e.g., silent Fc). Exemplary variant Fc region ("silent Fc") sequences are provided below (CH2 domain = bold text, amino acid changes are underlined; CH3 domain = underlined text):
[0043]
[0044] As used herein, the term "heavy chain," when used in reference to an antibody, refers to a polypeptide chain of about 50 kDa-70 kDa, wherein the amino-terminal portion includes a variable region of about 120 to 130 or more amino acids, and the carboxyl-terminal portion includes one or more constant regions. A "heavy chain" can refer to any of the different types based on the amino acid sequence of the constant domain, such as alpha (α), delta (δ), epsilon (ε), gamma (γ), and mu (μ), which give rise to antibodies of the IgA, IgD, IgE, IgG, and IgM classes, respectively, including subclasses of IgG, such as IgG1, IgG2, IgG3, and IgG4.
[0045] As used herein, the term "light chain," when used to refer to an antibody, refers to a polypeptide chain of about 25 kDa, wherein the amino terminal portion includes a variable region of about 100 to about 110 or more amino acids, and the carboxyl terminal portion includes a constant region. The approximate length of a light chain is 211 to 217 amino acids. There are two different types based on the amino acid sequence of the constant domain, such as kappa (κ) or lambda (λ). Light chain amino acid sequences are well known in the art.
[0046] The terms "antigen-binding fragment," "antigen-binding domain," "antigen-binding region," and similar terms refer to a portion of an antibody that comprises the amino acid residues (e.g., CDRs) that interact with an antigen and confer specificity and affinity to the binding fragment, domain, or region for the antigen. As used herein, "antigen-binding fragment" includes "antibody fragments" that comprise a portion of an antibody that includes one or more CDRs, such as an antigen-binding region or variable region of an antibody.
[0047] The antibodies described herein include, but are not limited to, synthetic antibodies, monoclonal antibodies, recombinantly produced antibodies, multispecific antibodies (e.g., including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, intrabodies, single-chain Fv (scFv) (e.g., including monospecific, bispecific, etc.), camelized antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fv (sdFv), anti-idiotypic (anti-Id) antibodies, and epitope-binding fragments of any of the above.
[0048] In some embodiments, the antibodies described herein include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, including molecules that contain one or more antigen binding sites that bind to the 5T4 antigen.
[0049] The antibody can be any type of immunoglobulin molecule (e.g., IgG, IgE, IgM, IgD, IgA, or IgY), any class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1, or IgA2), or any subclass (e.g., IgG2a or IgG2b). In some embodiments, the antibodies described herein are IgG antibodies (e.g., human IgG) or their class (e.g., human IgG1, IgG2, IgG3, or IgG4) or subclass.
[0050] In some embodiments, the antibody is a 4-chain antibody unit comprising two heavy (H) chain / light (L) chain pairs, wherein the amino acid sequences of the H chains are identical and the amino acid sequences of the L chains are identical. In some embodiments, the antibody is a 2-chain antibody unit comprising a VHH-VHH pair, wherein the amino acid sequences of the VHHs are identical. In some embodiments, the H chain and / or the L chain comprise a constant region, such as a human constant region. In some embodiments, the L chain constant region of such antibodies is a kappa or lambda light chain constant region, such as a human kappa or lambda light chain constant region. In some embodiments, the H chain constant region of such antibodies comprises a gamma heavy chain constant region, such as a human gamma heavy chain constant region. In some embodiments, such antibodies comprise an IgG constant region, such as a human IgG constant region (e.g., IgG1, IgG2, IgG3, and / or IgG4 constant region).
[0051] The antibody or fragment thereof can preferentially bind to 5T4, such as human 5T4, meaning that the antibody or fragment thereof binds to 5T4 with a greater affinity than it binds to an unrelated control protein and / or binds to human 5T4 with a greater affinity than it binds to an unrelated control protein. For example, the antibody or fragment thereof can specifically recognize and bind to 5T4 or a portion thereof. "Specific binding" means that the antibody or fragment thereof binds to 5T4 with an affinity that is at least 5, 10, 15, 20, 25, 50, 100, 250, 500, 1000, or 10,000 times greater than its affinity for an unrelated control protein (e.g., hen egg white lysozyme). In some embodiments, the antibody or fragment thereof can bind substantially exclusively to 5T4 (e.g., can distinguish 5T4 from other known polypeptides, e.g., by a measurable difference in binding affinity). In some embodiments, a 5T4-binding agent (e.g., an antibody or ADC) can react with 5T4 sequences other than human 5T4 sequences (e.g., cynomolgus monkey 5T4 sequences).
[0052] The terms "variable region" and "variable domain" refer to a portion of the light or heavy chain of an antibody, which is generally located at the amino terminus of the light or heavy chain and has a length of about 120 to 130 amino acids in the heavy chain and a length of about 100 to 110 amino acids in the light chain, and is used for the binding and specificity of each specific antibody to its specific antigen. The variable region of the heavy chain may be referred to as "VH". The variable region of the light chain may be referred to as "VL". The term "variable" refers to the fact that the sequences of certain segments of the variable region are widely different between antibodies. The V region mediates antigen binding and defines the specificity of a particular antibody to its specific antigen. However, variability is not evenly distributed within the 110 amino acids of the variable region. Instead, the V region is composed of a less variable (e.g., relatively unchanged) segment called a framework region (FR) of about 15-30 amino acids, separated by a shorter region with greater variability (e.g., extreme variability) called a "hypervariable region" or alternatively a "complementarity determining region". The variable regions of the heavy and light chains each contain four frameworks (FR1, FR2, FR3, and FR4), primarily in a β-sheet configuration connected by three hypervariable regions that form loops connecting the β-sheet structure and, in some cases, form a portion of the β-sheet structure. The hypervariable regions in each chain are held together tightly by the framework and, together with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of the antibody (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, (1991)). The constant region is not directly involved in the binding of the antibody to the antigen, but exhibits various effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) of the antibody. The sequence of the variable region is widely different between different antibodies. The variability of the sequence is concentrated in the CDR, while the less variable parts of the variable region are referred to as framework regions (FRs). The CDRs of the light and heavy chains are primarily responsible for the interaction of the antibody with the antigen. In specific embodiments, the variable region is a human variable region.
[0053] As used herein, the terms "hypervariable region," "HVR," "HV," "complementarity determining region," or "CDR" refer to regions of an antibody variable region whose sequence is hypervariable and / or forms structurally defined loops. Typically, an antibody comprises six hypervariable regions: three in VH (H1 or VH CDR1, H2 or VH CDR2, H3 or VH CDR3) and three in VL (L1 or VL CDR1, L2 or VL CDR2, L3 or VL CDR3). Many descriptions of hypervariable regions are in use and are encompassed herein. The Kabat CDR is based on sequence variability and is the most commonly used (see, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)). Chothia, on the other hand, refers to the position of the structural loops (see, e.g., Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). When numbering using the Kabat numbering convention, the end of the Chothia CDR-H1 loop varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertion at H35A and H35B; if both 35A and 35B do not exist, the loop ends at 32; if only 35A exists, the loop ends at 33; if both 35A and 35B exist, the loop ends at 34). The AbM hypervariable region represents a compromise between the Kabat CDR and Chothia structural loops and is used in the AbM antibody modeling software of Oxford Molecular (see, e.g., Martin, Antibody Engineering, Vol. 2, Chapter 3, Springer Verlag). The "contact" hypervariable region is based on an analysis of available complex crystal structures. The residues from each of these hypervariable regions or CDRs are mentioned below.
[0054] A universal numbering system has been developed and widely adopted, ImMunoGeneTics Information system (Lefranc et al., Dev. Comp. Immunol. 27(1): 55-77 (2003)). IMGT is an integrated information system dedicated to immunoglobulins (IG), T cell receptors (TR) and major histocompatibility complex (MHC) of humans and other vertebrates. In this article, CDRs are referred to in terms of amino acid sequence and position in the light chain or heavy chain. Since the "position" of CDRs within the structure of the immunoglobulin variable domain is conserved between species and is present in structures called loops, CDR and framework residues are easily identified by using a numbering system that aligns variable domain sequences based on structural features. This information can be used to graft and replace CDR residues from immunoglobulins of one species into an acceptor framework, usually from a human antibody. Honegger and Plückthun, J. Mol. Biol. 309: 657-670 (2001) have developed an alternative numbering system (AHon). The correspondence between numbering systems, including, for example, Kabat numbering and the IMGT unique numbering system, is well known to those skilled in the art (see, e.g., Kabat, supra; Chothia and Lesk, supra; Martin, supra; Lefranc et al., supra) and is also shown below. The various systems known in the art or described herein represent different ways of depicting CDRs and are generally considered equivalent when used to define the same antibody. The exemplary system shown herein combines Kabat and Chothia.
[0055] Exemplary IMGT Kabat AbM Chothia Contact <![CDATA[V H CDR1]]> 26-35 27-38 31-35 26-35 26-32 30-35 <![CDATA[V H CDR2]]> 50-65 56-65 50-65 50-58 53-55 47-58 <![CDATA[V H CDR3]]> 95-102 105-117 95-102 95-102 96-101 93-101 <![CDATA[V L CDR1]]> 24-34 27-38 24-34 24-34 26-32 30-36 <![CDATA[V L CDR2]]> 50-56 56-65 50-56 50-56 50-52 46-55 <![CDATA[V L CDR3]]> 89-97 105-117 89-97 89-97 91-96 89-96
[0056] The hypervariable region may comprise the following "extended hypervariable region": 24-36 or 24-34 (L1), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in VL and 26-35 or 26-35A (H1), 50-65 or 49-65 (H2) and 93-102, 94-102 or 95-102 (H3) in VH. As used herein, the terms "hypervariable region," "HVR," "HV," "complementarity determining region," or "CDR" are used interchangeably.
[0057] The term "vector" refers to a material for carrying or comprising a nucleic acid sequence, including, for example, introducing a nucleic acid sequence into a host cell. Suitable vectors include, for example, expression vectors, plasmids, phage vectors, viral vectors, episomes, and artificial chromosomes, which can include selection sequences or markers that can be used to stably integrate into the host cell chromosome. In addition, the vector can include one or more selective marker genes and appropriate expression control sequences. For example, the selective marker gene that can be included provides resistance to antibiotics or toxins, supplements nutritional deficiency defects, or provides key nutrients that are not present in the culture medium. The expression control sequence can include constitutive and / or inducible promoters, transcription enhancers, transcription terminators, etc. well known in the art. When two or more nucleic acid molecules are to be co-expressed (for example, antibody heavy chain and light chain or antibody VH and VL), the two nucleic acid molecules can, for example, be inserted into a single expression vector or an independent expression vector. For single vector expression, the encoding nucleic acid can be operably linked to a common expression control sequence or be connected to different expression control sequences, such as an inducible promoter and a constitutive promoter. Methods well known in the art can be used to confirm that the nucleic acid molecules are introduced into the host cell. Such methods include, for example, nucleic acid analysis such as Northern blot or polymerase chain reaction (PCR) amplification of mRNA, or immunoblotting for gene product expression, or other suitable analytical methods for testing the expression of an introduced nucleic acid sequence or its corresponding gene product. It will be understood by those skilled in the art that the nucleic acid molecule is expressed in sufficient amounts to produce the desired product (e.g., a 5T4 binder as described herein), and it will be further understood that methods well known in the art can be used to optimize expression levels to obtain sufficient expression.
[0058] "5T4-mediated disease," "5T4-mediated disorder," and "5T4-mediated condition" are used interchangeably and refer to any disease, disorder, or condition associated with or characterized by cells expressing 5T4, such as 5T4-expressing tumor cells. 5T4-mediated diseases include cancer, including but not limited to cancers that express or overexpress 5T4.
[0059] An "effective amount" is generally an amount sufficient to reduce the severity and / or frequency of symptoms, eliminate symptoms and / or potential causes, prevent the occurrence of symptoms and / or their potential causes, and / or ameliorate or remedy damage caused by or associated with the disease, disorder, or condition. In some embodiments, an effective amount is a therapeutically effective amount or a prophylactically effective amount.
[0060] As used herein, the term "therapeutically effective amount" refers to an amount of an agent (e.g., an antibody or ADC described herein or any other agent described herein) sufficient to reduce and / or improve the severity and / or duration of a given disease, disorder or condition and / or symptoms associated therewith. A therapeutically effective amount of an agent (including a therapeutic agent) can be an amount necessary to (i) reduce or improve the development or progression of a given disease, disorder or condition, (ii) reduce or improve the recurrence, development or onset of a given disease, disorder or condition, and / or (iii) improve or enhance the preventive or therapeutic effect of another therapy (e.g., a therapy other than the administration of an antibody or ADC described herein). A "therapeutically effective amount" of a substance / molecule / agent of the present disclosure (e.g., a 5T4 antibody or ADC) can vary according to factors such as the disease state, age, sex, and weight of an individual, and the ability of the substance / molecule / agent to elicit a desired response in an individual. A therapeutically effective amount encompasses an amount in which any toxic or deleterious effects of a substance / molecule / agent are exceeded by a therapeutically beneficial effect. In certain embodiments, the term "therapeutically effective amount" refers to an amount of an antibody or other agent (eg, ADC or drug) effective to "treat" a disease, disorder, or condition in a subject or mammal.
[0061] A "prophylactically effective amount" is an amount of a pharmaceutical composition that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or recurrence) of a disease, disorder or condition, or reducing the likelihood of the onset (or recurrence) of a disease, disorder or condition or associated symptoms.
[0062] The full therapeutic or prophylactic effect does not necessarily occur by administering one dose and may occur only after administering a series of doses.Thus, a therapeutically or prophylactically effective amount may be administered in one or more administrations.
[0063] As used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the US Pharmacopoeia, the European Pharmacopoeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
[0064] As used herein, "carrier" includes carriers, excipients, stabilizers, or preservatives that are nontoxic to cells or mammals exposed thereto at the dosages and concentrations employed. Carriers are typically aqueous pH buffered solutions. Examples of carriers include buffers such as phosphates, citrates, and other organic acids; antioxidants including ascorbic acid; low molecular weight (e.g., less than about 10 amino acid residues) polypeptides; proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other sugars including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and / or nonionic surfactants such as TWEEN®. TM , polyethylene glycol (PEG) and PLURONICS TM . The term "carrier" can also refer to a diluent, adjuvant (e.g., Freund's adjuvant (complete or incomplete)), excipient, or a vehicle used together with the therapeutic agent. Such a carrier can be a sterile liquid, such as water and oil, including those of petroleum, animal, plant, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil, etc. When the composition (e.g., pharmaceutical composition) is administered intravenously, water is an exemplary carrier. Saline solutions, as well as aqueous dextrose solutions and glycerol solutions can also be used as liquid carriers, particularly for injectable solutions. Suitable excipients (e.g., pharmaceutical excipients) include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glyceryl monostearate, talc, sodium chloride, skim milk powder, glycerol, propylene glycol, water, ethanol, etc. If desired, the composition can also include a small amount of wetting agent or emulsifier, or a pH buffer. The composition can take the form of a solution, suspension, emulsion, tablet, pill, capsule, powder, sustained-release formulation, etc. Oral compositions (including formulations) can include standard carriers, such as pharmaceutical grade mannitol, lactose, starch, magnesium stearate, sodium saccharin, cellulose, magnesium carbonate, and the like. Examples of suitable carriers are described in Remington's Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA. Compositions comprising pharmaceutical compounds can contain a prophylactically or therapeutically effective amount of a 5T4 binding agent (e.g., an antibody or ADC), for example, in an isolated or purified form, together with an appropriate amount of a carrier, to provide a form suitable for administration to a subject (e.g., a patient). The formulation should be suitable for the mode of administration.
[0065] In some embodiments, the present disclosure provides 5T4 binding agents that can be used as therapeutic agents herein. Such agents include antibodies (e.g., monospecific or multispecific, including bispecific) and ADCs that bind to 5T4. Exemplary antibodies include polyclonal, monoclonal, humanized, human, bispecific, and heterologous conjugate antibodies, as well as variants thereof with increased or decreased affinity or other properties.
[0066] In some embodiments, described herein are 5T4-binding agents (e.g., antibodies or ADCs) that bind to 5T4 (including 5T4 polypeptides, 5T4 polypeptide fragments, 5T4 peptides, or 5T4 epitopes). In some embodiments, the 5T4-binding agent is a human or humanized antibody (e.g., comprising a human constant region) that binds to 5T4 (including 5T4 polypeptides, 5T4 polypeptide fragments, 5T4 peptides, or 5T4 epitopes). In some embodiments, the 5T4-binding agent (e.g., antibody or ADC), such as a human 5T4-binding agent, can bind to 5T4 expressed on the surface of mammalian (e.g., human) cells (including tumor cells that express 5T4). In some embodiments, the 5T4-binding agent (e.g., antibody or ADC) binds to an extracellular epitope of 5T4 (e.g., a 5T4 epitope) exposed on a cell (e.g., a tumor cell). In some embodiments, described herein are 5T4-binding agents (e.g., antibodies or ADCs) that bind to 5T4 (such as human 5T4 or a portion thereof). In some embodiments, 5T4 is human 5T4. In some embodiments, the 5T4-binding agent is a human 5T4-binding agent (eg, an antibody or ADC that binds to human 5T4). Exemplary amino acid sequences of human 5T4 are described herein.
[0067] In some embodiments, a 5T4-binding agent (e.g., an antibody or ADC) described herein competes for binding to 5T4 (e.g., human 5T4) with a 5T4-binding agent (e.g., an antibody or ADC) comprising the VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 of any of the antibodies described herein, e.g., the amino acid sequences of the VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 depicted in Tables 1-3. Thus, in some embodiments, the 5T4-binding agents (e.g., antibodies or ADCs) described herein compete for binding to 5T4 (such as human 5T4) with a 5T4-binding agent (e.g., antibody or ADC) comprising one, two, and / or three VH CDRs and / or one, two, and / or three VL CDRs from: (a) the antibody designated mAbA4; (b) the antibody designated mAbA15; and (c) the antibody designated mAbA17, as shown in Tables 1-3. In some embodiments, the 5T4-binding agents (e.g., antibodies or ADCs) described herein compete for binding to 5T4 (such as human 5T4) with a 5T4-binding agent (e.g., antibody or ADC) comprising one, two, and / or three VH CDRs and one, two, and / or three VL CDRs from: (a) the antibody designated mAbA4; (b) the antibody designated mAbA15; and (c) the antibody designated mAbA17; as shown in Tables 1-3. In some embodiments, the 5T4-binding agents (e.g., antibodies or ADCs) described herein compete for binding to 5T4 (such as human 5T4) with 5T4-binding agents (e.g., antibodies or ADCs) comprising the VH and VL regions from: (a) the antibody designated mAbA4; (b) the antibody designated mAbA15; and (c) the antibody designated mAbA17, as shown in Tables 1-3. In some embodiments, the 5T4-binding agents (e.g., antibodies or ADCs) described herein compete for binding to 5T4 (such as human 5T4) with 5T4-binding agents (e.g., antibodies or ADCs) comprising: (a) a VH region comprising the amino acid sequence of SEQ ID NO: 25 and a VL region comprising the amino acid sequence of SEQ ID NO: 26; (b) a VH region comprising the amino acid sequence of SEQ ID NO: 44 and a VL region comprising the amino acid sequence of SEQ ID NO: 45; and (c) a VH region comprising the amino acid sequence of SEQ ID NO: 62 and a VL region comprising the amino acid sequence of SEQ ID NO: 63.
[0068] In some embodiments, the 5T4-binding agents (e.g., antibodies) described herein comprise the VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 of any of the antibodies described herein, such as the amino acid sequences of the VH region, VL region, VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 depicted in Tables 1-3. Thus, in some embodiments, the 5T4-binding agents (e.g., antibodies or ADCs) described herein comprise one, two, and / or three heavy chain CDRs and / or one, two, and / or three light chain CDRs from: (a) the antibody designated mAbA4; (b) the antibody designated mAbA15; and (c) the antibody designated mAbA17, as shown in Tables 1-3. In some embodiments, the 5T4-binding agents (e.g., antibodies or ADCs) described herein comprise one, two, and / or three heavy chain CDRs and one, two, and / or three light chain CDRs from: (a) the antibody designated mAbA4; (b) the antibody designated mAbA15; and (c) the antibody designated mAbA17, as shown in Tables 1-3.
[0069] In some embodiments, the 5T4-binding agent (e.g., antibody or ADC) comprises a VH region comprising a VH CDR1, VH CDR2, and / or VH CDR3, and / or a VL region comprising a VL CDR1, VL CDR2, and / or VL CDR3 of any one of the binding agents described herein (see, e.g., any one of Tables 1-3). Thus, in some embodiments, the 5T4-binding agent (e.g., antibody or ADC) described herein comprises one, two, and / or three heavy chain CDRs and / or one, two, and / or three light chain CDRs from Table 1. In some embodiments, the 5T4-binding agent (e.g., antibody or ADC) described herein comprises one, two, and / or three heavy chain CDRs and / or one, two, and / or three light chain CDRs from Table 2. In some embodiments, the 5T4-binding agent (e.g., antibody or ADC) described herein comprises one, two, and / or three heavy chain CDRs and / or one, two, and / or three light chain CDRs from Table 3.
[0070] The antibody designated mAbA4 comprises the VH sequence of SEQ ID NO:25 and the VL sequence of SEQ ID NO:26.
[0071] The antibody designated mAbA15 comprises the VH sequence of SEQ ID NO:44 and the VL sequence of SEQ ID NO:45.
[0072] The antibody designated mAbA17 comprises the VH sequence of SEQ ID NO:62 and the VL sequence of SEQ ID NO:63.
[0073]
[0074]
[0075]
[0076] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise a VH region or VH domain. Additionally or alternatively, in some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise a VL region or VL domain. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, have a combination of: (i) a VH domain or VH region; and / or (ii) a VL domain or VL region.
[0077] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise a heavy chain having the following combination: (i) a VH as described in any one of Tables 1-3; and (ii) one or more heavy chain constant domains (e.g., CH1, hinge, CH2, and CH3). An exemplary IgG heavy chain comprises any VH sequence as described herein and the following CH1, hinge, CH2, and CH3 amino acid sequences:
[0078]
[0079] Another exemplary IgG heavy chain comprises any VH sequence as described herein and the following CH1, hinge, CH2, and CH3 amino acid sequences:
[0080]
[0081] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise a light chain having the following combination: (i) a VL domain as described in any one of Tables 1-3; and (ii) a light chain constant domain (CL). Exemplary light chains (e.g., for pairing with IgG heavy chains) comprise any of the VL sequences described herein and the following CL amino acid sequence:
[0082]
[0083] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise (a) a heavy chain comprising (i) a VH as described in any one of Tables 1-3 and (ii) a combination of one or more heavy chain constant domains (e.g., CH1, hinge, CH2, and CH3); and (b) a light chain comprising (i) a VL as described in any one of Tables 1-3 and (ii) a combination of a light chain constant domain (CL or CL1) in IgG form. Exemplary 5T4-binding agents (e.g., antibodies or ADCs) comprise an IgG heavy chain comprising any VH sequence as described herein and the amino acid sequence of SEQ ID NO: 69 or 70, and a light chain comprising any VL sequence as described herein and the amino acid sequence of SEQ ID NO: 71.
[0084] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including six CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 identified in Table 1. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including six CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 identified in Table 2. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including six CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 identified in Table 3. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including six CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and / or VL CDR3 identified in Tables 1, 2, and / or 3.
[0085] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs including the three VH CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, listed in Table 1. In other embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs including the three VL CDRs, e.g., VL CDR1, VL CDR2, and / or VL CDR3, listed in Table 1. In other embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including three VH CDRs listed in Table 1, e.g., VH CDR1, VH CDR2, VH CDR3, and one or more CDRs, including three VL CDRs listed in Table 1, e.g., VL CDR1, VL CDR2, and / or VL CDR3.
[0086] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs including three VH CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, listed in Table 2. In other embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs including three VL CDRs, e.g., VL CDR1, VL CDR2, and / or VL CDR3, listed in Table 2. In other embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including three VH CDRs listed in Table 2, e.g., VH CDR1, VH CDR2, VH CDR3, and one or more CDRs, including three VL CDRs listed in Table 2, e.g., VL CDR1, VL CDR2, and / or VL CDR3.
[0087] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs including three VH CDRs, e.g., VH CDR1, VH CDR2, VH CDR3, listed in Table 3. In other embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs including three VL CDRs, e.g., VL CDR1, VL CDR2, and / or VL CDR3, listed in Table 3. In other embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies or ADCs), including human 5T4-binding agents, comprise one or more CDRs, including three VH CDRs listed in Table 3, e.g., VH CDR1, VH CDR2, VH CDR3, and one or more CDRs, including three VL CDRs listed in Table 3, e.g., VL CDR1, VL CDR2, and / or VL CDR3.
[0088] In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies) comprise one or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-24, 27-43, or 46-61. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies, or ADCs) comprise two or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-24, 27-43, or 46-61. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies, or ADCs) comprise three or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-24, 27-43, or 46-61. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies, or ADCs) comprise four or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-24, 27-43, or 46-61. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies, or ADCs) comprise five or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-24, 27-43, or 46-61. In some embodiments, the 5T4-binding agents described herein (e.g., antibodies, such as bispecific antibodies, or ADCs) comprise six or more complementarity determining regions (CDRs) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-24, 27-43, or 46-61.
[0089] In some embodiments, the 5T4-binding agents (e.g., antibodies, such as bispecific antibodies or ADCs) described herein comprise one or more (e.g., one, two, or three) VH CDRs listed in Tables 1-3. In other embodiments, the 5T4-binding agents (e.g., antibodies, such as bispecific antibodies or ADCs) described herein comprise one or more (e.g., one, two, or three) VL CDRs listed in Tables 1-3. In other embodiments, the 5T4-binding agents (e.g., antibodies, such as bispecific antibodies or ADCs) described herein comprise one or more (e.g., one, two, or three) VH CDRs listed in Tables 1-3 and one or more VL CDRs listed in Tables 1-3. Thus, in some embodiments, the 5T4-binding agents (e.g., antibodies, such as bispecific antibodies or ADCs) described herein comprise a VH CDR1 having the amino acid sequence of any one of SEQ ID NOs: 1, 7, 12, 13, 18, 27, 31, 34, 35, 39, 46, 50, 53, and 57. In some embodiments, a 5T4-binding agent (e.g., an antibody, such as a bispecific antibody, or ADC) described herein comprises a VH CDR2 having an amino acid sequence of any one of SEQ ID NOs: 2, 8, 14, 19, 24, 28, 32, 36, 40, 43, 47, 51, 54, 58, and 61. In some embodiments, a 5T4-binding agent (e.g., an antibody, such as a bispecific antibody, or ADC) described herein comprises a VH CDR3 having an amino acid sequence of any one of SEQ ID NOs: 3, 9, 15, 20, 29, 33, 37, 41, 48, 52, 55, and 59. In some embodiments, a 5T4-binding agent (e.g., an antibody, such as a bispecific antibody, or ADC) described herein comprises a VH CDR1 and / or a VH CDR2 and / or a VH CDR3 independently selected from the VH CDR1, VH CDR2, VH CDR3 depicted in any one of the amino acid sequences depicted in Tables 1-3. In some embodiments, a 5T4-binding agent (e.g., an antibody, such as a bispecific antibody, or ADC) described herein comprises a VL CDR1 having an amino acid sequence of any one of SEQ ID NOs: 4, 10, 16, and 21. In another embodiment, a 5T4-binding agent (e.g., an antibody, such as a bispecific antibody, or ADC) described herein comprises a VL CDR2 having an amino acid sequence of any one of SEQ ID NOs: 5, 11, and 22. In some embodiments, a 5T4-binding agent (e.g., an antibody, such as a bispecific antibody, or ADC) described herein comprises a VL CDR3 having an amino acid sequence of any one of SEQ ID NOs: 6, 17, 23, 30, 38, 42, 49, 56, and 60.In some embodiments, a 5T4-binding agent described herein (e.g., an antibody, such as a bispecific antibody or ADC) comprises a VL CDR1 and / or VL CDR2 and / or VL CDR3 independently selected from the VL CDR1, VL CDR2, VL CDR3 depicted in any one of the amino acid sequences depicted in Tables 1-3.
[0090] In some embodiments, a 5T4-binding agent described herein (e.g., an antibody, such as a bispecific antibody or ADC) comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 1, 27, or 46, (ii) SEQ ID NO: 7, 31, or 50, (iii) SEQ ID NO: 12, 34, or 53, (iv) SEQ ID NO: 13 or 35, and (v) SEQ ID NO: 18, 39, or 57; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 2, 28, or 47, (ii) SEQ ID NO: 8, 32, or 51, (iii) SEQ ID NO: 14, 36, or 54, (iv) SEQ ID NO: 19, 40, or 58, and (v) SEQ ID NO: NO: 24, 43 or 61; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 3, 29 or 48, (ii) SEQ ID NO: 9, 33 or 52, (iii) SEQ ID NO: 15, 37 or 55, and (iv) SEQ ID NO: 20, 41 or 59; and / or a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 4, (ii) SEQ ID NO: 10, (iii) SEQ ID NO: 16, and (iv) SEQ ID NO: 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 5, (ii) SEQ ID NO: 11, and (iii) SEQ ID NO: 22; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 3, 29 or 48, (ii) SEQ ID NO: 9, 33 or 52, (iii) SEQ ID NO: 15, 37 or 55, and (iv) SEQ ID NO: 20, 41 or 59. NO: 6, 30 or 49, (ii) SEQ ID NO: 17, 38 or 56, and (iii) SEQ ID NO: 23, 42 or 60.
[0091] In some embodiments, a 5T4-binding agent described herein (e.g., an antibody, such as a bispecific antibody or ADC) comprises a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 1, 27, or 46, (ii) SEQ ID NO: 7, 31, or 50, (iii) SEQ ID NO: 12, 34, or 53, (iv) SEQ ID NO: 13 or 35, and (v) SEQ ID NO: 18, 39, or 57; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 2, 28, or 47, (ii) SEQ ID NO: 8, 32, or 51, (iii) SEQ ID NO: 14, 36, or 54, (iv) SEQ ID NO: 19, 40, or 58, and (v) SEQ ID NO: NO: 24, 43 or 61; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 3, 29 or 48, (ii) SEQ ID NO: 9, 33 or 52, (iii) SEQ ID NO: 15, 37 or 55, and (iv) SEQ ID NO: 20, 41 or 59.
[0092] In some embodiments, a 5T4-binding agent described herein (e.g., an antibody, such as a bispecific antibody or ADC) comprises a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 4, (ii) SEQ ID NO: 10, (iii) SEQ ID NO: 16, and (iv) SEQ ID NO: 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 5, (ii) SEQ ID NO: 11, and (iii) SEQ ID NO: 22; and (3) a VLCR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 6, 30, or 49, (ii) SEQ ID NO: 17, 38, or 56, and (iii) SEQ ID NO: 23, 42, or 60.
[0093] In some embodiments, described herein are antibodies or fragments thereof that bind to 5T4, wherein the antibodies or fragments thereof comprise: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 1, 27, or 46, (ii) SEQ ID NO: 7, 31, or 50, (iii) SEQ ID NO: 12, 34, or 53, (iv) SEQ ID NO: 13, or 35, and (v) SEQ ID NO: 18, 39, or 57; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 2, 28, or 47, (ii) SEQ ID NO: 8, 32, or 51, (iii) SEQ ID NO: 14, 36, or 54, (iv) SEQ ID NO: 19, 40, or 58, and (v) SEQ ID NO: 24, 43, or 61; and (3) a VH having an amino acid sequence selected from the group consisting of: NO: 22; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 6, 30 or 49, (ii) SEQ ID NO: 17, 38 or 56, and (iii) SEQ ID NO: 20, 41 or 59. NO: 23, 42 or 60.
[0094] In some embodiments, described herein are antibodies or fragments thereof that bind to 5T4, wherein the antibodies or fragments thereof comprise a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 1, 27, or 46, (ii) SEQ ID NO: 7, 31, or 50, (iii) SEQ ID NO: 12, 34, or 53, (iv) SEQ ID NO: 13, or 35, and (v) SEQ ID NO: 18, 39, or 57; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 2, 28, or 47, (ii) SEQ ID NO: 8, 32, or 51, (iii) SEQ ID NO: 14, 36, or 54, (iv) SEQ ID NO: 19, 40, or 58, and (v) SEQ ID NO: 24, 43, or 61; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of: CDR3: (i) SEQ ID NO: 3, 29 or 48, (ii) SEQ ID NO: 9, 33 or 52, (iii) SEQ ID NO: 15, 37 or 55, and (iv) SEQ ID NO: 20, 41 or 59.
[0095] In some embodiments, described herein are antibodies or fragments thereof that bind to 5T4, wherein the antibodies or fragments thereof comprise a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 4, (ii) SEQ ID NO: 10, (iii) SEQ ID NO: 16, and (iv) SEQ ID NO: 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 5, (ii) SEQ ID NO: 11, and (iii) SEQ ID NO: 22; and (3) a VLCDR3 having an amino acid sequence selected from the group consisting of: (i) SEQ ID NO: 6, 30, or 49, (ii) SEQ ID NO: 17, 38, or 56, and (iii) SEQ ID NO: 23, 42, or 60.
[0096] In some embodiments, antibodies or fragments thereof that bind to 5T4 are described herein and comprise all three heavy chain complementarity determining regions (CDRs) and / or all three light chain CDRs from the antibody designated mAbA4, comprising a VH sequence of SEQ ID NO: 25 and a VL sequence of SEQ ID NO: 26; the antibody designated mAbA15, comprising a VH sequence of SEQ ID NO: 44 and a VL sequence of SEQ ID NO: 45; or the antibody designated mAbA17, comprising a VH sequence of SEQ ID NO: 62 and a VL sequence of SEQ ID NO: 63. In some embodiments, the antibody or fragment thereof comprises all three heavy chain CDRs and / or all three light chain CDRs from the antibody designated mAbA4. In some embodiments, the antibody or fragment thereof comprises all three heavy chain CDRs and / or all three light chain CDRs from the antibody designated mAbA15. In some embodiments, the antibody or fragment thereof comprises all three heavy chain CDRs and / or all three light chain CDRs from the antibody designated mAbA17.
[0097] In some embodiments, antibodies or fragments thereof that bind to 5T4 are described herein, wherein the antibody comprises: (a) a heavy chain variable (VH) region comprising the VH CDR1, VH CDR2, and VH CDR3 amino acid sequences depicted in Tables 1-3; and / or (b) a light chain variable (VL) region comprising the VL CDR1, VL CDR2, and VL CDR3 amino acid sequences depicted in Tables 1-3. In some embodiments, the antibody comprises a heavy chain variable (VH) region comprising the VH CDR1, VH CDR2, and VH CDR3 amino acid sequences depicted in Tables 1-3. In some embodiments, the antibody comprises a light chain variable (VL) region comprising the VL CDR1, VL CDR2, and VL CDR3 amino acid sequences depicted in Tables 1-3.
[0098] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 8, 14, 19, and 24; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 9, 15, and 20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 17, and 23.
[0099] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 1; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 2; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 6.
[0100] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 7; (2) a VHCDR2 having an amino acid sequence of SEQ ID NO: 8; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 9; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 10; (2) a VLCDR2 having an amino acid sequence of SEQ ID NO: 11; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 6.
[0101] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 12; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 2; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 6.
[0102] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 13; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 14; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 15; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 11; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 17.
[0103] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 18; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 19; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 20; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 21; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 22; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 23.
[0104] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 1; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 24; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 3; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 6.
[0105] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 27, 31, 34, 35, and 39; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 28, 32, 36, 40, and 43; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 33, 37, and 41; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22, and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 38, and 42.
[0106] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 27; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 28; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 29; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 30.
[0107] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 31; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 32; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 33; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 10; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 11; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 30.
[0108] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 34; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 28; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 29; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 30.
[0109] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 35; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 36; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 37; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 16; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 11; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 38.
[0110] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 39; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 40; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 41; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 21; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 22; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 42.
[0111] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 27; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 43; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 29; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 30.
[0112] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 46, 50, 53, and 57; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 47, 51, 54, 58, and 61; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 48, 52, 55, and 59; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22; and (3) a VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 49, 56, and 60.
[0113] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 46; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 47; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 48; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 49.
[0114] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 50; (2) a VHCDR2 having an amino acid sequence of SEQ ID NO: 51; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 52; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 10; (2) a VLCDR2 having an amino acid sequence of SEQ ID NO: 11; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 49.
[0115] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 53; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 47; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 48; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 49.
[0116] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 13; (2) a VHCDR2 having an amino acid sequence of SEQ ID NO: 54; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 55; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 16; (2) a VLCDR2 having an amino acid sequence of SEQ ID NO: 11; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 56.
[0117] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 57; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 58; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 59; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 21; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 22; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 60.
[0118] In some embodiments, described herein is an antibody comprising: (a) a heavy chain variable (VH) region comprising: (1) a VH CDR1 having an amino acid sequence of SEQ ID NO: 46; (2) a VH CDR2 having an amino acid sequence of SEQ ID NO: 61; and (3) a VH CDR3 having an amino acid sequence of SEQ ID NO: 48; and (b) a light chain variable (VL) region comprising: (1) a VL CDR1 having an amino acid sequence of SEQ ID NO: 4; (2) a VL CDR2 having an amino acid sequence of SEQ ID NO: 5; and (3) a VL CDR3 having an amino acid sequence of SEQ ID NO: 49.
[0119] In some embodiments, described herein are antibodies comprising the VH and / or VL regions described herein, wherein the VH and / or VL regions comprise human framework sequences. In some embodiments, the VH and / or VL regions comprise framework 1 (FR1), framework 2 (FR2), framework 3 (FR3), and / or framework 4 (FR4) sequences, e.g., human FR1, human FR2, human FR3, and / or human FR4.
[0120] In some embodiments, the antibodies disclosed herein are monoclonal antibodies. In some embodiments, the monoclonal antibodies are humanized, human or chimeric antibodies. In some embodiments, the antibodies described herein are Fab, Fab', F(ab')2, Fv, scFv, (scFv)2, single-chain antibody molecules, dual variable region antibodies, single variable region antibodies, linear antibodies, V regions or multispecific antibodies formed by antibody fragments.
[0121] In some embodiments, described herein are binding agents that bind to substantially the same epitope as an antibody or fragment thereof of any of the antibodies described herein. In some embodiments, described herein are binding agents that compete with an antibody or fragment thereof for binding to human 5T4. In some embodiments, the binding agent is an antibody or fragment thereof or an ADC comprising an antibody or fragment thereof.
[0122] In certain aspects, the CDRs of a 5T4-binding agent (e.g., an antibody or ADC), including human 5T4-binding agents, can be determined according to the Kabat system (Kabat et al. (1971) Ann. NY Acad. Sci. 190:382-391 and Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, US Department of Health and Human Services, NIH Publication No. 91-3242).
[0123] In certain aspects, the CDRs of a 5T4 binder (e.g., an antibody or ADC), including a human 5T4 binder, can be determined according to the Chothia system, which will be referred to herein as "Chothia CDRs" (see, e.g., Chothia and Lesk, 1987, J. Mol. Biol., 196:901-917; Al-Lazikanie et al., 1997, J. Mol. Biol., 273:927-948; Chothia et al., 1992, J. Mol. Biol., 227:799-817; Tramontano A et al., 1990, J. Mol. Biol. 215(1):175-82; and U.S. Pat. No. 7,709,226).
[0124] In certain aspects, the CDRs of a 5T4 binder (e.g., an antibody or ADC), including a human 5T4 binder, can be prepared according to ImMunoGeneTics The IMGT CDRs can be determined systematically, for example, as described in Lefranc, M.-P., 1999, The Immunologist, 7: 132-136 and Lefranc, M.-P. et al., 1999, Nucleic Acids Res., 27: 209-212 ("IMGT CDRs").
[0125] In certain aspects, the CDRs of a 5T4-binding agent (e.g., an antibody or ADC) (including human 5T4-binding agents) can be determined according to the AbM system, which will be referred to herein as "AbM CDRs," e.g., as described in MacCallum et al., 1996, J. Mol. Biol., 262: 732-745. See also, e.g., Martin, A., "Protein Sequence and Structure Analysis of Antibody Variable Domains," Antibody Engineering, Kontermann and Dübel, eds., Chapter 31, pp. 422-439, Springer-Verlag, Berlin (2001).
[0126] In certain aspects, the CDRs of a 5T4 binder (e.g., an antibody or ADC) (including human 5T4 binders) can be determined according to the Contact system, which will be referred to herein as "Contact CDRs" (see, e.g., MacCallum RM et al., 1996, J Mol Biol 5:732-745). Contact CDRs are based on analysis of available complex crystal structures.
[0127] In some embodiments, the position of one or more CDRs along the VH (e.g., CDR1, CDR2, or CDR3) and / or VL (e.g., CDR1, CDR2, or CDR3) regions of a 5T4-binding agent (e.g., an antibody or ADC) described herein (including a human 5T4-binding agent) can be varied by one, two, three, four, five, or six amino acid positions, so long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%). For example, in some embodiments, the positions of the CDRs defining any of Table 1, Table 2, or Table 3 can be altered by shifting the N-terminal and / or C-terminal boundaries of the CDRs by one, two, three, four, five, or six amino acids relative to the current CDR positions, so long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%). In other embodiments, the length of one or more CDRs of the VH (e.g., CDR1, CDR2, or CDR3) and / or VL (e.g., CDR1, CDR2, or CDR3) regions of the 5T4-binding agents (e.g., antibodies or ADCs) described herein (including human 5T4-binding agents) can be varied (e.g., shorter or longer) by one, two, three, four, five, or more amino acids, so long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%). For example, in some embodiments, the VH and / or VL CDR1, CDR2, and / or CDR3 described herein can be one, two, three, four, five, or more amino acids shorter than one or more of the CDRs set forth in SEQ ID NOs: 1-24, 27-43, or 46-61, as long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%). In other embodiments, the VH and / or VL CDR1, CDR2, and / or CDR3 described herein can be one, two, three, four, five, or more amino acids longer than one or more of the CDRs set forth in SEQ ID NOs: 1-24, 27-43, or 46-61, as long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%).In some embodiments, the amino terminus of the VH and / or VL CDR1, CDR2 and / or CDR3 described herein can be shortened or extended by one, two, three, four, five, or more amino acids compared to one or more CDRs set forth in SEQ ID NOs: 1-24, 27-43, or 46-61, as long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%). Additionally or alternatively, in some embodiments, the carboxyl termini of the VH and / or VL CDR1, CDR2, and / or CDR3 described herein can be shortened or lengthened by one, two, three, four, five, or more amino acids compared to one or more CDRs described in SEQ ID NOs: 1-24, 27-43, or 46-61, as long as binding to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, such as at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%). Whether binding to 5T4 (e.g., human 5T4) is maintained can be determined using any method known in the art, such as the binding assays and conditions described in the "Examples" section herein. For example, Example 2 described herein describes an assay for measuring binding to 5T4 (e.g., human 5T4).
[0128] In other embodiments, the 5T4 binding agents (e.g., antibodies or ADCs) proposed herein that bind to 5T4, including human 5T4 binding agents, further comprise conservative sequence modifications. For polypeptides as 5T4 binding agents (e.g., antibodies), such as human 5T4 binding agents, conservative sequence modifications include conservative amino acid substitutions, wherein the conservative amino acid substitutions include those in which the amino acid residues are replaced by amino acid residues with similar side chains. Families of amino acid residues with similar side chains have been defined in the art. Therefore, in some embodiments, the non-essential amino acid residues predicted in 5T4 are replaced by another amino acid residue from the same side chain family. Methods for identifying conservative amino acid substitutions that do not eliminate antigen binding and nucleotide sequences encoding the same are well known in the art (see, e.g., Brummell et al., Biochem. 32: 1180-1187 (1993); Kobayashi et al., Protein Eng. 12(10): 879-884 (1999); and Burks et al., Proc. Natl. Acad. Sci. USA 94: 412-417 (1997)). In some embodiments, the conservative sequence modifications described herein modify the amino acid sequence of a 5T4 binder (e.g., an antibody or ADC) (including a human 5T4 binder) by 50%, or 55%, or 60%, or 65%, or 70%, or 75%, or 80%, or 85%, or 90%, or 95%, or 98%, or 99%. In some embodiments, amino acid sequence modifications refer to up to 1, 2, 3, 4, 5, or 6 amino acid substitutions to a CDR (such as those described in any of Tables 1-3). Thus, for example, each such CDR may contain up to 5 conservative amino acid substitutions, such as up to (no more than) 4 conservative amino acid substitutions, such as up to (no more than) 3 conservative amino acid substitutions, such as up to (no more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution. In some embodiments, a 5T4-binding agent (e.g., an antibody) (including a human 5T4-binding agent) contains one or more (including six) CDRs that are at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a CDR of mAbA4, mAbA15, or mAbA17 (see, e.g., Table 1, Table 2, or Table 3). In some embodiments, 5T4-binding agents (e.g., antibodies), including human 5T4-binding agents, contain VH and VL comprising CDRs identical to those of mAbA4, mAbA15, or mAbA17 (see, e.g., Table 1, Table 2, or Table 3). In some embodiments, the amino acid sequence modifications do not include any modifications within the SDRs. In some embodiments, the amino acid sequence modifications do not include any modifications within the CDRs (such as CDR1, CDR2, CDR3, or any combination thereof). In other embodiments, the amino acid sequence modifications are in the framework or constant regions.
[0129] In some embodiments, provided herein is an antibody or fragment thereof comprising a VH comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 25 and a VL comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 26, and binding of the antibody or fragment thereof to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%).
[0130] In some embodiments, provided herein is an antibody or fragment thereof comprising a VH comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 44 and a VL comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 45, and binding of the antibody or fragment thereof to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%).
[0131] In some embodiments, provided herein is an antibody or fragment thereof comprising a VH comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 62 and a VL comprising an amino acid sequence at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 63, and binding of the antibody or fragment thereof to 5T4 (e.g., human 5T4) is maintained (e.g., substantially maintained, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%).
[0132] The present disclosure provides 5T4 binding agents (e.g., antibodies) having a masking portion and / or a cleavable portion, wherein one or more 5T4 binding domains of the 5T4 binding agent (e.g., antibody) are masked (e.g., via a masking portion) and / or activatable (e.g., via a cleavable portion). Techniques for masking 5T4 binding agents (e.g., antibodies) are well known in the art, including SAFEbody masking technology (see, e.g., U.S. Patent Application Publication No. 2019 / 0241886) and Probody masking technology (see, e.g., U.S. Patent Application Publication No. 2015 / 0079088). Such techniques can be used to generate masked and / or activatable 5T4 binding agents (e.g., antibodies). Such masked and / or activatable 5T4 binding agents (e.g., antibodies) can be used to prepare conjugates comprising any of the 5T4 binding agents (e.g., antibodies) of the present disclosure, such as human 5T4 binding agents, including immunoconjugates, ADCs, masked ADCs, and activatable antibody-drug conjugates (AADCs), including those directly or indirectly linked to another agent, such as a drug. For example, a 5T4 binding agent (e.g., an antibody) of the present disclosure, such as a human 5T4 binding agent, can be covalently bound to one or more agents, such as a drug, via a synthetic linker.
[0133] If desired, the 5T4 binder (e.g., antibody) (including human 5T4 binders) is linked or conjugated (directly or indirectly) to a moiety having effector function, such as cytotoxic activity (e.g., chemotherapeutic moiety or radioisotope) or immune recruitment activity. The moiety to be linked or conjugated (directly or indirectly) includes a cytotoxic drug (e.g., a toxin such as aurostatin) or a non-cytotoxic drug (e.g., a signal transduction regulator such as a kinase); or a masking moiety that masks one or more binding domains of the 5T4 binder (e.g., antibody); or a cleavable moiety that allows one or more binding domains of the masked conjugate of the 5T4 binder (e.g., antibody) to be unmasked in the tumor microenvironment by cleavage of the cleavable moiety, thereby activating the 5T4 binder. Moieties that promote immune recruitment may include other antigen binding agents, such as viral proteins that selectively bind to cells of the innate and / or adaptive immune systems. Alternatively or additionally, 5T4-binding agents (e.g., antibodies), including human 5T4-binding agents, are optionally linked or conjugated (directly or indirectly) to a moiety that facilitates separation from a mixture (e.g., a tag) or a moiety with reporter activity (e.g., a detection marker or reporter protein). It should be understood that the features of the 5T4-binding agents (e.g., antibodies), including human 5T4-binding agents, described herein also extend to polypeptides comprising 5T4-binding agent fragments.
[0134] In some embodiments, the 5T4-binding agents (e.g., antibodies) described herein that bind to human 5T4, including 5T4-binding agents, can be linked or conjugated (directly or indirectly) to a polypeptide, which can result in the production of an activatable antibody. In some embodiments, the 5T4-binding agent (e.g., antibody) (including human 5T4-binding agent) is linked or conjugated (directly or indirectly) to another agent. In some embodiments, the other agent is a drug, resulting in an ADC, or when the antibody of the ADC comprises a masking moiety and a cleavable moiety, an AADC is produced.
[0135] In some embodiments, the 5T4-binding agents (e.g., antibodies) described herein (including human 5T4-binding agents) are conjugated or recombinantly linked (directly or indirectly) to a therapeutic agent (e.g., a cytotoxic agent) or a diagnostic or detectable agent. The conjugated or recombinantly linked antibodies, including masked or activatable conjugates, can be used, for example, to treat or prevent a disease, disorder, or condition, such as a 5T4-mediated disease, disorder, or condition. The conjugated or recombinantly linked 5T4-binding agents (e.g., antibodies), including masked or activatable conjugates, can be used, for example, to monitor or predict the onset, development, progression, and / or severity of a 5T4-mediated disease, disorder, or condition.
[0136] Such diagnosis and detection can be accomplished, for example, by coupling a 5T4 binding agent (e.g., an antibody) to a detectable substance, including, for example: an enzyme, including but not limited to horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; a prosthetic group, including but not limited to streptavidin / biotin or avidin / biotin; a fluorescent material, including but not limited to umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinamine fluorescein, dansyl chloride, or phycoerythrin; a luminescent material, including but not limited to luminol; a bioluminescent material, including but not limited to luciferase, luciferin, or aequorin; a chemiluminescent material, including but not limited to acridinium-based compounds or halogenated tags; a radioactive material, including but not limited to iodine ( 131 i. 125 I. 123 I and 121 I), carbon ( 14 C), sulfur ( 35 S), tritium (3H), indium ( 115 In, 113 In, 112 In and 111 In), technetium ( 99 Tc), thallium ( 201 Ti), gallium ( 68 Ga and 67 Ga), Palladium ( 103 Pd), molybdenum ( 99 Mo), xenon ( 133 Xe), fluorine ( 18F), 153 Sm, 177 Lu, 159 Gd, 149 Pm, 140 La, 175 Y b, 166 Ho, 90 Y. 47 Sc, 186 Re、 188 Re、 142 Pr, 105 Rh, 97 Such as 68 Ge, 57 Co、 65 Zn, 85 Sr. 32 P. 153 Gd, 169 Yb, 51 Cr, 54 Mn, 75 Se, 113 Sn, or 117 Sn; positron-emitting metals using various positron emission tomography techniques; and non-radioactive paramagnetic metal ions.
[0137] Also described herein are 5T4-binding agents (e.g., antibodies) that are recombinantly linked or conjugated (covalently or non-covalently, directly or indirectly) to a heterologous protein or polypeptide (or fragment thereof, e.g., to a polypeptide (e.g., about 10, about 20, about 30, about 40, about 50, about 60, about 70, about 80, about 90, or about 100 amino acids) to produce a fusion protein, and their uses. Specifically, described herein are fusion proteins that comprise an antigen binding site of a 5T4-binding agent (e.g., antibody) (including a human 5T4-binding agent) described herein. In some embodiments, the 5T4 binding agent (e.g., an antibody) can be linked to a heterologous protein, polypeptide, or peptide. In some embodiments, the heterologous protein, polypeptide, or peptide linked to a 5T4 binding agent (e.g., an antibody) can be used to target the 5T4 binding agent to specific cells (e.g., cells expressing 5T4, including tumor cells). Other non-limiting heterologous proteins, polypeptides, or peptides linked to a 5T4 binding agent (e.g., an antibody) can be used as internalization signals or immune cell engagers.
[0138] In addition, the 5T4 binding agents (e.g., antibodies) described herein, including human 5T4 binding agents, can be linked (directly or indirectly) to a marker or "tag" sequence, such as a peptide, to facilitate purification. In some embodiments, the marker or tag amino acid sequence is a hexahistidine peptide, such as the tag provided in the pQE vector (see, e.g., QIAGEN, Inc.), many of which are commercially available. For example, as described in Gentz et al., 1989, Proc. Natl. Acad. Sci. USA 86:821-24, hexahistidine provides convenient purification of fusion proteins. Other peptide tags that can be used for purification include, but are not limited to, the hemagglutinin ("HA") tag (which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Cell 37:767-78)) and the "FLAG" tag.
[0139] Methods for linking or conjugating moieties, including polypeptides, to antibodies (directly or indirectly) are well known in the art, any of which can be used to prepare the antibody-drug conjugates or fusion proteins described herein.
[0140] In some embodiments, the 5T4 binding agents (e.g., antibodies) described herein are fusion proteins. As used herein, the term "fusion protein" refers to a polypeptide comprising the amino acid sequence of a binding agent (e.g., an antibody) and the amino acid sequence of a heterologous polypeptide or protein (e.g., a polypeptide or protein that is not typically a part of an antibody). In certain embodiments, the fusion protein retains the biological activity of the 5T4 binding agent. In certain embodiments, the fusion protein comprises a 5T4 antibody VH region, a VL region, a VH CDR (one, two, or three VH CDRs) and / or a VL CDR (one, two, or three VL CDRs), wherein the fusion protein binds to a 5T4 epitope, a 5T4 fragment, and / or a 5T4 polypeptide.
[0141] Fusion proteins can be produced, for example, by the techniques of gene shuffling, motif shuffling, exon shuffling, and / or codon shuffling (collectively referred to as "DNA shuffling"). DNA shuffling can be used to alter the activity of 5T4 binders (e.g., antibodies), including human 5T4 binders as described herein, including, for example, 5T4 binders with higher affinity and lower off-rates (see, e.g., U.S. Patent Nos. 5,605,793; 5,811,238; 5,830,721; 5,834,252; and 5,837,458; Patten et al., 1997, Curr. Opinion Biotechnol. 8:724-33; Harayama, 1998, Trends Biotechnol. 16(2):76-82; Hansson et al., 1999, J. Mol. Biol. 287:265-76; and Lorenzo and Blasco, 1998, Biotechniques 24(2):308-13). In some embodiments, 5T4 binders (including human 5T4 binders) can be altered by random mutagenesis by error-prone PCR, random nucleotide insertion, or other methods prior to recombination. Polynucleotides encoding 5T4 binders described herein can be recombined with one or more components, motifs, segments, parts, domains, fragments, etc. of one or more heterologous molecules.
[0142] The 5T4 binding agents (e.g., antibodies) described herein (including human 5T4 binding agents) can also be attached to a solid support, which can be used for immunoassays or purification of the target antigen. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride, or polypropylene.
[0143] The 5T4-binding agents (eg, antibodies) described herein (including human 5T4-binding agents) also can be linked or conjugated (directly or indirectly) to a second antibody to form an antibody heteroconjugate.
[0144] The linker can be a "cleavable moiety" that facilitates release of the attached or conjugated reagent in the cell, but non-cleavable linkers are also encompassed herein. Linkers for use in the conjugates (e.g., ADCs or AADCs) of the present disclosure include, but are not limited to, acid-labile linkers (e.g., hydrazone linkers), disulfide-containing linkers, peptidase-sensitive linkers (e.g., peptide linkers comprising amino acids such as valine and / or citrulline, such as citrulline-valine or phenylalanine-lysine), photolabile linkers, dimethyl linkers, thioether linkers, or hydrophilic linkers designed to evade multidrug transporter-mediated resistance.
[0145] Conjugates of antibodies and agents, including those wherein the agent is a drug for preparing an ADC or an AADC, can be prepared using a variety of bifunctional protein coupling agents, such as N-(β-maleimidopropyloxy) succinimide ester (BMPS); N-ε-maleimidocaproyl-oxysuccinimide ester (ECMS); N-γ-maleimidocaproyl-oxysuccinimide ester (GMBS); 1,6-hexane-bis-vinyl sulfone (HBVS); succinimidyl-4-(-N-maleimidomethyl)cyclohexane; alkane-1-carboxyl-(6-amidohexanoate))(LC-SMCC); m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS); 4-(4-N-maleimidophenyl)butyric acid hydrazide (MPBH); succinimidyl 3-(bromoacetamido) propionate (SBAP); succinimidyl iodoacetate (SIA); succinimidyl (4-iodoacetyl) aminobenzoate (SIAB); succinimidyl-4-(N-maleimidomethyl)cyclohexane alkane-1-carboxylate (SMCC); succinimidyl 4-(p-maleimidophenyl) butyrate (SMPB); succinimidyl-6-(β-maleimidopropionamido) hexanoate (SMPH); N-(ε-maleimidocaproyloxy)sulfosuccinimide ester (sulfo-ECMS); N-(γ-maleimidobutyloxy)sulfosuccinimide ester (sulfo-GMBS); N-(κ-maleimidoundecanoyloxy)sulfosuccinimide ester (sulfo-K MUS); m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester (sulfo-MBS); sulfosuccinimidyl (4-iodo-acetyl)aminobenzoate (sulfo-SIAB); sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate (sulfo-SMCC); sulfosuccinimidyl 4-(p-maleimidophenyl)butyrate (sulfo-SMPB); and succinimidyl-(4-vinylsulfone)benzoate) (SVSB).
[0146] The present disclosure also contemplates that conjugates of antibodies and agents, including those where the agent is a drug for use in preparing an ADC or AADC, can be prepared using any suitable method disclosed in the art (see, e.g., Bioconiugate Techniques (Ed. Hermanson, 2nd ed., 2008)).
[0147] Conventional conjugation strategies for antibodies and agents (including where the agent is a drug for the preparation of an ADC or AADC) are based on random conjugation chemistry involving the ε-amino group of a Lys residue or the thiol group of a Cys residue, which results in heterogeneous conjugates. Recently developed technologies allow for site-specific conjugation to antibodies, resulting in homogeneous loading and avoiding conjugate subpopulations with altered antigen binding or pharmacokinetics. These include the engineering of "thiomas," which contain cysteine substitutions that provide reactive thiol groups at positions on the heavy and light chains and do not disrupt immunoglobulin folding and assembly or alter antigen binding (see, e.g., Junutula et al., 2008, J. Immunol. Meth. 332: 41-52; and Junutula et al., 2008, Nature Biotechnol. 26: 925-32). In another approach, selenocysteine was co-translationally inserted into the antibody sequence by recoding the stop codon UGA from stop to selenocysteine insertion, allowing site-specific covalent conjugation at the nucleophilic selenol group of selenocysteine in the presence of other natural amino acids (see, e.g., Hofer et al., 2008, Proc. Natl. Acad. Sci. USA 105: 12451-56; and Hofer et al., 2009, Biochemistry 48(50): 12047-57).
[0148] In some embodiments, the 5T4 binding agents (e.g., antibodies) described herein (including human 5T4 binding agents) are conjugated to a cytotoxic agent. In some embodiments, the 5T4 binding agents (e.g., antibodies) disclosed herein (including human 5T4 binding agents) can be optionally conjugated to one or more cytotoxic agents disclosed herein or known in the art to produce an ADC or AADC. In some embodiments, the cytotoxic agent is a chemotherapeutic agent, including but not limited to methotrexate, adriamycin, doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin, or other intercalating agents. In some embodiments, the cytotoxic agent is an enzymatically active toxin or fragment thereof of bacterial, fungal, plant, or animal origin, including but not limited to diphtheria A chain, non-binding active fragments of diphtheria toxin, exotoxin A chain, ricin A chain, abrin A chain, modicin A chain, α-sarcin, Aleurites fordii protein, dianthus protein, pokeweed protein (PAPI, PAPII, and PAP-S), bitter melon inhibitor, curcin, croton protein, Sapaonaria officinalis inhibitor, gelonin, mitogellin, limitomycin, phenomycin, enomycin, and tricothecenes. In some embodiments, the cytotoxic agent is a radioactive isotope used to produce a radioconjugate or radioconjugate. A variety of radionuclides can be used to prepare radioconjugates, including but not limited to 90 Y. 125 I. 131 I. 123 I. 111 In, 131 In, 105 Rh, 153 Sm, 67 Cu, 67 Ga, 166 Ho, 177 Lu, 186 Re、 188 Re and 212Bi. Conjugates of polypeptides or molecules with one or more small molecule toxins (eg, calicheamicins, maytansinoids, trichothecenes, and CC1065, and toxinically active derivatives of these toxins) may also be used. Conjugates of polypeptides or molecules with cytotoxic agents are prepared using a variety of bifunctional protein coupling agents, such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imino esters (e.g., dimethyl adipimidate HCL), active esters (e.g., disuccinimidyl suberate), aldehydes (e.g., glutaraldehyde), bis-azido compounds (e.g., bis(p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (e.g., bis(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (e.g., toluene 2,6-diisocyanate), and bis-active fluorine compounds (e.g., 1,5-difluoro-2,4-dinitrobenzene).
[0149] In some embodiments, the 5T4 binding agents described herein (e.g., antibodies), including human 5T4 binding agents, are conjugated to drugs such as signal transduction regulators, pro-apoptotic agents, mitotic inhibitors, anti-tumor antibiotics, immunomodulators, nucleic acids for gene therapy, alkylating agents, anti-angiogenic agents, antimetabolites, boron-containing agents, chemoprotectants, hormone agents, anti-hormonal agents, corticosteroids, photoactive therapeutic agents, oligonucleotides, radionuclide agents, radiosensitizers, topoisomerase inhibitors, and tyrosine kinase inhibitors. In some embodiments, the mitotic inhibitor is dolastatin, auristatin, maytansinoid, and plant alkaloid. In some embodiments, the drug is dolastatin, auristatin, maytansinoid, and plant alkaloid. Examples of auristatin are monomethyl auristatin F (MMAF) or monomethyl auristatin E (MMAE). Examples of maytansinoids include, but are not limited to, DM1, DM2, DM3, and DM4. In some embodiments, the antitumor antibiotic is selected from the group consisting of actinomycins, anthracyclines, calicheamicins, and duocarmycins. An example of an actinomycin is pyrrolobenzodiazepine (pyrrolobenzodiazepine, PBD). Examples of anthracyclines are PNU-anthracyclines, such as PNU-159682 or a derivative.
[0150] 5T4 binding agents (e.g., antibodies) described herein, including human 5T4 binding agents, can be monospecific, bispecific, trispecific, or have greater multispecificity. Such agents may include monospecific or multispecific antibodies or ADCs. Multispecific antibodies, such as bispecific antibodies, are monoclonal antibodies that have binding specificity for at least two different targets (e.g., antigens) or two different epitopes on the same target (e.g., a bispecific antibody for 5T4 having a first binding domain for a first epitope of 5T4 and a second binding domain for a second epitope of 5T4). In some embodiments, monospecific and multispecific (e.g., bispecific) antibodies or ADCs can be constructed based on the sequences of the antibodies described herein, such as the CDR sequences listed in Tables 1-3. In some embodiments, the multispecific antibodies described herein are bispecific antibodies. In some embodiments, the bispecific antibodies are mouse, chimeric, human, or humanized antibodies. In some embodiments, one binding specificity of the multispecific antibody is for 5T4 and the other is for any other target (e.g., antigen). In some embodiments, a multispecific (e.g., bispecific) antibody can comprise more than one target (e.g., antigen) binding domain, wherein different binding domains are specific for different targets (e.g., a first binding domain that binds 5T4 and a second binding domain that binds another target (e.g., antigen) such as an immune checkpoint modulator (e.g., a negative checkpoint modulator). In some embodiments, a multispecific (e.g., bispecific) antibody molecule can bind to more than one (e.g., two or more) epitopes on the same target (e.g., antigen). In some embodiments, one of the binding specificities is 5T4 and the other is for one or more of the following: cytotoxic T lymphocyte antigen-4 (CTLA-4), CD80, CD86, programmed cell death 1 (PD-1), programmed cell death ligand 2 (PD-L2), lymphocyte activation gene-3 (LAG-3; also known as CD223), galectin-3, B and T lymphocyte attenuator (BTLA), T cell membrane protein 3 (TIM3), galectin-9 (GAL9), BT-H1, BT-H3, BT-H4, T cell immunoreceptor with Ig and ITIM domains (TIGIT / Vstm3 / WUCAM / VSIG9), V domain Ig VISTA, glucocorticoid-induced tumor necrosis factor receptor-related (GITR) protein, herpes virus entry mediator (HVEM), OX40, CD27, CD28, CD137, CGEN-15001T, CGEN-15022, CGEN-15027, CGEN-15049, CGEN-15052, and CGEN-15092.
[0151] Methods for preparing multispecific antibodies are known in the art, for example, by co-expressing two immunoglobulin heavy chain-light chain pairs, wherein the two heavy chains have different specificities (see, for example, Milstein and Cuello, 1983, Nature 305: 537-40). For further details on producing multispecific antibodies (e.g., bispecific antibodies), see, for example, Bispecific Antibodies (Kontermann, ed., 2011).
[0152] Exemplary structures of multispecific antibodies are known in the art and are further described in Weidle et al., 2013, Cancer Genomics & Proteomics 10: 1-18; Brinkman et al., 2017, MABS, 9: 2, 182-212; Godar et al., 2018, Expert Opinion on Therapeutic Patents, 28: 3, 251-276; and Spiess et al., 2015, Mol. Immunol. 67: 95-106.
[0153] For example, bispecific antibody molecules can be divided into different structural groups: (i) bispecific immunoglobulin G (BsIgG); (ii) IgG with additional antigen-binding moieties attached; (iii) bispecific antibody fragments; (iv) bispecific fusion proteins; and (v) bispecific antibody conjugates. As non-limiting examples, BsIgG formats can include crossMab, DAF (two-in-one), DAF (four-in-one), DutaMab, DT-IgG, knobs-in-holes common LC, knobs-in-holes assembly, charge pair, Fab arm exchange, SEEDbody, triomab, LUZ-Y, Fcab, κλ body and / or orthogonal Fab.
[0154] In some embodiments, BsIgG comprises a heavy chain engineered for heterodimerization. For example, a "knobs-in-holes" strategy, a SEED platform, a common heavy chain (e.g., in a κλ body) and a heterodimer Fc region can be used to engineer a heavy chain for heterodimerization. Strategies to avoid homodimer heavy chain pairing in BsIgG are known in the art, including knobs-in-holes, diabodies, asymmetry, charge pairs, HA-TF, SEEDbody, and differential protein A affinity.
[0155] Another bispecific antibody form is the IgG with additional antigen-binding moiety attached.For example, it is possible to engineer monospecific IgG to have bispecificity by attaching additional antigen-binding unit to monospecific IgG, for example, at the N- or C-terminus of heavy or light chain. Exemplary additional antigen-binding unit includes single domain antibodies (for example, variable heavy chain or variable light chain), engineered protein scaffolds and paired antibody variable domains (for example, single chain variable fragment or variable fragment). The non-limiting examples of additional IgG forms include dual variable domain IgG (DVD-Ig), IgG (H)-scFv, scFv-(H) IgG, IgG (L)-scFv, scFv-(L) IgG, IgG (L, H)-Fv, IgG (H)-V, V (H)-IgG, IgG (L)-V, V (L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG-2scFv, scFv4-Ig, zybody and DVI-IgG (four in one). See Spiess et al., Mol. Immunol. 67 (2015): 95-106). In some embodiments, exemplary antibody formats are B-Body formats for monospecific or multispecific (e.g., bispecific antibodies), as described, for example, in International Patent Application Publication No. WO 2018 / 075692 and U.S. Patent Application Publication No. 2018 / 0118811.
[0156] Bispecific antibody fragment (BsAb) is the form of the bispecific antibody molecule lacking some or all of the constant domains of antibodies.For example, some BsAb lack the Fc region.In embodiments, the bispecific antibody fragment includes the heavy chain and light chain region connected by the peptide linker that allows BsAb to be effectively expressed in a single host cell.The limiting examples of bispecific antibody fragments include but are not limited to nanobody, nanobody-HAS, BiTE, diabody, DART, TandAb, scDiabody, scDiabody-CH3, diabody-CH3, three bodies (triple body), miniantibody (miniantibody), miniantibody (minibody), TriBi miniantibody, scFv-CH3 KIH, Fab-scFv, scFv-CH-CL-scFv, F (ab ') 2, F (ab ') 2-scFv2, scFv-KIH, Fab-scFv-Fc, tetravalent HCAb, scDiabody-Fc, diabody-Fc, tandem scFv-Fc and inner antibody.
[0157] Bispecific fusion protein includes the antibody fragment connected with other proteins.For example, bispecific fusion protein can be connected with other proteins to increase extra specificity and / or functionality.In some embodiments, docking lock (dock-and-lock, DNL) method can be used to produce bispecific antibody molecules with higher valence.For example, with albumin binding protein or human serum albumin bispecific antibody fusion can prolong the serum half-life of antibody fragment.In embodiments, chemical conjugation, such as the chemical conjugation of antibody and / or antibody fragment, can be used to produce BsAb molecule.Exemplary bispecific antibody conjugates include CovX-body (CovX-body) form, in which low molecular weight drug site-specifically conjugated to each Fab arm or antibody or its fragment single reactive lysine.In some embodiments, conjugation improves serum half-life.
[0158] Methods for producing multispecific antibodies (including bispecific antibodies) are known in the art. For example, multispecific antibodies (including bispecific antibodies) can be produced by expressing the component antibodies separately in different host cells and then purifying / assembling or by expressing the component antibodies in a single host cell. Purification of multispecific (e.g., bispecific) antibody molecules can be carried out by various methods known in the art (including affinity chromatography).
[0159] In some embodiments, the 5T4 binders (e.g., antibodies) disclosed herein, including human 5T4 binders, can be provided in any antibody format disclosed herein or known in the art. As non-limiting examples, in some embodiments, the 5T4 binders (e.g., antibodies), including human 5T4 binders, can be selected from: Fabs-in-tandem-Ig (FIT-Ig); DVD-Ig; hybrid hybridoma (quadroma or tetradoma); anticalin platform (Pieris); diabodies; single-chain diabodies; tandem single-chain Fv fragments; TandAb, trispecific Ab (Affimed); Darts dual affinity retargeting (Macrogenics); bispecific Xmab (Xencor); bispecific T cell engager (Bites; Amgen; 55kDa); Triplebody; Tribody = Fab-scFv fusion protein multifunctional recombinant antibody derivative (CreativeBiolabs); Duobody platform (Genmab); dock and lock (dock and lock) lock) platform; knobs-into-holes (KIH) platform; humanized bispecific IgG antibody (REGN1979) (Regeneron); Mab2 bispecific antibody (F-Star); DVD-Ig = dual variable domain immunoglobulin (Abbott); kappa-lambda body; TBTI = tetravalent bispecific tandem Ig; and CrossMab (Roche).
[0160] In some embodiments, the multispecific (e.g., bispecific) antibodies disclosed herein comprise a 5T4 binding domain and one or more additional binding domains that bind to one or more non-5T4 targets. In some embodiments, the multispecific (e.g., bispecific) antibodies disclosed herein comprise a 5T4 binding domain comprising a VH and / or VL amino acid sequence as disclosed herein, such as those in Table 1, Table 2, or Table 3.
[0161] In some embodiments, described herein are multispecific (e.g., bispecific) antibodies comprising a binding domain that binds 5T4, said binding domain comprising the VH and VL CDRs disclosed herein, such as those shown in Table 1, Table 2, or Table 3.
[0162] Antibodies that bind to 5T4 can be obtained by any suitable method, such as, but not limited to, immunization with whole tumor cells containing 5T4 and collection of antibodies, recombinant technology, or screening libraries of antibodies or antibody fragments using epitopes of the 5T4 extracellular domain. Monoclonal antibodies can be produced using a variety of known techniques (see, e.g., Coligan et al. (eds.), Current Protocols in Immunology, 1: 2.5.12.6.7 (John Wiley & Sons 1991); Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol (eds.) (1980); Antibodies: A Laboratory Manual, Harlow and Lane (eds.), Cold Spring Harbor Laboratory Press (1988); and Picksley et al., "Production of monoclonal antibodies against proteins expressed in E. coli," DNA Cloning 2: Expression Systems, 2nd ed., Glover et al. (eds.), p. 93 (Oxford University Press 1995)). One exemplary technique for producing monoclonal antibodies involves immunizing an animal with human 5T4 antigen and generating hybridomas from spleen cells taken from the animal. The hybridoma can produce a monoclonal antibody or antibody fragment that binds to 5T4.
[0163] In another embodiment, monoclonal antibodies or antibody fragments can be isolated from an antibody phage library produced using, for example, the technology described in Antibody Phage Display: Methods and Protocols, edited by PMO'Brien and R.Aitken, Humana Press, Totawa NJ, 2002. In principle, synthetic antibody clones are selected by screening a phage library containing phages displaying various fragments of antibody variable regions (Fv) fused to phage coat proteins. Such phage libraries are screened for the desired antigen. Clones expressing Fv fragments that can bind to the desired antigen are adsorbed onto the antigen and are therefore separated from non-binding clones in the library. Bound clones are then eluted from the antigen and can be further enriched by additional antigen adsorption / elution cycles.
[0164] The variable domains can be functionally displayed on phage as single-chain Fv (scFv) fragments (in which VH and VL are covalently linked by a short flexible peptide) or as Fab fragments (in which they are each fused to a constant domain and interact non-covalently), as described, for example, in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994).
[0165] Repertoires of VH and VL genes can be individually cloned by polymerase chain reaction (PCR) and randomly recombined in phage libraries, which can then be searched for antigen-binding clones, as described in Winter et al. (supra). Libraries from immunized sources provide high-affinity antibodies to the immunogen without the need to construct hybridomas. Alternatively, naive repertoires can be cloned to provide a single source of human antibodies against a wide range of non-self antigens and also self-antigens without any immunization, as described by Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be prepared synthetically by cloning unrearranged V-gene segments from stem cells and using PCR primers containing random sequences to encode highly variable CDR3 regions and achieve in vitro rearrangement, as described, for example, by Hoogenboom and Winter, J. Mol. Biol. 227: 381-388 (1992).
[0166] Screening of the library can be accomplished by various techniques known in the art. For example, 5T4 (e.g., 5T4 polypeptides, fragments, or epitopes) can be used to coat the wells of an adsorption plate, expressed on host cells attached to an adsorption plate or used for cell sorting, conjugated to biotin for capture with streptavidin-coated beads, or used in any other method for panning a display library. The selection of antibodies with slow dissociation kinetics (e.g., good binding affinity) can be facilitated by using long washes and monovalent phage display, as described in Bass et al., Proteins, 8: 309-314 (1990) and WO 92 / 09690; and low coating density of the antigen, as described in Marks et al., Biotechnol., 10: 779-783 (1992).
[0167] 5T4 binders (e.g., antibodies) can be obtained by designing an appropriate antigen screening program to select phage clones of interest, and then constructing full-length 5T4 binder (e.g., antibody) clones using VH and / or VL sequences (e.g., Fv sequences) from the phage clones of interest or various CDR sequences from the VH and VL sequences and appropriate constant region (e.g., Fc) sequences, as described in Kabat et al., Sequences of Immunological Interest, 5th ed., NIH Publication 91-3242, Bethesda MD (1991), vol. 1-3.
[0168] Likewise, human antibodies that bind to 5T4 can be produced by any of a variety of techniques, including, but not limited to, Epstein-Barr virus (EBV) transformation of human peripheral blood cells (e.g., containing B lymphocytes), in vitro immunization of human B cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from a human immunoglobulin V region phage library, or other procedures known in the art and based on the disclosure herein. Methods for obtaining human antibodies from transgenic animals are further described in, for example, Bruggemann et al., Curr. Opin. Biotechnol., 8:45558, 1997; Jakobovits et al., Ann. NY Acad. Sci., 764:52535, 1995; Green et al., Nature Genet., 7:13-21, 1994; Lonberg et al., Nature, 368:856-859, 1994; Taylor et al., Int. Immun. 6:579-591, 1994; and U.S. Patent No. 5,877,397.
[0169] For example, human antibodies that bind to 5T4 can be obtained from transgenic animals that have been engineered to produce specific human antibodies in response to antigenic attack. For example, International Patent Publication No. WO 98 / 24893 discloses transgenic animals with human Ig loci, wherein due to the inactivation of endogenous heavy and light chain loci, the animals do not produce functional endogenous immunoglobulins. Transgenic non-primate mammalian hosts capable of generating an immune response to an immunogen are also described, wherein the antibodies have primate constant and / or variable regions, and wherein the endogenous immunoglobulin encoding loci are replaced or inactivated. International Patent Publication No. WO 96 / 30498 discloses the use of the Cre / Lox system to modify immunoglobulin loci in mammals, such as replacing all or part of the constant or variable regions to form modified antibody molecules. International Patent Publication No. WO 94 / 02602 discloses non-human mammalian hosts with inactivated endogenous Ig loci and functional human Ig loci. U.S. Patent No. 5,939,598 discloses a method for preparing transgenic mice, wherein the mice lack endogenous heavy chains and express exogenous immunoglobulin loci comprising one or more xenogeneic constant regions. Using transgenic animals, such as the transgenic animals described herein, an immune response to a selected antigen molecule can be generated, and antibody-producing cells can be removed from the animals and used to produce hybridomas that secrete human monoclonal antibodies. Immunization protocols, adjuvants, etc. are known in the art and are used for immunization of transgenic mice described in, for example, International Patent Publication No. WO 96 / 33735. The ability of monoclonal antibodies to inhibit or neutralize the biological activity or physiological effect of the corresponding protein can be tested.
[0170] The present disclosure provides humanized antibodies that bind to 5T4 (including human 5T4). The humanized antibodies of the present disclosure may comprise one or more CDRs from VH and / or VL disclosed herein, such as those shown in Tables 1-3. Various methods for humanizing non-human antibodies are known in the art. For example, a humanized antibody may have one or more amino acid residues introduced therein from a non-human source. These non-human amino acid residues are generally referred to as "import" residues, which are typically taken from an "import" variable domain. Humanized antibodies that bind to 5T4 can be generated using techniques known to those skilled in the art (Zhang et al., Molecular Immunology, 42(12): 1445-1451, 2005; Hwang et al., Methods, 36(1): 35-42, 2005; Dall'Acqua et al., Methods, 36(1): 43-60, 2005; Clark, Immunology Today, 21(8): 397-402, 2000 and U.S. Pat. Nos. 6,180,370; 6,054,927; 5,869,619; 5,861,155; 5,712,120; and 4,816,567).
[0171] In some cases, humanized antibodies are constructed by CDR transplantation, in which the amino acid sequences of the six CDRs of VH and VL of a parent non-human antibody (e.g., a rodent) are transplanted onto a human antibody framework. For example, Padlan et al. (FASEB J. 9: 133-139, 1995) determined that only about one-third of the residues in the CDR actually contact the antigen, and referred to these as "specificity determining residues" or SDRs. In the SDR transplantation technique, only SDR residues are transplanted onto a human antibody framework (see, e.g., Kashmiri et al., 2005, Methods 36: 25-34, 2005).
[0172] The selection of human variable domains to be used in producing humanized antibodies (both light and heavy chains) can be important for reducing antigenicity. For example, according to the so-called "best fit" method, the variable domain sequences of non-human (e.g., rodent) antibodies are screened for the entire library of known human variable domain sequences. The human sequence closest to the rodent sequence can be selected as the human framework of the humanized antibody (Sims et al. (1993) J. Immunol. 151: 2296; Chothia et al. (1987) J. Mol. Biol. 196: 901). Another method uses a specific framework derived from the consensus sequence of all human antibodies of the light chain or heavy chain of a specific subgroup. The same framework can be used for several different humanized antibodies (Carter et al., (1992) Proc. Natl. Acad. Sci. USA, 89: 4285; Presta et al. (1993) J. Immunol., 151: 2623). In some cases, the framework was derived from the most abundant human subtype, V L 6Subgroup I(V L 6I) and V H Subgroup III (V H In another approach, human germline genes were used as the source of framework regions.
[0173] In an alternative CDR comparison-based paradigm (termed superhumanization), framework homology is irrelevant. This approach consists of comparing non-human sequences to a library of functional human germline genes. Genes encoding canonical structures identical or closely related to the murine sequences are then selected. Next, among genes sharing canonical structures with non-human antibodies, those with the highest homology within their CDRs are selected as framework donors. Finally, the non-human CDRs are grafted onto these frameworks (see, e.g., Tan et al., J. Immunol. 169:1119-1125, 2002).
[0174] In addition, it is generally desired that antibodies be humanized while retaining their affinity for antigens and other favorable biological properties. To achieve this goal, according to a method, humanized antibodies are prepared by analyzing the process of parental sequences and various conceptual humanized products using three-dimensional models of parental sequences and humanized sequences. Three-dimensional immunoglobulin models are usually available and are familiar to those skilled in the art. Computer programs that illustrate and display the possible three-dimensional conformational structures of selected candidate immunoglobulin sequences are available. These include, for example, WAM (Whitelegg and Rees, Protein Eng. 13: 819-824, 2000), Modeller (Sali and Blundell, J. Mol. Biol. 234: 779-815, 1993), and Swiss PDB Viewer (Guex and Peitsch, Electrophoresis 18: 2714-2713, 1997). Inspection of these displays allows analysis of the likely role of the residues in the function of the candidate immunoglobulin sequence, for example, analysis of residues that influence the ability of the candidate immunoglobulin to bind to its antigen. In this way, framework residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for one or more target antigens, is achieved. In general, the hypervariable region residues are directly and most involved in influencing antigen binding.
[0175] Another approach for antibody humanization is based on a measure of antibody humanness called human string content (HSC). This method compares the mouse sequence to a repertoire of human germline genes and scores differences as HSC. Multiple different humanized variants are then generated by maximizing their HSC rather than using a global identity measure, thereby humanizing the target sequence. (Lazar et al., Mol. Immunol. 44: 1986-1998, 2007).
[0176] In addition to the methods described above, empirical methods can be used to generate and select humanized antibodies. These methods include those based on the use of enrichment techniques or high-throughput screening techniques to generate large libraries of humanized variants and select the best clones. Antibody variants can be isolated from phage, ribosome, and yeast display libraries and by bacterial colony screening (see, for example, Hoogenboom, Nat. Biotechnol. 23: 1105-1116, 2005; Dufner et al., Trends Biotechnol. 24: 523-529, 2006; Feldhaus et al., Nat. Biotechnol. 21: 163-70, 2003; Schlapschy et al., Protein Eng. Des. Sel. 17: 847-60, 2004).
[0177] In the framework library approach, a collection of residue variants is introduced at specific positions of the framework, and the library is subsequently screened to select the framework that best supports the grafted CDRs. The residues to be replaced can include some or all of the "Vernier" residues identified as potentially contributing to CDR structure (see, e.g., Foote and Winter, 1992, J. Mol. Biol. 224: 487-499, 1992), or a more limited set of target residues identified from Baca et al. (J. Biol. Chem. 272: 10678-10684, 1997).
[0178] In framework shuffling, the complete framework is combined with non-human CDRs, rather than generating a combinatorial library of selected residue variants (see, e.g., Dall'Acqua et al., 2005, Methods 36:43-60). The library can be screened for binding in a two-step selection approach, first humanizing the VL and then the VH. Alternatively, a one-step framework shuffling approach can be used. Such an approach has been shown to be more efficient than a two-step selection approach, as the resulting antibodies exhibit improved biochemical and physicochemical properties, including enhanced expression, increased affinity, and thermal stability (see, e.g., Damschroder et al., Mol. Immunol. 44:3049-60, 2007).
[0179] The "humanization" method is based on the experimental identification of the minimum specificity determinant (MSD) required, and is based on sequentially replacing non-human fragments into a human FR library and evaluating binding. It starts with the CDR3 region of the non-human VH and VL chains, and gradually replaces the other regions of the non-human antibody into a human framework, including CDR1 and CDR2 of both VH and VL. This method typically results in epitope retention and identification of antibodies from multiple subclasses with different human V segment CDRs. Humanization allows the isolation of antibodies that are 91-96% homologous to human germline antibodies. (See, e.g., Alfenito, Cambridge Institute for Health Technology's 3rd Annual PEGS, Protein Engineering Summit, 2007).
[0180] "Human engineering" methods include changing non-human antibodies or antibody fragments, such as mice or chimeric antibodies or antibody fragments, by making specific changes to the amino acid sequence of the antibody, so as to produce antibodies that are reduced in immunogenicity but still retain the modified desired binding properties of the original non-human antibodies. Typically, this technology includes categorizing the amino acid residues of non-human (e.g., mouse) antibodies as "low risk," "medium risk" or "high risk" residues. Classification is performed using a global risk / reward calculation that measures the risk of replacement of the resulting antibody, which will affect the folding and / or replacement of the resulting antibody by human residues, and predicting the benefit of a specific replacement (e.g., for immunogenicity in people). By comparing the amino acid sequence of the variable region from a non-human antibody with the corresponding region of a specific or shared human antibody sequence, it is possible to select a specific human amino acid residue that is substituted into a given position (e.g., low or medium risk) of a non-human (e.g., mouse) antibody sequence. According to the comparison, the amino acid residues at low or medium risk positions in the non-human sequence can be substituted into the corresponding residues in the human antibody sequence. Techniques for preparing human engineered proteins are described in more detail in Studnicka et al., Protein Engineering, 7:805-814 (1994), US Pat. Nos. 5,766,886, 5,770,196, 5,821,123, and 5,869,619, and PCT Application Publication No. WO 93 / 11794.
[0181] In some embodiments, the 5T4 binders described herein comprise non-antibody protein scaffolds. Non-limiting examples of such non-antibody protein scaffolds include fibronectin scaffolds, anticalins, adnectins, affibodies, DARPins, fynomers, affitins, affilins, avimers, cysteine-rich knot protein peptides, or engineered Kunitz-type inhibitors. Methods for producing such non-antibody protein scaffolds are well known in the art, any of which can be used to produce 5T4 binders comprising non-antibody protein scaffolds (see, e.g., Simeon and Chen, Protein Cell, 9(1): 3-14 (2018); Yang et al., Annu Rev Anal Chem (Palo Alto Calif). 10(1): 293-320 (2017)).
[0182] Also provided are nucleic acids encoding the 5T4 binders (e.g., antibodies or antibody fragments) or fusion polypeptides disclosed herein, nucleic acids complementary thereto, vectors comprising the nucleic acids disclosed herein, and cells comprising the nucleic acids or vectors disclosed herein. In some embodiments, the cells express the 5T4 binders. In some embodiments, the cells replicate the nucleic acids or vectors. In some embodiments, materials for producing 5T4 binders (e.g., human 5T4 binders) and fragments thereof are provided. For example, isolated cells can produce 5T4 binders (e.g., antibodies or antibody fragments). In this regard, cells (e.g., isolated cells) can produce antibodies or fragments thereof comprising VH and VL disclosed herein. In some embodiments, the polynucleotides described herein may comprise one or more nucleic acid sequences encoding a 5T4 binder (e.g., an antibody or antibody fragment). In some embodiments, the polynucleotides are isolated and / or recombinant polynucleotides. In various aspects, the isolated polynucleotides comprise nucleotide sequences encoding VH and / or VL, wherein the VH and VL comprise complementary determining regions (CDRs) identical to the CDRs disclosed herein.
[0183] In some embodiments, one or more vectors (e.g., expression vectors) may contain one or more polynucleotides for expressing the one or more polynucleotides in a suitable host cell. Such vectors can be used, for example, to amplify polynucleotides in host cells to produce useful amounts of polynucleotides, and to express binding agents such as antibodies or antibody fragments using recombinant techniques.
[0184] In some embodiments, one or more vectors are expression vectors, wherein one or more polynucleotides are operably connected to one or more polynucleotides that comprise expression control sequences. Special consideration has been given to the recombinant expression construct of autonomous replication, such as plasmids and viral DNA vectors that incorporate the polynucleotides of the antibody sequence of one or more coding combinations of 5T4. The expression control DNA sequence comprises a promoter, an enhancer and an operator, and is usually selected based on the expression system that will utilize the expression construct. Promoter and enhancer sequences are usually selected according to the ability to increase gene expression, and the operator sequence is usually selected according to the ability to regulate gene expression. The expression construct can also include the sequence of one or more selective markers encoding, and the selective marker allows identification of the host cell carrying the construct. The expression construct can also include the sequence that promotes and preferably promotes homologous recombination in the host cell. In some embodiments, the expression construct can also include the necessary sequence for replication in the host cell.
[0185] Exemplary expression control sequences include promoter / enhancer sequences, such as the cytomegalovirus promoter / enhancer (Lehner et al., J. Clin. Microbiol., 29:2494-2502, 1991; Boshart et al., Cell, 41:521-530, 1985); the Rous sarcoma virus promoter (Davis et al., Hum. Gene Ther., 4:151, 1993); the Tie promoter (Korhonen et al., Blood, 86(5):1828-1835, 1995); the simian virus 40 promoter; DRA (downregulated in adenomas; Alrefai et al., Am. J. Physiol. Gastrointest. Liverpool Physiol., 293:G923-G934, 2007); MCT1 (monocarboxylate transporter 1; Cuff et al., Am. J. Physiol. Gastrointet. Liverpool Physiol., G977-G979.2005); and Math1 (mouse atonal homolog 1; Shroyer et al., Gastroenterology, 132:2477-2478, 2007), for expression in mammalian cells, the promoter is operably linked upstream (e.g., 5') of the polypeptide coding sequence. In another variation, the promoter is an epithelial-specific promoter or an endothelial-specific promoter. The polynucleotide may also optionally include a suitable polyadenylation sequence (e.g., SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (e.g., 3') of the polypeptide coding sequence.
[0186] If desired, the one or more polynucleotides may also optionally comprise a nucleotide sequence encoding a secretion signal peptide fused in frame to the polypeptide sequence. The secretion signal peptide directs secretion of the antibody polypeptide from cells expressing the one or more polynucleotides and is cleaved from the secreted polypeptide by the cells. The one or more polynucleotides may further optionally comprise a sequence whose sole intended function is to facilitate large-scale production of the vector. Polynucleotides for gene therapy can be manufactured and administered using methods described in the literature for various transgenics. See, for example, Isner et al., Circulation, 91: 2687-2692, 1995; and Isner et al., Human Gene Therapy, 7: 989-1011, 1996.
[0187] In some embodiments, the polynucleotide may further comprise additional sequences to facilitate host cell uptake and expression of the antibody or fragment thereof (and / or any other peptide). In some embodiments, a "naked" transgene encoding an antibody or fragment thereof as described herein (e.g., a transgene without a virus, liposome, or other carrier to facilitate transfection) is employed.
[0188] Any suitable vector can be used to introduce one or more polynucleotides encoding the antibody or its fragment into the host. Exemplary vectors that have been described include replication-defective retroviral vectors, including but not limited to lentiviral vectors (Kim et al., J. Virol., 72(1):811-816, 1998; Kingsman & Johnson, Scrip Magazine, October 1998, pp. 43-46); parvoviral vectors, such as adeno-associated virus (AAV) vectors (U.S. Pat. Nos. 5,474,9351; 5,139,941; 5,622,856; 5,658,776; 5,773,289; 5,789,390; 5,834,441; 5,863,541; 5,851,521; 5,252,479; Gnaten Ko et al., J. Invest. Med., 45:87-98, 1997); adenovirus (AV) vectors (U.S. Pat. Nos. 5,792,453; 5,824,544; 5,707,618; 5,693,509; 5,670,488; 5,585,362; Quantin et al., Proc. Natl. Acad. Sci. USA, 89:2581-2584, 1992; Stratford ... Perricaudet et al., J. Clin. Invest., 90:626-630, 1992; and Rosenfeld et al., Cell, 68:143-155, 1992); adenovirus adeno-associated virus chimeric (U.S. Pat. No. 5,856,152) or vaccinia virus or herpes virus vectors (U.S. Pat. Nos. 5,879,934; 5,849,571; 5,830,727; 5,661,033; 5,328,688); lipofectin-mediated gene transfer (BRL); liposome vectors (U.S. Pat. No. 5,631,237); and combinations thereof. Any of these expression vectors can be prepared using standard recombinant DNA techniques as described, for example, in Sambrook et al., Molecular Cloning, a Laboratory Manual, 2nd ed., Cold Spring Harbor Press, Cold Spring Harbor, NY (1989) and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, New York, NY (1994).Optionally, the viral vector is made replication defective by, for example, deleting or disrupting a selectable gene required for viral replication.
[0189] Other non-viral delivery mechanisms contemplated include calcium phosphate precipitation (Graham and Van Der Eb, Virology, 52:456-467, 1973; Chen and Okayama, Mol. Cell Biol., 7:2745-2752, 1987; Rippe et al., Mol. Cell Biol., 10:689-695, 1990), DEAE-dextran (Gopal, Mol. Cell Biol., 5:1188-1190, 1985), electroporation (Tur-Kaspa et al., Mol. Cell Biol., 5:1189-1191, 1986), and immunoprecipitation (Evans et al., Mol. Cell Biol., 6:1190-1191, 1991). Biol., 6:716-718, 1986; Potter et al., Proc. Nat. Acad. Sci. USA, 81:7161-7165, 1984), direct microinjection (Harland and Weintraub, J. Cell Biol., 101:1094-1099, 1985), DNA-loaded liposomes (Nicolau and Sene, Biochim. Biophys. Acta, 721:185-190, 1982; Fraley et al., Proc. Natl. Acad. Sci. USA, 76:3348-3352, 1979; Felgner, Sci Am., 276(6):102-6, 1997; Felgner, Hum Gene. Ther., 7(15):1791-3, 1996), cell sonication (Fechheimer et al., Proc. Natl. Acad. Sci. USA, 84:8463-8467, 1987), gene bombardment using high-speed microparticles (Yang et al., Proc. Natl. Acad. Sci. USA, 87:9568-9572, 1990) and receptor-mediated transfection (Wu and Wu, J. Biol. Chem., 262:4429-4432, 1987; Wu and Wu, Biochemistry, 27:887-892, 1988; Wu and Wu, Adv. Drug Delivery Rev., 12:159-167, 1993).
[0190] The vector (or antibody or fragment thereof or nucleic acid as discussed herein) can be entrapped in liposomes. See, for example, Ghosh and Bachhawat, in: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Dekker, pp. 87-104 (1991); Radler et al., Science, 275(5301):810-814, 1997). Various commercial methods involving "lipofection" technology are also contemplated. In some embodiments, the liposomes can be complexed with hemagglutinating virus (HVJ). This has been shown to facilitate fusion with cell membranes and promote entry of liposome-encapsulated DNA into cells (Kaneda et al., Science, 243:375-378, 1989). In some embodiments, liposomes are complexed or used in conjunction with a nuclear non-histone chromosomal protein (HMG-1) (Kato et al., J. Biol. Chem., 266:3361-3364, 1991). In some embodiments, liposomes are complexed or used in conjunction with both HVJ and HMG-1. Such expression constructs have been successfully used for transfer and expression of nucleic acids in vitro and in vivo. In some embodiments, a 5T4 binder (e.g., an antibody) (including a human 5T4 binder) is contained in the liposome to target the liposome to cells (e.g., tumor cells) that express 5T4 on their surface.
[0191] The cell can comprise one or more polynucleotides or one or more vectors, for example, the cell is transformed or transfected with one or more polynucleotides encoding a 5T4 binding agent (e.g., an antibody), including a human 5T4 binding agent, or one or more vectors comprising the one or more polynucleotides. In some embodiments, the cell expresses a 5T4 binding agent (e.g., an antibody), including a human 5T4 binding agent, comprising one or more (including six) CDRs that are at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the CDRs of mAbA4, mAbA15, or mAbA17 (see, e.g., Tables 1, 2, and / or 3). In some embodiments, the cell expresses a 5T4 binding agent (e.g., an antibody), including a human 5T4 binding agent, comprising a VH and a VL comprising the same CDRs as the CDRs of mAbA4, mAbA15, and / or mAbA17 (see, e.g., Tables 1, 2, and / or 3). The cell can be a prokaryotic cell, such as Escherichia coli (see, e.g., Pluckthun et al., Methods Enzymol., 178:497-515, 1989), or a eukaryotic cell, such as an animal cell (e.g., a myeloma cell, a Chinese hamster ovary (CHO) cell, or a hybridoma cell), a yeast (e.g., Saccharomyces cerevisiae), or a plant cell (e.g., a tobacco, corn, soybean, or rice cell). The use of mammalian host cells can provide translational modifications (e.g., glycosylation, truncation, lipidation, and phosphorylation) that may be desired to confer optimal biological activity on the recombinant expression product. Similarly, polypeptides (e.g., 5T4 binders (e.g., antibodies), including human 5T4 binders) can be glycosylated or non-glycosylated and / or have been covalently modified to include one or more water-soluble polymer linkages, such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
[0192] Methods for introducing DNA or RNA into host cells are well known and include transformation, transfection, electroporation, nuclear injection, or fusion with vectors such as liposomes, micelles, ghost cells, and protoplasts. Such host cells can be used to amplify polynucleotides and can also be used to express polypeptides encoded by the polynucleotides. In this regard, methods for producing 5T4 binders (e.g., antibodies) can include culturing host cells and isolating the 5T4 binder. Transferring naked DNA expression constructs into cells can be accomplished using particle bombardment, which relies on the ability to accelerate DNA-coated microparticles to high speeds that allow them to pierce cell membranes and enter cells without killing them (Klein et al., Nature, 327:70-73, 1987). Several devices for accelerating small particles have been developed. One such device relies on a high-voltage discharge to generate an electric current, which in turn provides the motive force (Yang et al., Proc. Natl. Acad. Sci USA, 87:9568-9572, 1990). The microparticles used are composed of biologically inert materials such as tungsten or gold beads. The host cells can be isolated and / or purified. A host cell may also be a cell transformed in vivo to cause transient or permanent expression of a polypeptide in vivo. A host cell may also be an isolated cell transformed ex vivo and introduced after transformation, for example, to produce a polypeptide in vivo for therapeutic purposes. The definition of a host cell specifically excludes transgenic humans.
[0193] The various methods for producing antibodies from polynucleotides are generally well known. For example, Maniatis et al., Molecular Cloning, A Laboratory Manual, 2nd edition, Cold Spring Harbor Laboratory, New York, 1989 describes molecular biology procedures (see also Maniatis et al., 3rd edition, Cold Spring Harbor Laboratory, New York, 2001). In addition, many publications describe techniques suitable for preparing antibodies by manipulating DNA, producing expression vectors, and transforming and culturing appropriate cells (see, for example, Mountain and Adair, Biotechnology and Genetic Engineering Reviews 1st edition, Tombs ed., Intercept, Andover, UK, 1992); and Current Protocols in Molecular Biology, Ausubel ed., Wiley Interscience, New York, 1999).
[0194] 5T4 binders (e.g., antibodies), including human 5T4 binders, are produced using any suitable method, such as isolation from immunized animals, recombinant or synthetic production, or genetic engineering, including those described above. Antibody fragments derived from antibodies are obtained, for example, by proteolysis of the antibodies. For example, papain or pepsin digestion of intact antibodies produces a 5S fragment, termed F(ab')2, or two monovalent Fab fragments and an Fc fragment, respectively. F(ab)2 can be further cleaved using a thiol reducing agent to produce a 3.5S Fab monovalent fragment. Methods for producing antibody fragments are further described in, for example, Edelman et al., Methods in Enzymology, 1:422 Academic Press (1967); Nisonoff et al., Arch. Biochem. Biophys., 89:230-244, 1960; Porter, Biochem. J., 73:119-127, 1959; U.S. Pat. No. 4,331,647; and Andrews, SM and Titus JA, Current Protocols in Immunology (Coligan et al., eds.), John Wiley & Sons, New York (2003), pp. 2.8.1, 2.8.10 and 2.10A.1, 2.10A.5.
[0195] 5T4 binding agents (e.g., antibodies), including human 5T4 binding agents, can be genetically engineered. For example, 5T4 binding agents (e.g., antibodies), including human 5T4 binding agents, comprise variable region domains, for example, produced by recombinant DNA engineering techniques. In this regard, the variable region domains are optionally modified by insertions, deletions, or alterations in the amino acid sequence of the antibody to produce the antibody of interest, including as described above. Polynucleotides encoding the CDRs of interest are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA from antibody-producing cells as a template (see, e.g., Courtenay Luck, "Genetic Manipulation of Monoclonal Antibodies," in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al. (Eds.), p. 166 (Cambridge University Press 1995); Ward et al., "Genetic Manipulation and Expression of Antibodies," in Monoclonal Antibodies: Principles and Applications, Birch et al., (Eds.), p. 137 (Wiley Liss, Inc., 1995); and Larrick et al., Methods: A Companion to Methods in Enzymology, 2: 106-110, 1991). Current antibody manipulation techniques allow the construction of engineered variable region domains comprising at least one CDR and, optionally, one or more framework amino acids from a first antibody and the remainder of the variable region domain from a second antibody. Such techniques are used, for example, to humanize antibodies or improve their affinity for a binding target.
[0196] "Humanized antibody " is an antibody in which the CDRs of the heavy variable chain and light variable chain of a non-human immunoglobulin are transferred to a human variable domain. Constant region does not need to exist, but if present, in some embodiments, they are optionally substantially identical to human immunoglobulin constant region, for example, at least about 85-90%, about 95%, 96%, 97%, 98%, 99% or more identical. Therefore, in some cases, all parts of the humanized immunoglobulin, except possible CDR, are substantially identical to the corresponding parts of natural human immunoglobulin sequences. For example, a humanized antibody is a human immunoglobulin (for example, a host antibody), wherein the hypervariable region residues of the host antibody are replaced by hypervariable region residues with desired specificity, affinity and ability from a non-human species (donor antibody) such as mouse, rat, rabbit or non-human primate.
[0197] In some embodiments, the 5T4 binding agents described herein (e.g., antibodies or ADCs) can be used in compositions and methods for treating, preventing, or ameliorating a 5T4-mediated disease, disorder, or condition (including one or more symptoms of the disease, disorder, or condition). 5T4-mediated diseases, disorders, and conditions include cancer, including but not limited to any cancer in which tumor cells overexpress 5T4.
[0198] In some embodiments, described herein is a method for treating tumor immunity in a subject, comprising administering to the subject a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein. In some embodiments, provided herein are pharmaceutical compositions comprising a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a binding agent (e.g., an antibody or ADC) as described herein for treating tumor immunity in a subject. In some embodiments, provided herein are uses of a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein for the preparation of a medicament for treating tumor immunity in a subject.
[0199] In some embodiments, described herein is a method for treating a cancer or tumor in a subject, comprising administering to the subject a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein. In some embodiments, provided herein are pharmaceutical compositions comprising a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a binding agent (e.g., an antibody or ADC) as described herein for use in treating a cancer or tumor in a subject. In some embodiments, provided herein are uses of a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein for the preparation of a medicament for treating a cancer or tumor in a subject.
[0200] In some embodiments, described herein is a method for alleviating one or more symptoms associated with cancer or a tumor in a subject, comprising administering to the subject a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein. In some embodiments, provided herein are 5T4 binding agents (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein for alleviating one or more symptoms associated with cancer or a tumor in a subject. In some embodiments, provided herein are uses of 5T4 binding agents (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein for the preparation of a medicament for alleviating one or more symptoms associated with cancer or a tumor in a subject.
[0201] In some embodiments, described herein is a method for reducing the size of a tumor in a subject having a tumor, comprising administering to the subject a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein. In some embodiments, provided herein are pharmaceutical compositions comprising a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a binding agent (e.g., an antibody or ADC) as described herein for reducing the size of a tumor in a subject having a tumor. In some embodiments, provided herein are uses of a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein for the preparation of a medicament for reducing the size of a tumor in a subject having a tumor.
[0202] In some embodiments, described herein is a method for enhancing the removal of tumor cells in a subject having a tumor, comprising administering to the subject a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein. In some embodiments, provided herein is a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein, for enhancing the removal of tumor cells in a subject having a tumor. In some embodiments, provided herein is a use of a 5T4 binding agent (e.g., an antibody or ADC) or a fragment thereof, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) as described herein, in the preparation of a medicament for enhancing the removal of tumor cells in a subject having a tumor.
[0203] One or more therapeutic agents described herein and a 5T4 binding agent (e.g., an antibody or ADC) or fragment thereof described herein, or a pharmaceutical composition comprising a binding agent (e.g., an antibody or ADC) described herein, can be administered to a subject of the methods described herein.
[0204] In some embodiments, the antibody is a human antibody, including but not limited to antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences, as described, for example, in Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242. If the antibody contains a constant region, the constant region is also preferably derived from human germline immunoglobulin sequences. Human antibodies may include amino acid residues not encoded by human germline immunoglobulin sequences, for example to enhance the activity of the antibody, but do not include CDRs derived from other species (e.g., mouse CDRs placed within human variable framework regions).
[0205] In some embodiments, the cancer or tumor cells of the methods described herein express 5T4, for example, on the cell surface. In further embodiments, the cancer or tumor cells overexpress 5T4. In some embodiments, 5T4 binding agents (e.g., antibodies or ADCs) are cytotoxic to tumor cells in cell culture. Such cell cultures may include tumor cells that express or overexpress 5T4. Tumor cells include, but are not limited to, breast cancer cells, bladder cancer cells, melanoma cells, prostate cancer cells, mesothelioma cells, lung cancer cells, testicular cancer cells, thyroid cancer cells, squamous cell carcinoma cells, glioblastoma cells, neuroblastoma cells, uterine cancer cells, colorectal cancer cells, and pancreatic cancer cells.
[0206] In some embodiments, methods for enhancing the removal of tumor cells in a subject are described herein. For example, the method includes administering a 5T4 binding agent (e.g., an antibody or ADC) that effectively enhances the removal of tumor cells, such as a human 5T4 binding agent as described herein. In some embodiments, the method includes administering a 5T4 binding agent (e.g., an antibody or ADC) that competes for binding with mAbA4, mAbA15, and / or mAbA17 (see, e.g., Table 1, Table 2, and / or Table 3 CDRs and VH / VL), (ii) binding to human 5T4 and / or (iii) binding to a 5T4 binding agent in a 5T4 region identified by mAbA4, mAbA15, and / or mAbA17 (see, e.g., Table 1, Table 2, and / or Table 3 CDRs and VH / VL), resulting in enhanced removal of tumor cells. In some embodiments, one or more binding agents (e.g., antibodies), polynucleotides, vectors, and / or cells as described above can be used to enhance the removal of tumor cells in vivo (e.g., a method for treating cancer in a subject).
[0207] Also provided are methods of regulating (e.g., inhibiting, reducing, preventing) tumor growth in a subject. For example, the method comprises administering to the subject a composition comprising a 5T4 binding agent (e.g., an antibody or ADC) in an amount effective to regulate tumor growth in the subject.
[0208] As used herein, "tumor" refers to any neoplastic cell growth or proliferation, whether malignant or benign, and refers to all precancerous and cancerous cells and tissues. The terms "cancer" and "cancerous" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancer include, but are not limited to, breast cancer, colon cancer, kidney cancer, lung cancer, squamous cell myeloid leukemia, hemangiomas, melanomas, astrocytomas, and glioblastomas, as well as other cell proliferative disease states, including, but not limited to: Heart: sarcomas (angiosarcomas, fibrosarcomas, rhabdomyosarcomas, liposarcoma), myxomas, rhabdomyomas, fibromas, lipomas, and teratomas; Lung: bronchogenic carcinomas (squamous cell carcinomas, undifferentiated small cell carcinomas, undifferentiated large cell carcinomas, adenocarcinomas), alveolar (bronchiolar) carcinomas, bronchial adenomas, sarcomas, lymphomas, chondromatous carcinomas, chondrosarcomas, and pulmonary fibrosis. Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumor, vipoma), small intestine (adenocarcinoma, lymphoma, carcinoid tumor, Kaposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large intestine (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma); genitourinary: kidney (adenocarcinoma, Wilm's tumor), lymphoma, leukemia, renal cell carcinoma ), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma, small cell prostate carcinoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, stromal cell carcinoma, fibroma, fibroadenoma, adenomatous tumor, lipoma); Liver: liver cancer (hepatocellular carcinoma), bile duct cancer, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing sarcoma, malignant lymphoma (reticular cell sarcoma), malignant giant cell tumor (chordoma), osteochondroma (osteocartilaginous exostosis) exostoses), benign enchondromas, chondroblastomas, chondromyxofibromas, osteoid osteomas, and giant cell tumors; nervous system: skull (osteomas, hemangiomas, granulomas, xanthomas, osteitis deformans), meninges (meningiomas, meningiosarcomas, gliomatosis), brain (astrocytomas, medulloblastomas, gliomas, ependymomas, germ cell tumors (pinealomas), glioblastomas multiforme, oligodendrogliomas, schwannomas, retinoblastomas, congenital tumors), spinal neurofibromas, meningiomas, gliomas, sarcomas);Gynecology: Uterus (endometrial cancer), Cervix (cervical cancer, preneoplastic cervical atypia), Ovary (ovarian cancer) serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma, granulosa-thecal cell tumor, Sertoli-Leydig cell tumor, dysgerminoma, malignant teratoma), Vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), Vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonic rhabdomyosarcoma), Fallopian tube (carcinoma); Hematology: Blood (myeloid leukemia (acute and chronic), acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative disorders, multiple sclerosis) Myeloma, myelodysplastic syndrome), Hodgkin's disease, non-Hodgkin's lymphoma (malignant lymphoma); Skin: malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Kaposi's sarcoma, dysplastic nevus, lipoma, hemangioma, dermatofibroma, keloid, psoriasis; and Adrenal gland: neuroblastoma; and thyroid cancer, including medullary thyroid carcinoma. In some embodiments, the tumor or cancer is a recurrent tumor or cancer. In some embodiments, the tumor or cancer is a metastatic tumor or cancer. In some embodiments, the tumor or cancer is a primary tumor or cancer. Additionally or alternatively, the tumor or cancer is resistant to chemotherapy or other non-5T4 targeted anticancer therapies.
[0209] Also provided is a method of treating cancer by administering a 5T4-binding agent (eg, an antibody), such as a human 5T4-binding agent, alone or in combination with another agent, to a subject in need thereof.
[0210] "Enhancing" tumor cell removal does not require 100% enhanced removal. Any increase in the removal rate is expected. Similarly, "modulating" tumor growth refers to reducing the size of the tumor, slowing tumor growth, or inhibiting the increase in the size of an existing tumor. The tumor does not need to be completely eliminated; any reduction in tumor size or slowing of tumor growth constitutes a beneficial biological effect in the subject. In this regard, tumor cell removal can be enhanced, for example, by at least about 5%, at least about 10%, or at least about 20%, compared to the level of removal observed in the absence of the method (e.g., in a biologically matched control subject or sample not exposed to the agent of the method). The effect is detected by, for example, a reduction in tumor size, a reduction or maintenance of tumor marker levels, or a reduction or maintenance of tumor cell populations. In some embodiments, the removal of tumor cells is enhanced, for example, by at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or more (about 100%), compared to the removal of tumor cells in the absence of the 5T4 binding agent (e.g., antibody) of the method.
[0211] In addition, 5T4 binding agents (such as antibodies or ADC) can be used to alleviate or reduce the side effects associated with cancer, such as bone degeneration, spinal collapse and paralysis. In one aspect, the subject suffers from bone metastasis or is at risk of suffering from bone metastasis, and the 5T4 binding agent (such as, antibody or ADC) is administered in an amount that reduces the degeneration of the surrounding bone. Therefore, in some aspects, the 5T4 binding agent prevents the bone degeneration caused by bone metastasis, wherein tumor cell proliferation is reduced or not reduced. In some aspects, the 5T4 binding agent (such as, antibody or ADC) not only prevents the bone degeneration caused by bone metastasis, but also reduces tumor cell proliferation. Generally, the impact on tumor cell proliferation (such as, inhibiting proliferation or not affecting proliferation) depends on the microenvironment of specific metastasis. For example, the proliferation of metastases located in a microenvironment with a large amount of type 1 collagen can be suppressed. On the contrary, the proliferation of metastases located in a microenvironment lacking a large amount of type 1 collagen may not be suppressed, but bone degeneration near the metastases is reduced or prevented.
[0212] The specific administration regimen of a 5T4 binding agent (e.g., antibody or ADC) for a particular subject will depend in part on the agent used, the amount of the agent administered, the route of administration, and the cause and extent of any side effects. The amount of agent (e.g., antibody or ADC) administered to a subject (e.g., a mammal such as a human) should be sufficient to achieve the desired response within a reasonable timeframe. Thus, in some embodiments, the amount of a 5T4 binding agent (e.g., antibody or ADC) or pharmaceutical composition described herein administered to a subject is an effective amount.
[0213] Suitable routes of administering compositions comprising a 5T4 binding agent (e.g., an antibody or ADC), such as a human 5T4 binding agent (e.g., an antibody or ADC), are well known in the art. Although more than one route may be used to administer an agent (e.g., an antibody or ADC), a particular route may provide a more direct and more effective response than another route.
[0214] The present disclosure provides a composition, such as a pharmaceutical composition, comprising a 5T4 binding agent (e.g., an antibody or ADC) such as a human 5T4 binding agent and a carrier (e.g., a pharmaceutically acceptable carrier). The specific carrier employed may depend on chemical-physical considerations, such as solubility and lack of reactivity with the binding agent or co-therapy, as well as on the route of administration. Pharmaceutically acceptable carriers are well known in the art, examples of which are described herein. Exemplary pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of injectable sterile solutions or dispersions. Injectable formulations are further described, for example, in Pharmaceutics and Pharmacy Practice, JB Lippincott Co., Philadelphia. Pa. Banker and Chalmers. eds. pp. 238-250 (1982) and ASHP Handbook on Injectable Drugs, Toissel, 4th edition, pp. 622-630 (1986). The preparation of the pharmaceutical compositions provided herein and their various routes of administration can be carried out according to methods well known in the art. Delivery systems useful in the context of the present invention include timed release, delayed release, and sustained release delivery systems so that delivery of the composition occurs before sensitization of the site to be treated and there is enough time to cause sensitization of the site to be treated. Many types of release delivery systems are available and known to those of ordinary skill in the art. Suitable release delivery systems include polymer-based systems, such as poly (lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the aforementioned polymers containing drugs are described in, for example, U.S. Patent No. 5,075,109. Delivery systems also include non-polymer systems, which are lipids such as sterols such as cholesterol, cholesterol esters, and fatty acids or neutral fats such as monoglycerides, diglycerides, and triglycerides; hydrogel release systems; silicone rubber systems; peptide-based systems; wax coatings; compressed tablets using conventional adhesives and excipients; partially fused implants; and the like. Specific examples include, but are not limited to: (a) erosion systems, in which the active ingredient is contained in a matrix, as described in U.S. Patents 4,452,775, 4,667,014, 4,748,034, and 5,239,660, and (b) diffusion systems, in which the active ingredient is permeated from a polymer at a controlled rate, as described in U.S. Patents 3,832,253 and 3,854,480. In addition, pump-based hardware delivery systems can be used, some of which are suitable for implantation. In one aspect, a pharmaceutical composition comprising a 5T4 binding agent (e.g., an antibody or ADC), such as a human 5T4 binding agent, is placed in a container along with packaging material that provides instructions for use of such pharmaceutical composition.Typically, such instructions include tangible expressions describing the concentrations of the reagents and, in some embodiments, the relative amounts of excipient ingredients or diluents (eg, water, saline, or PBS) that may be necessary to reconstitute the pharmaceutical composition.
[0215] In some aspects, the methods described herein further comprise administering one or more additional agents, including therapeutic agents, which may be present in the composition or may be administered together with the 5T4 binding agent (e.g., an antibody or ADC), such as a human 5T4 binding agent, or provided in a separate composition using the same or different routes of administration. One or more additional agents (including therapeutic agents) may be administered together with the 5T4 binding agent (e.g., an antibody or ADC) or separately (e.g., simultaneously, alternately, sequentially) (e.g., for combination therapy). Such additional therapeutic agents include, but are not limited to, therapeutic antibodies, immunotherapies and immunotherapeutics, cytotoxic agents, chemotherapeutics, and inhibitors.
[0216] Therapeutic antibodies that can be used with a 5T4 binder (e.g., an antibody or ADC) as described herein (e.g., for combination therapy) include, but are not limited to, trastuzumab; abciximab; daclizumab; BEC2; IMC-C22; vitaxin; Campath 1H / LDP-03; Smart M195; epratuzumab; betumomab; visilizumab; CM3, a humanized anti-ICAM3 antibody; IDEC-114; ibritumomab tiuxetan; IDEC-131; IDEC-151; IDEC-152; SMART anti-CD3; eculizumab; adalimumab; certolizumab pegol; IDEC-151; MDX-CD4; CD20-streptavidin; CDP571; LDP-02; OrthoClone OKT4A; ruplizumab; natalizumab; and lerdeumab; or their biosimilars.
[0217] Immunotherapies and immunotherapeutic agents that can be used with a 5T4 binder (e.g., an antibody or ADC) as described herein (e.g., for combination therapy) include, but are not limited to, cytokines such as granulocyte-macrophage colony-stimulating factor (GM-CSF), granulocyte colony-stimulating factor (G-CSF), macrophage inflammatory protein (MIP)-1-α, interleukins (including IL-1, IL-2, IL-4, IL-6, IL-7, IL-12, IL-15, IL-18, IL-21, and IL-27), tumor necrosis factor (including TNF-α), and interferons (including IFN-α, IFN-β, and IFN-γ); aluminum hydroxide (alum); bacillus Calmette-Guérin (BCG); keyhole limpet hemocyanin (KLH); incomplete Freund's adjuvant (IFN-α); A); QS-21; DETOX; Levamisole; and dinitrophenol (DNP), and combinations thereof, such as a combination of an interleukin (eg, IL-2) and other cytokines (eg, IFN-α). In some embodiments, immunotherapy includes immunotherapeutics that regulate immune responses, such as checkpoint inhibitors or checkpoint agonists. In some embodiments, immunotherapeutics are antibody modulators targeting PD-1, 5T4, PD-L2, CEACAM (eg, CEACAM-1, -3, and / or -5), CTLA-4, TIM-3, LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, TGF β, OX40, 41BB, LIGHT, CD40, GITR, TGF-β, TIM-3, SIRP-α, VSIG8, BTLA, SIGLEC7, SIGLEC9, ICOS, B7H3, B7H4, FAS, and / or BTNL2, etc. In some embodiments, immunotherapeutic agents are agents that increase the activity of natural killer (NK) cells. In some embodiments, immunotherapeutic agents are agents that suppress immune response suppression. In some embodiments, immunotherapeutic agents are agents that suppress suppressor cells or suppress cell activity. In some embodiments, immunotherapeutic agents are agents or therapies that suppress Treg activity. In some embodiments, immunotherapeutic agents are agents that suppress the activity of inhibitory immune checkpoint receptors.
[0218] In some embodiments, immunotherapeutic agent includes the T or NK or NKT cell regulator of the agonist or activator selected from costimulatory molecules.In one embodiment, the agonist of costimulatory molecules is selected from GITR, OX40, ICOS, SLAM (such as SLAMF7), HVEM, LIGHT, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a / CD18), ICOS (CD278), 4-1BB (CD137), CD30, CD40, BAFFR, CD7, NKG2C, NKp80, CD160, B7-H3 or CD83 ligand agonist (for example, agonistic antibodies or its antigen-binding fragment or soluble fusion).In other embodiments, effector cell combination includes bispecific T cell adapter (for example, with reference to CD3 and tumor antigen (for example, EGFR, PSCA, PSMA, EpCAM, HER2 etc.) bispecific antibody molecule) or bispecific NK cell adapter.
[0219] Cytotoxic agents that can be used (e.g., for combination therapy) with 5T4 binding agents as described herein (e.g., antibodies or ADCs) include substances that inhibit or prevent cell function and / or cause cell death or destruction. Exemplary cytotoxic agents include, but are not limited to, radioisotopes (e.g., At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212, and radioisotopes of Lu); growth inhibitors; enzymes and fragments thereof, such as nuclear lytic enzymes; and toxins, such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant, or animal origin, including fragments and / or variants thereof. Other exemplary cytotoxic agents can be selected from antimicrotubule agents, platinum coordination complexes, alkylating agents, antibiotic agents, topoisomerase II inhibitors, antimetabolites, topoisomerase I inhibitors, hormones and hormone analogs, signal transduction pathway inhibitors, non-receptor tyrosine kinase angiogenesis inhibitors, immunotherapeutic agents, pro-apoptotic agents, LDH-A inhibitors; fatty acid biosynthesis inhibitors; cell cycle signaling inhibitors; HDAC inhibitors, proteasome inhibitors; and cancer metabolism inhibitors.
[0220] Chemotherapeutic agents that can be used with a 5T4 binder (e.g., an antibody or ADC) as described herein (e.g., for combination therapy) include compounds that can be used to treat cancer. Examples of chemotherapeutic agents include, but are not limited to, erlotinib, bortezomib, disulfiram, epigallocatechin gallate, salinosporine A, carfilzomib, 17-AAG (geldanamycin), radicicol, lactate dehydrogenase A (LDH-A), fulvestrant, sunitinib, letrozole, imatinib mesylate, fmasunate, oxaliplatin, 5-FET (5-fluorouracil), leucovorin, rapamycin, lapatinib, lonafamib (SCH 66336), sorafenib (Bayer Labs), gefitinib, AG1478; alkylating agents such as thiotepa and Cyclophosphamide; alkyl sulfonates, such as busulfan, improsulfan, and piposulfan; aziridines, such as benzodopa, carboquinone, meturedopa, and uredopa; ethyleneimines and methylamelamines, including hexamethylmelamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide, and trishydroxymethylmelamine; acetogenins (especially bullatacin and bullatacinone); camptothecins (including topotecan and irinotecan); bryostatin; cally statin; CC-1065 (including its synthetic analogs adozelesin, carzelesin, and bizelesin); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); adrenocortical steroids (including prednisone and prednisolone); cyproterone acetate; 5α-reductase inhibitors (including finasteride and dutasteride); vorinostat, romidepsin, panobinostat, valproic acid, mocetinostat, dolastatin; aldesleukin, talc-duocarmycin (including synthetic analogs KW-2189 and CB1-TM1); eleutherobin; pancratis tatin; sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlorpromazine, clofosamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimustine; antibiotics such as enediyne antibiotics (e.g., calicheamicins, particularly calicheamicin gamma II and calicheamicin omega I (Angew Chem. Inti. Ed. Engl. 1994 33:183-186); dynemicins, including dynemicin A; bisphosphonates such as clodronate; espamycins;and neocanstatin chromophores and related chromoprotein enediyne antibiotic chromophores), aclarubicin, actinomycin, authramycin, azaserine, bleomycin, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycin, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin, and deoxydoxorubicin), epirubicin, elarubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, noramycin, olivomycin, peplomycin, porphyrin, puromycin, quelamycin in), rhodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, and zorubicin; antimetabolites, such as methotrexate and 5-fluorouracil (5-FU); folate analogs, such as leucovorin, methotrexate, and fenvalerate , trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thioimidazole, and thioguanine; pyrimidine analogs such as ancitabine, azacitidine, azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, and floxuridine; androgens such as calutosterone, drostanolone propionate, epithioandrostol, melastane, and testolactone; antiadreners such as aminoglutethimide, mitotane, and trilostane; folic acid supplements such as folinic acid acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defosfamide; demecolcine; diaziquone; elfornithine; elliptinium acetate; epothilones; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; maytansine alkaloids, such as maytansine and ansamitocin; mitoguanidine; mitoxantrone; mopidarol; nitracrine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllic acid; 2-ethylhydrazide; procarbazine; polysaccharide complex (JHS Natural Products, Eugene, Ore.); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine; trichothecenes, particularly T-2 toxin, verrucarin A, roridin A, and anguidine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; cytarabine ("Ara-C"); cyclophosphamide; thiotepa; taxoids, such as paclitaxel, (without Cremophor), albumin engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, Ill.) and docetaxel (docetaxel / doxetaxel); chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs, such as cisplatin and carboplatin; vinblastine; etoposide (VP-16); ifosfamide; etoposide (VP-16); ifosfamide; mitoxantrone; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunorubicin; aminopterin; capecitabine; ibandronate; CPT-11; the topoisomerase inhibitor RFS2000; difluoromethylornithine (DMFO); retinoids, such as retinoic acid; acid); and pharmaceutically acceptable salts, acids and derivatives of any of the foregoing. Chemotherapeutic agents also include (i) antihormonal agents used to modulate or inhibit the effects of hormones on tumors, such as antiestrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including tamoxifen citrate), raloxifene, droloxifene, iodoxifene, 4-hydroxytamoxifen, troxifene, keoxifene, LY117018, onapristone and toremifene citrate; (ii) aromatase inhibitors that inhibit the aromatase enzyme that regulates estrogen production in the adrenal glands, such as 4(5)-imidazoles, aminoglutethimide, megestrol acetate, exemestane, formestane, fadrozole, vorozole, letrozole and anastrozole; (i ii) antiandrogens, such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; buserelin, triptorelin, medroxyprogesterone acetate, diethylstilbestrol, premarin, fluoxymesterone, all-trans retinoic acid, fenretinide, and troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase inhibitors; (v) lipid kinase inhibitors; (vi) antisense oligonucleotides, particularly those that inhibit the expression of genes in signal transduction pathways involved in abnormal cell proliferation, such as PKC-α, Ralf, and H-Ras; (vii) ribozymes, such as inhibitors of VEGF expression (e.g., ) and HER2 expression inhibitors; (viii) vaccines, such as gene therapy vaccines, e.g. and rIL-2; topoisomerase 1 inhibitors, such as and (ix) pharmaceutically acceptable salts, acids and derivatives of any of the foregoing.
[0221] Chemotherapeutic agents also include antibodies as described above, including alemtuzumab, bevacizumab; cetuximab; panitumumab, rituximab, pertuzumab, tositumomab, and the antibody drug conjugate gemtuzumab ozogamicin.Additional humanized monoclonal antibodies with therapeutic potential as agents for combination with 5T4-binding agents (e.g., antibodies) as described herein include: apolizumab, aselizumab, atlizumab, bapinezumab, bivacizumab maytansine, cantuzumab maytansine, cecilizumab, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab ... zumab), felvizumab, fontolizumab, gemtuzumab ozogamicin, ituzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab Monoclonal antibodies, nimotuzumab, nivolumab, nolovizumab, nunamizumab, ocrelizumab, omalizumab, palivizumab, pascolizumab, pecfusituzumab, pertuzumab, pexelizumab, ralivizumab, ranibizumab, reslivizumab, reslizumab, resyvizumab, rovelizumab, lulizumab, sibrotuzumab, siplizumab, sontuzumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tefibazumab, tocilizumab, toralizumab, tucotuzumab celmoleukin, tucusituzumab, umavizumab, ustekinumab, visilizumab, and anti-interleukin-12 (ABT-8744695, Wyeth Research and Abbott Laboratories), a recombinant, purely human, full-length IgG1λ antibody genetically modified to recognize the interleukin-12p40 protein.Chemotherapeutic agents also include dexamethasone, interferon, colchicine, clofentazine, cyclosporine, amphotericin, metronidazole, alemtuzumab, alitretinoin, allopurinol, amifostine, arsenic trioxide, asparaginase, live BCG, bevacizumab, bexarotene, cladribine, clofarabine, darbepoetin α, denileukin, dexrazoxane, epoetin α, elotinib, filgrastim, histrelin acetate, ibritumomab, interferon α-2a, interferon α-2b, lenalidomide, levamisole, mesna, methoxsalen, nandrolone, nelarabine, nofetumomab, oprelvekin, palifermin, pamidronate, pegademase, pegaspargase, pegfilgrastim, pemetrexed disodium, plicamycin, porfimer sodium sodium), quinacrine, rasburicase, sargramostim, temozolomide, VM-26, 6-TG, toremifene, tretinoin, ATRA, valrubicin, zoledronate and zoledronic acid, and pharmaceutically acceptable salts thereof.
[0222] Chemotherapeutic agents also include hydrocortisone, hydrocortisone acetate, cortisone acetate, tixocortol pivalate, triamcinolone acetonide, triamcinolone alcohol, mometasone, amcinonide, budesonide, desonide, fluocinolone acetonide, fluocinolone acetonide, betamethasone, betamethasone sodium phosphate, dexamethasone, dexamethasone sodium phosphate, fluocortolone, hydrocortisone-17-butyrate, hydrocortisone-17-valerate, alclometasone dipropionate, betamethasone valerate, betamethasone dipropionate, prednicarbate, clobetasone-17-butyrate, clobetasone-17-propionate, fluocortolone caproate, fluocortolone pivalate, and flupredniidine acetate; immunoselective anti-inflammatory peptides (ImSAIDs), such as phenylalanine-glutamine-glycine (FEG) and its D-isomer (feG) (IMULAN BioTherapeutics, LLC); antirheumatic drugs such as azathioprine, cyclosporine (cyclosporine A), D-penicillamine, gold salts, hydroxychloroquine, leflunomide, minocycline, sulfasalazine, tumor necrosis factor alpha (TNF α) blockers such as etanercept, infliximab, adalimumab, certolizumab bpegol, golimumab (Simponi), interleukin 1 (IL-1) blockers such as anakinra, T cell costimulation blockers such as abatacept, interleukin 6 (IL-6) blockers such as tocilizumab; interleukin 13 (IL-13) blockers such as lebrikizumab; interferon alpha (IFN) blockers such as rontalizumab; β7 integrin blockers such as rhuMAb β7; IgE pathway blockers such as anti-M1 prime; blockers of the secreted homotrimer LTa3 and the membrane-bound heterotrimer LTal / 132, such as antilymphotoxin alpha (LTa); miscellaneous investigational agents, such as thioplatin, PS-341, phenyl butyrate, Et-I8-OCH3, or farnesyltransferase inhibitors (L-739749, L-744832); polyphenols, such as quercetin, resveratrol, piceatannol, epigallocatechin gallate, theaflavins, flavanols, proanthocyanidins, betulinic acid, and their derivatives; autophagy inhibitors, such as chloroquine; delta-9-tetrahydrocannabinol (dronabinol); beta-lapachone; lapachol; colchicines; betulinic acid; acetylcamptothecin, scopolamine, and 9-aminocamptothecin; podophyllotoxin; tegafur; bexarotene; bisphosphonates, such as clodronate, etidronate, NE-58095, zoledronic acid / zoledronate, alendronate, pamidronate, tiludronate, or risedronate; and epidermal growth factor receptor (EGF-R); vaccines, such as Vaccines; perifosine, COX-2 inhibitors (such as celecoxib or etoricoxib), proteosome inhibitors (such as PS341); CCI-779; tipifarnib (R11577); orafenib, ABT510; Bcl-2 inhibitors such as oblimersen sodium and pixantrone; farnesyl transferase inhibitors such as lonafarnib (SCH 6636); and pharmaceutically acceptable salts, acids or derivatives of any of the above; and combinations of two or more of the above, such as CHOP (abbreviation for the combination therapy of cyclophosphamide, doxorubicin, vincristine and prednisolone); and FOLFOX (abbreviation for the treatment regimen of oxaliplatin combined with 5-FU and folinic acid). Chemotherapeutic agents also include poly ADP ribose polymerase (PARP) inhibitors: olaparib, rucaprib, niraparib, talzoparib.
[0223] Inhibitors that can be used with a 5T4-binding agent (e.g., an antibody) as described herein (e.g., for combination therapy) include, but are not limited to, kinase inhibitors such as imatinib, baricitinib, gefitinib, erlotinib, sorafenib, dasatinib, sunitinib, lapatinib, nilotinib, pirfenidone, pazopanib, crizotinib, velotinib, crottotinib, vandetanib, ruxolitinib, axitinib, bosutinib, regorafenib, tofacitinib, cabozantinib, ponatinib, trametinib, dabrafenib, afatinib, ibrutinib, ceritinib, idelalisib, nintedanib, palbociclib, lenvatinib, cobimetinib, abemaciclib, acalabrutinib, alectinib, binimetinib, and selegiline. inib), brigatinib, encorafenib, erdafitinib, everolimus, fostamatinib, gilter, larotrectinib, lorlatinib, netarsudil, osimertinib, pemitinib, pexidartinib, ribociclib, temsirolimus, XL-092, XL-147, XL-765, XL-499, and XL-880. In some embodiments, the compounds described herein can be used in combination with an HSP90 inhibitor (e.g., XL888), a liver X receptor (LXR) modulator, a retinoid-related orphan receptor gamma (RORy) modulator, a checkpoint inhibitor such as a CK1 inhibitor or a CK1 alpha inhibitor, a Wnt pathway inhibitor (e.g., SST-215), or a mineralocorticoid receptor inhibitor (e.g., ixacetolone), or XL-888 for the treatment of a disease disclosed herein, such as cancer.In some embodiments, a 5T4-binding agent (e.g., an antibody) as disclosed herein can be used in combination with an inhibitor of one or more of the following kinases for the treatment of cancer: Akt1, Akt2, Akt3, TGF-βR, PKA, PKG, PKC, CaM-kinase, phosphorylase kinase, MEKK, ERK, MAPK, mTOR, EGFR, HER2, HER3, HER4, 1NS-R, IGF-1R, IR-R, PDGFαR, PDGFβ / R, CSFIR, KIT, FLK-II, KDR / FL K-1, FLK-4, flt-1, FGFR1, FGFR2, FGFR3, FGFR4, Ron, Sea, TRKA, TRKB, TRKC, FLT3, VEGFR / Flt2, Flt4, EphAl, EphA2, Eph A3, EphB2, EphB4, Tie2, Src, Fyn, Lck, Fgr, Btk, Fak, SYR, FRK, JAK (JAK1 and / or JAK2), ABL, ALK, CDK7, CDK12, KRAS and B-Raf.
[0224] Other non-limiting examples of inhibitors that can be used with a 5T4 binding agent (e.g., an antibody or ADC) as described herein, e.g., for treating cancer (e.g., for combination therapy), include FGFR inhibitors (FGFR1, FGFR2, FGFR3, or FGFR4, e.g., pemigatinib), EGFR inhibitors (also known as ErB-1 or HER-1; e.g., erlotinib, gefitinib, vandetanib, osimertinib, cetuximab, necitumumab, or panitumumab), VEGFR inhibitors or pathway blockers (e.g., bevacizumab, pazopanib, sunitinib, sorafenib, axitinib, regorafenib, ponatinib, vandetanib, ramucirumab, lenvatinib, ziv-aflibercept), PARP inhibitors (e.g., olaparib, rucaparib, veliparib), arib or niraparib), and JAK inhibitors (e.g., ruxolitinib, baricitinib, itatinib), IDO inhibitors (e.g., epacadostat, NLG919 or BMS-986205, MK7162), LSD1 inhibitors, TDO inhibitors, PI3K-δ inhibitors (e.g., parsaclisib), PI3K-γ inhibitors such as PI3K-γ selective inhibitors, Pim inhibitors, CSF1R inhibitors, TAM receptor tyrosine kinases (Tyro-3, Axl, and Mer), adenosine receptor antagonists (e.g., A2a / A2b receptor antagonists), HPK1 inhibitors, chemokine receptor inhibitors (e.g., CCR2 or CCR5 inhibitors), SHP1 / 2 phosphatase inhibitors, histone deacetylase (HDAC) such as HDAC8 inhibitors, angiogenesis inhibitors, interleukin receptor inhibitors, bromo and extra terminal family (bromo and extra terminal family) member inhibitors (e.g., bromodomain inhibitors or BET inhibitors) or a combination thereof.
[0225] In some embodiments, a 5T4-binding agent (e.g., an antibody or ADC) as disclosed herein can be used in combination with a PD-1 inhibitor or a 5T4 inhibitor, such as an anti-PD-1 monoclonal antibody or an anti-5T4 monoclonal antibody, such as nivolumab (Opdivo), pembrolizumab (Keytruda, MK-3475), atezolizumab, avelumab, cemiplimab, spartalizumab, camrelizumab, or the like. relizumab), cetrelimab, toripalimab, sintilimab, AB122, JTX-4014, BGB-108, BCD-100, BAT1306, LZM009, AK105, HLX10 and TSR-042, AMP-224, AMP-514, PDR001, durvalumab, pidilizumab, CT-011), CK-301, BMS936559, MPDL3280A, tislelizumab, BMS-935559, MEDI4736, FAZ053, KN035, CS1001, CBT-502, A167, STI-A101, BGB-A333, MSB-2311, HLX20, AUNP12, CA-170, BMS-986189, LY3300054, and MSB0010718C.
[0226] In some embodiments, multispecific binding agents as disclosed herein can be used in combination with CTLA-4 inhibitors, such as anti-CTLA-4 antibodies, e.g., ipilimumab (Yervoy), tremelimumab, and AGEN1884, or with phosphatidylserine inhibitors, such as bavituximab (PGN401), or with antibodies to cytokines (IL-10, TGF-β, etc.), or with bispecific antibodies that bind 5T4 and CTLA-4 (e.g., AK104) or PD-1 and CTLA-4, or with other anticancer agents such as cemiplimab.
[0227] The additional agent can be a pharmaceutically acceptable salt, ester, amide, hydrate and / or prodrug of any of these therapeutic agents or other agents described above.
[0228] It is to be understood that modifications that do not substantially affect the activity of the various embodiments described herein are also provided within the definition of the subject matter described herein.Accordingly, the following examples are intended to illustrate and not to limit the present disclosure. Example
[0229] Example 1. Antibody Generation
[0230] To obtain binders to human 5T4, antibody discovery was performed by phage display.
[0231] A. Phage Display
[0232] To obtain binders to human 5T4, antibody discovery was performed by phage display of a human Fab library using standard protocols. The extracellular domain of human 5T4 was purchased from Acro Biosystems (biotinylated human 5T4 His-Avitag Acro, catalog number TPG-H83Eb) or generated. The generated antigens consisted of human 5T4, cynomolgus monkey 5T4, and mouse 5T4, all cloned into a vector containing a C-terminal 6-his-Avi tag and, where possible, biotinylated in vitro using a co-expressed biotin ligase using standard procedures.
[0233] Phage clones are screened for the ability in conjunction with biotinylated human 5T4. In brief, the phage library of Fab format is constructed using the expression vector (also referred to as phagemid) that can be replicated and expressed in phage. Heavy chain and light chain are encoded in identical expression vectors, wherein heavy chain merges with the brachymembrane variant of phage coat protein pill. Light chain and heavy chain-pIII fusions are expressed as independent polypeptides and assembled in the bacterial periplasm, wherein redox potential enables the formation of disulfide bond, to form the antigen-binding domains (Fab) of candidate antibodies.
[0234] The library was created using sequences derived from specific human heavy chain variable domains and specific human light chain variable domains. The light chain variable domains within the screening library were generated, diversity was introduced into the VL CDR3 (L3), and wherein the light chain VL CDR1 (L1) and CDR2 (L2) retained human germline sequences. For the screened library, all three CDRs of the VH domain were diversified to match the positional amino acid frequency according to the CDR length found in the human antibody repertoire. The phage display heavy chain (SEQ ID NO: 72) and light chain (SEQ ID NO: 73) scaffolds used in the library are listed below, where "x" represents the CDR amino acids that were changed to create the library, and bold italics represent constant CDR sequences.
[0235] The sequence of SEQ ID NO: 72 is
[0236]
[0237] The sequence of SEQ ID NO: 73 is
[0238]
[0239] Diversity was generated by mutagenesis using degenerate DNA oligonucleotide primers to introduce diversity into the VL CDR3 (L3) and VH CDR1 (H1), CDR2 (H2) and CDR3 (H3) to mimic the diversity found in natural antibody repertoires, as described in Kunkel, TA (PNAS 1985 January 1, 82 (2) 488-492), the entire contents of which are incorporated herein by reference. Briefly, single-stranded circular DNA incorporating uracil was prepared from isolated phage using standard procedures and Kunkel mutagenesis was performed to introduce diversity into the four CDRs. The chemically synthesized DNA was then electroporated into TG1 cells and subsequently recovered. The recovered cells were subcultured and infected with M13K07 helper phage to generate a phage library.
[0240] Phage panning was performed using standard procedures. Briefly, the first round of phage panning was performed with targets immobilized on streptavidin magnetic beads that were subjected to approximately 1 × 10 12 Phage from the prepared library were in a volume of 1 ml in PBST-2% BSA. After 1 hour of incubation, bead-bound phage were separated from the supernatant using a magnetic stand. The beads were washed three times to remove non-specifically bound phage and then the OD 600 After incubation at room temperature for 20 minutes, the infected cells were incubated in 25 ml of 2xYT+ampicillin and M13K07 helper phage (final concentration of about 1×10 10 pfu / ml) in the passage culture, and allow to grow overnight at 37 ℃ with vigorous shaking. The next day, standard procedure was used to prepare phage by PEG precipitation. Before panning, the beads of SAV coating were pre-cleared of specific phage. The second round of panning used KingFisher magnetic bead processor and 50 or 100nM beads to fix the 5T4 antigen, using standard procedure (100nM 5T4 was used for the 3rd round, and 50nM 5T4 was used for the 4th round). A total of 3-4 rounds of phage panning were carried out to enrich the phage display of Fab specific to the 5T4 antigen. Polyclonal ELISA was used to confirm the 5T4 specific enrichment, and individual clones were separated and further verified by performing monoclonal phage ELISA. DNA sequencing was used to determine the sequence of the CDR of the isolated Fab clone containing the candidate antibody.
[0241] The genes encoding the heavy and light chain variable domains of the candidate antibody are cloned separately into mammalian expression vectors for expression as full-length IgG in mammalian cells.
[0242] For full-length IgG, the heavy chain constant region (e.g., CH1 = normal text; hinge = italic text; CH2 = bold text; and CH3 = underlined text) includes the following amino acid sequence:
[0243]
[0244]
[0245] For full-length IgG, the light chain constant region (e.g., CL) includes the following amino acid sequence:
[0246]
[0247] IgG antibodies were purified from the culture supernatant using protein A resin.
[0248] Example 2. Screening assay
[0249] A bivalent binding assay was used to provide data on whether the VH / VL antibodies obtained by phage display in Example 1 bind to immobilized 5T4 from all three clinically relevant species: human, cynomolgus monkey (cyno), and mouse. For bivalent binding and cross-reactivity assays, 5T4 human, cynomolgus monkey, and mouse antigens were synthesized using sequences from a protein database and expressed as biotinylated proteins using a his-avi tag and in vivo biotinylation with a co-expressed BirA enzyme.
[0250] A standard Octet-based assay was used to qualitatively determine whether each antibody bound to each antigen. For these assays, 200 nM biotinylated antigen was immobilized on a streptavidin biosensor in 1X kinetic buffer (ForteBio). The loaded sensor was then immersed in a well containing 500 nM of the antibody of interest and the association binding signal was monitored. An increase in signal above the negative control during the association step was considered binding to the antigen.
[0251] For qualitative binding affinity using Octet, all 27 antibodies tested showed binding to human 5T4, 13 antibodies also showed binding to cynomolgus monkey 5T4, and 13 antibodies also showed binding to mouse 5T4. Data for exemplary antibodies are shown in Table 4 below.
[0252] Table 4. Qualitative bivalent binding affinity by Octet
[0253]
[0254] The relative affinity of each 5T4 binder obtained by phage display in Example 1 to human 5T4 was determined using a monovalent binding assay. Human 5T4 was purchased from Acro Biosystems (Acro catalog number TPGH52E) and was also produced separately. The monovalent interaction of the binder with human 5T4 was monitored using an Octet (PallForteBio) instrument. For these assays, 36nM of antibody was immobilized on an anti-human Fc (AHC) sensor in 1X kinetic buffer (ForteBio). The sensor was then immersed in a well containing 3X serial dilutions of human 5T4 ranging from 1 μM to 1.37nM. The association was allowed to reach equilibrium. The sensor was then moved to a well containing only 1X kinetic buffer and allowed to dissociate to equilibrium. The association and dissociation rates were measured, and the monovalent K was calculated from these using the onboard analysis software (ForteBio). D .
[0255] Of all 27 tested antibodies, most showed weak binding in the monovalent binding affinity-internal (Lot 20-019-62) assay. mAbA4, mAbA15, and mAbA17 all showed strong or moderate binding in all three lots. The data are shown in Table 5 below.
[0256] Table 5. Qualitative monovalent binding affinity by Octet
[0257]
[0258] Example 3: Additional screening and selection
[0259] Antibodies selected for binding to 5T4, eg, such as those described in Example 2, are evaluated for binding to cells expressing 5T4.
[0260] Cells at 70%-90% confluence were harvested on the day of the assay. In a v-bottom 96-well plate (Costar 3897), 100,000 cells per well were incubated at +4°C for 30 minutes with 50 μL of an 8-point or 12-point antibody dilution series per well. After incubation, the cells were washed once with PBS by centrifugation at 200 x g for 5 minutes. The cells were then incubated at +4°C for 30 minutes with 50 μL of AlexaFluor488 goat anti-human IgG Fab (Jackson Immuno Research 109-547-003) diluted 1:100 per well. The cells were washed twice with PBS by centrifugation at 200 x g for 5 minutes and collected on an iQue Screener Plus (Sartorius). The mean fluorescence intensity of the BL1 (Alexa-Fluor-488) channel was plotted against the antibody concentration to generate a dose response curve and EC50 value.
[0261] Among the 27 antibodies tested, 26 antibodies showed binding affinity to HEK-5T4 cells, 16 antibodies showed binding affinity to MCF-7 cells, and 26 antibodies showed binding affinity to HEK-cyno-5T4 cells.
[0262] Selected antibodies that bound to all three HEK-5T4, MCF-7, and HEK-cyno-5T4 cell lines (including mAbA4, mAbA15, and mAbA17) were further evaluated in internalization assays in HEK-5T4 and MCF-7 cells.
[0263] Adherent cells at 70%-90% confluence were harvested and plated overnight at 20,000 cells / well in 50 μL culture medium in 96-well black transparent / flat-bottom half-area plates (Corning3882) at 37°C. For suspension cell lines, 96-well plates were coated with poly-L-ornithine solution (Millipore-Sigma) at 37°C for 1 hour, and cells were seeded in 50 μL culture medium at a density of 40,000 cells / well approximately 1-2 hours before the assay. The antibody was diluted in cell culture medium, mixed with 3X molar concentration of Incucyte human FabFluor-pH red antibody labeling reagent, and incubated at room temperature for 15 minutes. All dilutions of the antibody / FabFluor mixture were prepared at a final concentration of 2X. 50 μL of the 2X antibody / Fab-Fluor mixture was then added directly to each well with pre-seeded cells in duplicate, and the plate was quickly transferred to Incucyte. The plate was then scanned every 30 minutes for up to 24 hours. Note that the first scan (0 hour) was started within 2-3 minutes of adding the antibody / FabFluor mixture to the cells. The plates were analyzed by reading the red signal generated over time and normalized to the % confluence of the cells in that well. A small amount of antibody was tested at different concentrations on the target cell line, and the optimal concentration was selected based on a good signal-to-noise ratio.
[0264] In the internalization assay, 6 antibodies (including mAbA4 and mAbA15) showed strong internalization in HEK-5T4 cells, one antibody showed moderate internalization in HEK-5T4 cells, and 7 antibodies showed no internalization or nonspecific internalization in HEK-5T4 cells. In another assay, 2 antibodies showed strong internalization in MCF 7 cells, 4 antibodies showed moderate internalization in HEK-5T4 cells, and 8 antibodies showed no internalization or nonspecific internalization in MCF-7 cells.
[0265] Example 4: Developability Assay
[0266] Antibodies selected for binding to 5T4 are tested in various developability methods, e.g., as described in Examples 2 and 3. For example, various chromatography methods, including size exclusion chromatography (SEC), hydrophobic interaction chromatography (HIC), and vertical monolayer adsorption chromatography (SMAC), are employed to assess developability factors such as percent monomer, solubility, and antibody aggregation or precipitation.
[0267] Size exclusion chromatography (SEC) analysis was performed on an Agilent 1100 HPLC using a 7.8 mm ID x 30 cm TSKgel G3000SWXL column (Tosoh Bioscience LLC, PN 08541) and a 6 mm x 4 cm guard column (PN 08543). 2+ / Mg 2+ ) was standardized to a concentration of 1 mg / mL and clarified by centrifugation to precipitate particles while still retaining soluble aggregates. The mobile phase buffer was 2X concentration Dulbecco's PBS (pH 7.4, without Ca) diluted from the 10X stock concentration. 2+ / Mg 2+ ). For each sample, 10 μL was loaded and eluted isocratically at 1.0 mL / min for 20 minutes at ambient temperature. Absorbance was monitored at 280 nm. The chromatographic peaks were integrated to determine the homogeneity percentage and retention time. In addition to molecular size analysis (sizing), the choice of column stationary phase and mobile phase also supports hydrophobic and electrostatic interactions (secondary interactions are much milder than SMAC). Data analysis was performed using an Agilent ChemStation B.04.03S P1.
[0268] The results showed that mAbA4, mAbA15, and mAbA17 (and other antibodies tested) had strong developability based on SEC analysis.
[0269] Hydrophobic interaction chromatography (HIC) analysis was performed on an Agilent 1100 HPLC using a 4.6 mm ID x 3.5 cm TSKgelButyl-NPR column (Tosoh Bioscience LLC, PN 14947). The antibody was diluted in Dulbecco's PBS (pH 7.4, without calcium). 2+ / Mg 2+) was standardized to a concentration of 1 mg / mL. At ambient temperature, the column was balanced with 100% mobile phase buffer A (2M ammonium sulfate / 20mM sodium phosphate, pH 7.0) at a flow rate of 1 mL / min. For each sample, 10 μL was loaded and eluted at 1.0 mL / min for 15 minutes using a gradient from 100% mobile phase buffer A to 100% mobile phase buffer B (20mM sodium phosphate, pH 7.0), maintained at 100% B for 3 minutes to wash the column, and returned to 100% A for 2 minutes to balance. Absorbance was monitored at 280 nm. Sample retention times were calculated and compared with a set of standard controls to identify the presence of antibodies and various substances with increased retention times (increased hydrophobicity). Data analysis was performed using Agilent ChemStation B.04.03SP1.
[0270] Results from hydrophobic interaction chromatography (HIC) analysis indicated that some antibodies had strong developability, while others had moderate developability. Based on HIC analysis, mAbA4, mAbA15, and mAbA17 were among those with strong developability. Antibody hydrophobicity can influence antibody aggregation, solubility, and viscosity. Results indicated that these antibodies had a low tendency to aggregate and precipitate.
[0271] Use 4.6mmID x 300mm Zenix SEC 300 column (Sepax Technologies, PN 21 3300P-4630) and 4.6mm x 50mm guard column (PN 213300P-4605) to carry out vertical single layer adsorption chromatography (SMAC) analysis on Agilent 1100HPLC. Antibody is standardized to 1mg / mL concentration in Dulbecco PBS (pH 7.4, without Ca2+ / Mg2+) and clarified by centrifugation to precipitate particles while still retaining soluble aggregates. Mobile phase buffer is Dulbecco PBS (pH 7.4, without Ca2+ / Mg2+) at a concentration of 2X (diluted from 10X stock solution concentration). For each sample, 10 μL are loaded and eluted isocratically at ambient temperature for 32 minutes at 0.4mL / min. Absorbance is monitored at 280nm. Sample retention times were calculated and compared to a set of standard controls to identify antibodies with increased retention times (increased tendency to form aggregates and / or increased hydrophobic / electrostatic interactions) since the column stationary phase in conjunction with the mobile phase selection promotes secondary interactions in addition to molecular size analysis. Data analysis was performed using an Agilent ChemStation B.04.03S P1.
[0272] Results from vertical monolayer adsorption chromatography (SMAC) analysis showed that some antibodies had strong developability, while others had moderate developability. Based on SMAC analysis, mAbA4, mAbA15, and mAbA17 were those with strong developability. This assay was based on good retention times, which indicate colloidal stability and low aggregation tendency.
[0273] Example 5: Epitope binning assay
[0274] Epitope binning assays were used to determine which epitopes of 5T4 each antibody obtained by phage display in Example 1 bound.
[0275] In order to maintain the overall structure of the 5T4 protein, while still being able to carry out epitope binding determination, each of the seven continuous sequences (epitopes 1-7) of the cloned human 5T4 was used to replace each of the corresponding mouse sequences to produce a mouse-human chimera. In order to produce a chimera, full-length human and mouse 5T4 genes were synthesized and cloned into a mammalian vector with a 6-His-Avi tag by GenScript. Each of the seven sequences (epitopes 1-7) as described herein was then removed from the human gene and cloned into the mouse gene using appropriate primers. Epitope 1 (H1) of human 5T4 corresponds to SSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSEAART (SEQ ID NO: 76); epitope 2 (H2) of human 5T4 corresponds to VKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVR (SEQ ID NO: 77); epitope 3 (H3) of human 5T4 corresponds to AGAFEHLPSLRQLDLSHNPLADLSPFAFSG (SEQ ID NO: 78); epitope 4 (H4) of human 5T4 corresponds to SNASVSAPSPLVELILNHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLE (SEQ ID NO: 79); epitope 5 (H5) of human 5T4 corresponds to LASNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESL (SEQ ID NO: NO: 80); epitope 6 (H6) of human 5T4 corresponds to HLEDNALKVLHNGTLAELQGLPHIRVFL (SEQ ID NO: 81); and epitope 7 (H7) of human 5T4 corresponds to DNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTS (SEQ ID NO: 82). Antigens were transiently expressed using the Expi293 protein expression system (Thermo Fisher), biotinylated in vitro using co-expressed BirA biotin ligase, and purified using Ni-NTA affinity chromatography.As shown in Table 6, seven chimeric constructs of human (H) and mouse (M) sequences were generated: (1) H1 M2 M3 M4 M5 M6 M7 (SEQ ID NO: 83); (2) M1 H2 M3 M4 M5 M6 M7 (SEQ ID NO: 84); (3) M1 M2 H3 M4 M5 M6 M7 (SEQ ID NO: 85); (4) M1 M2 M3 H4 M5 M6 M7 (SEQ ID NO: 86); (5) M1 M2 M3 M4 H5 M6 M7 (SEQ ID NO: 87); (6) M1 M2 M3 M4 M5 H6 M7 (SEQ ID NO: 88); and (7) M1 M2 M3 M4 M5 M6 H7 (SEQ ID NO: 89). Each antibody was then tested for binding to each chimeric construct and the full-length human protein. Any significant binding signal to the chimera indicates the region to which the antibody specifically binds.
[0276] Table 6.5T4 chimeric constructs
[0277]
[0278]
[0279] A standard Octet-based assay was used for epitope binning assays to establish epitope bins for each antibody. For these assays, 50 nM biotinylated antigen was immobilized on a streptavidin sensor in 1X kinetic buffer (ForteBio). The sensor was then immersed in a well containing 100 nM of the antibody in question and the association signal was monitored. Chimeras that effectively knocked out antibody binding corresponded to the specific epitope bound by the antibody. Full-length human 5T4 was included in the assay for reference.
[0280] The results showed that 9 antibodies specifically bound to epitope 4 of 5T4, 3 antibodies specifically bound to epitope 7 of 5T4, 3 antibodies specifically bound to epitope 2 of 5T4, 1 antibody specifically bound to epitope 4 and epitope 6 of 5T4, and 11 antibodies bound to full-length 5T4 (FL). Table 7 summarizes exemplary epitope binning results (for mAbA4, mAbA15, and mAbA17).
[0281] Table 7. Epitope binning assay
[0282] Antibody Epitope binning mAbA4 4 mAbA15 2 mAbA17 7
[0283] Example 6: Antibody selection
[0284] As described above, of all the antibodies screened from the phage library as described in Example 1, 27 antibodies that were still able to bind to 5T4 after formatting into IgG were further tested as described in Examples 2-5. Three antibodies, designated mAbA4, mAbA15, and mAbA17, were selected based on a variety of activities, including their specificity for binding to human 5T4, their binding to cynomolgus monkey 5T4, their cell surface binding signals, and their strong developability as assessed by various methods such as SEC, HIC, and SMAC. The VH, VL, and CDR sequences of these antibodies are shown in Tables 1-3.
[0285] Example 7. Binding of Antibodies to Human 5T4 (ELISA)
[0286] A. Normal binding
[0287] The ability of the selected antibodies to bind to hu5T4 was tested using ELISA. TM )-tagged unconjugated human TPBG / 5T4 protein (AcroBiosystems (Newark, DE, USA), catalog number TPG-H52E5) was diluted to 2 μg / mL in PBS, mixed thoroughly, and plated in 96-well plates (Nunc ) and incubated at 4°C overnight.
[0288] On day 2, PBS was used to treat -20 ("PBS-T") were washed four times. 200 μL of casein (Blocker TM The wells were blocked with casein (purchased from ThermoFisher Scientific) and incubated with shaking at room temperature for 2 hours.
[0289] Prepare a 1:3 dilution series of IgG-ADC in PBS and add 100 μL per well to a 96-well plate. Incubate the plate with shaking at room temperature for 1 hour.
[0290] Goat anti-human IgG Fcγ specific HRP conjugate (Jackson Immunoresearch, catalog number 109-035-098) was diluted to a factor of 1:15000 in PBS. The ELISA plate was washed six times with PBS-T using a plate washer (BioTek ELx405), after which 100 μL of goat anti-human IgG Fcγ specific HRP conjugate was added to each well. The plate was then incubated at room temperature for 30 minutes while shaking.
[0291] ELISA plate washer (BioTek ELx405) was used to wash the ELISA plate six times with PBS-T, and then 100 μ L 3,3', 5,5'-tetramethylbenzidine (TMB) was added to each well. The plate was developed until the dark blue color became visible. H2SO4 (2N, 100 μ L) was then added to quench the reaction, and the absorbance of each well was read on a plate reader (equipped with the SpetraMax M5 of SoftMaxPro software, available from Molecular Devices).
[0292] B. Stress testing
[0293] 1. High pH stress test. The antibodies were tested for their ability to bind to 5T4 using an ELISA under alkaline (high pH) conditions. 1 mg / mL of antibody in 0.1% w / w H2O2 / 1x PBS was stored at room temperature in the dark for 24-48 hours, after which 50 mM methionine was added. Samples were stored frozen prior to analysis by ELISA as described above in Section A. Table 8 below reports the calculated EC values for each test antibody. 50 .
[0294] Table 8. Binding of antibodies to hu5T4 at high pH
[0295] mAbs condition <![CDATA[EC 50 (nM)]]> mAbA4 pH 8.5 Day 0 0.120 mAbA4 pH 8.5 Day 1 0.127 mAbA4 pH 8.5 Day 4 0.114 mAbA4 pH 8.5 Day 7 0.128 mAbA4 pH 8.5 Day 14 0.136 mAbA15 pH 8.5 Day 0 0.134 mAbA15 pH 8.5 Day 1 0.128 mAbA15 pH 8.5 Day 4 0.133 mAbA15 pH 8.5 Day 7 0.143 mAbA15 pH 8.5 Day 14 0.131 mAbA17 pH 8.5 Day 0 0.153 mAbA17 pH 8.5 Day 1 0.174 mAbA17 pH 8.5 Day 4 0.150 mAbA17 pH 8.5 Day 7 0.158 mAbA17 pH 8.5 Day 14 0.167
[0296] 2. Low pH stress test. The ability of the antibodies to bind to 5T4 was also tested using ELISA under acidic (low pH) conditions. Solutions of 1 mg / mL to 10 mg / mL of the antibodies were prepared in 20 mM Tris / 10 mM EDTA at pH 8.5 and stored at 37°C for 1 to 2 weeks. The samples were stored frozen prior to analysis by ELISA as described in Section A above. Table 9 below reports the EC values calculated for each test antibody. 50 .
[0297] Table 9. Binding of antibodies to hu5T4 at low pH
[0298] mAbs condition <![CDATA[EC 50 (nM)]]> mAbA4 pH 5.5 Day 0 0.133 mAbA4 pH 5.5 Day 1 0.132 mAbA4 pH 5.5 Day 4 0.125 mAbA4 pH 5.5 Day 7 0.124 mAbA4 pH 5.5 Day 14 0.122 mAbA15 pH 5.5 Day 0 0.124 mAbA15 pH 5.5 Day 1 0.134 mAbA15 pH 5.5 Day 4 0.123 mAbA15 pH 5.5 Day 7 0.132 mAbA15 pH 5.5 Day 14 0.138 mAbA17 pH 5.5 Day 0 0.164 mAbA17 pH 5.5 Day 1 0.159 mAbA17 pH 5.5 Day 4 0.157 mAbA17 pH 5.5 Day 7 0.190 mAbA17 pH 5.5 Day 14 0.153
[0299] 3. Oxidative stress. The antibodies were tested for their ability to bind to 5T4 using an ELISA in an oxidizing environment. Solutions of 1 mg / mL to 10 mg / mL of antibody were prepared in 20 mM citrate / 50 mM NaCl at pH 5.5 and stored at 37°C for 1 to 2 weeks. Samples were stored frozen prior to analysis by ELISA as described in Section A above. Table 10 below reports the calculated EC values for each test antibody. 50 .
[0300] Table 10. Binding of antibodies to hu5T4 under oxidative stress
[0301] mAbs condition <![CDATA[ECs0(nM)]]> mAbA4 PBS Time 0 0.182 mAbA4 PBS time 24 hours 0.200 mAbA4 PBS time 48 hours 0.189 mAbA4 <![CDATA[PBS + H2O2 Time 0]]> 0.225 mAbA4 <![CDATA[PBS + H2O2 for 24 hours]]> 0.393 mAbA4 <![CDATA[PBS + H2O2 for 48 hours]]> 0.386 mAbA15 PBS Time 0 0.229 mAbA15 PBS time 24 hours 0.212 mAbA15 PBS time 48 hours 0.203 mAbA15 <![CDATA[PBS + H2O2 Time 0]]> 0.191 mAbA15 <![CDATA[PBS + H2O2 for 24 hours]]> 0.190 mAbA15 <![CDATA[PBS + H2O2 for 48 hours]]> 0.189 mAbA17 PBS Time 0 0.198 mAbA17 PBS time 24 hours 0.186 mAbA17 PBS time 48 hours 0.185 mAbA17 <![CDATA[PBS + H2O2 Time 0]]> 0.188 mAbA17 <![CDATA[PBS + H2O2 for 24 hours]]> 0.183 mAbA17 <![CDATA[PBS + H2O2 for 48 hours]]> 0.207
[0302] Example 8. Cross-reactivity of antibodies with cynomolgus monkey, rat and mouse 5T4 (ELISA and Octet)
[0303] The ability of the selected antibodies to bind to non-human 5T4-Ts was tested using ELISA and Octet. Using the ELISA protocol described in Example 7, the human 5T4 antigen was replaced with: recombinant cynomolgus monkey 5T4-Fc (derived from R&D Systems (Minneapolis, MN, USA), catalog number 2280-TG-100 or LSBio (Seattle, WA, USA), catalog number LS-G137131), recombinant mouse 5T4-Fc (R&D Systems, catalog number 5049-TG-100), recombinant rat TPBG / 5T4 with a 6His-SUMO, N-terminal tag (LSBio catalog number G56592), and recombinant mouse TPBG / 5T4 with a His, N-terminal tag (LSBio, catalog number G12168). For Octet analysis, a protein A biochip was coated with the antibody, washed with PBS, and then reacted with the antigen as described above. All antibodies tested bound to human, cynomolgus monkey, and rat 5T4. No significant binding cross-reactivity was observed with mouse 5T4.
[0304] Example 9. Cell Binding of Antibodies to 5T4-Transfected CHO and HEK293 Cells
[0305] The selected antibodies were tested for their ability to bind to HEK293 and CHO cells transfected to express human, cynomolgus monkey, rat, or mouse 5T4. Untransfected cells were used as controls to observe nonspecific binding. mAbA4, mAbA15, and mAbA17 reacted to HEK293 and CHO cells transfected to express human and cynomolgus monkey 5T4, but not to cells transfected to express rat or mouse 5T4.
[0306] *****
[0307] This application also includes the following implementations:
[0308] 1. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0309] (i) VH CDR1, VH CDR2, and VH CDR3 set forth in VH comprising the amino acid sequence of SEQ ID NO: 25, and VL CDR1, VL CDR2, and VL CDR3 set forth in VL comprising the amino acid sequence of SEQ ID NO: 26;
[0310] (ii) VH CDR1, VH CDR2, and VH CDR3 set forth in VH comprising the amino acid sequence of SEQ ID NO: 44, and VL CDR1, VL CDR2, and VL CDR3 set forth in VL comprising the amino acid sequence of SEQ ID NO: 45; or
[0311] (iii) VH CDR1, VH CDR2 and VHCDR3 shown in VH comprising the amino acid sequence of SEQ ID NO: 62, and VL CDR1, VL CDR2 and VL CDR3 shown in VL comprising the amino acid sequence of SEQ ID NO: 63.
[0312] 2. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0313] (a) a VH region comprising:
[0314] (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 7, 12, 13, and 18;
[0315] (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 8, 14, 19, and 24; and
[0316] (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 9, 15, and 20;
[0317] as well as
[0318] (b) a VL region comprising:
[0319] (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21;
[0320] (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22; and
[0321] (3) A VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 17, and 23.
[0322] 3. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0323] (i) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6;
[0324] (ii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 7, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 8, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6;
[0325] (iii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 12, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6;
[0326] (iv) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 13, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 15; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 16, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17;
[0327] (v) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 18, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 20; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 23; or
[0328] (vi) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 24, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
[0329] 4. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0330] (a) a VH region comprising:
[0331] (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 27, 31, 34, 35, and 39;
[0332] (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 28, 32, 36, 40, and 43; and
[0333] (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 33, 37, and 41;
[0334] as well as
[0335] (b) a VL region comprising:
[0336] (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21;
[0337] (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22; and
[0338] (3) A VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 38, and 42.
[0339] 5. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0340] (i) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 27, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 28, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 29; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30;
[0341] (ii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 31, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 32, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30;
[0342] (iii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 34, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 28, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 29; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30;
[0343] (iv) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 35, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 16, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 38;
[0344] (v) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 39, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 40, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 41; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 42; or
[0345] (vi) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 27, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 29; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30.
[0346] 6. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0347] (a) a VH region comprising:
[0348] (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 46, 50, 53, 13, and 57;
[0349] (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 47, 51, 54, 58, and 61; and
[0350] (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 48, 52, 55, and 59;
[0351] as well as
[0352] (b) a VL region comprising:
[0353] (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21;
[0354] (2) having a VL CDR2 selected from the group consisting of the amino acid sequences of SEQ ID NOs: 5, 11, and 22; and
[0355] (3) A VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 49, 56, and 60.
[0356] 7. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises:
[0357] (i) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 46, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 47, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 48; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VLCDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49;
[0358] (ii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 50, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 51, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 52; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49;
[0359] (iii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 53, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 47, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 48; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VLCDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49;
[0360] (iv) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 13, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 54, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 55; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 16, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 56;
[0361] (v) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 57, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 58, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 59; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 60; or
[0362] (vi) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 46, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 61, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 48; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49.
[0363] 8. The antibody or fragment thereof according to any one of embodiments 1 to 7, wherein the antibody or fragment thereof further comprises a framework 1 (FR1), framework 2 (FR2), framework 3 (FR3) and / or framework 4 (FR4) sequence as shown in any one of SEQ ID NOs: 25, 26, 44, 45, 62 and 63.
[0364] 9. The antibody or fragment thereof according to any one of embodiments 1 to 7, wherein the antibody or fragment thereof further comprises a human framework sequence.
[0365] 10. The antibody or fragment thereof according to any one of embodiments 1 to 8, wherein the antibody or fragment thereof comprises:
[0366] (i) a VH comprising the amino acid sequence of SEQ ID NO: 25 and a VL comprising the amino acid sequence of SEQ ID NO: 26;
[0367] (ii) a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45; or
[0368] (iii) VH comprising the amino acid sequence of SEQ ID NO: 62 and VL comprising the amino acid sequence of SEQ ID NO: 63.
[0369] 11. The antibody or fragment thereof according to any one of embodiments 1-10, wherein the antibody is a monoclonal antibody.
[0370] 12. The antibody or fragment thereof according to any one of embodiments 1-11, wherein the antibody is a humanized antibody, a human antibody or a chimeric antibody.
[0371] 13. The antibody or fragment thereof according to any one of embodiments 1-12, wherein the antibody or fragment thereof is Fab, Fab', F(ab')2, Fv, scFv, (scFv)2, a single-chain antibody molecule, a dual variable region antibody, a single variable region antibody, a linear antibody, a V region, or a multispecific antibody formed by antibody fragments.
[0372] 14. The antibody or fragment thereof according to any one of embodiments 1-13, wherein the antibody or fragment thereof is conjugated or recombinantly fused to a diagnostic agent, a detectable agent or a therapeutic agent.
[0373] 15. The antibody or fragment thereof of embodiment 14, wherein the therapeutic agent is a chemotherapeutic agent, a cytotoxin, or a drug.
[0374] 16. A binding agent that binds to substantially the same epitope as the antibody or fragment thereof of any one of embodiments 1-15.
[0375] 17. The binding agent of embodiment 16, which is an antibody or a fragment thereof.
[0376] 18. The binding agent of embodiment 16, comprising a non-antibody protein scaffold.
[0377] 19. The binding agent of embodiment 18, wherein the non-antibody protein scaffold comprises a fibronectin scaffold, anticalin, adnectin, affibody, DARPin, fynomer, affitin, affilin, avimer, cysteine-rich desmin peptide, or an engineered Kunitz-type inhibitor.
[0378] 20. A binding agent that competes with the antibody or fragment thereof of any one of embodiments 1-15 for binding to human 5T4.
[0379] 21. The binding agent of embodiment 20, wherein the binding agent is an antibody or a fragment thereof.
[0380] 22. One or more vectors comprising one or more polynucleotides or complementary polynucleotides encoding the antibody or fragment thereof of any one of embodiments 1-15.
[0381] 23. A pharmaceutical composition comprising the antibody or fragment thereof of any one of embodiments 1-15 or the binding agent of any one of embodiments 16-21, and a pharmaceutically acceptable carrier.
[0382] 24. A method of treating cancer or a tumor in a subject, comprising administering to the subject the antibody or fragment thereof of any one of embodiments 1-15 or the pharmaceutical composition of embodiment 23.
[0383] 25. A method for alleviating one or more symptoms associated with cancer or a tumor in a subject, comprising administering to the subject the antibody or fragment thereof of any one of embodiments 1-15 or the pharmaceutical composition of embodiment 23.
[0384] 26. A method for reducing tumor size in a subject having a tumor, comprising administering to the subject the antibody or fragment thereof of any one of embodiments 1-15 or the pharmaceutical composition of embodiment 23.
[0385] 27. A method for enhancing tumor cell removal in a subject having a tumor, comprising administering to the subject the antibody or fragment thereof of any one of embodiments 1-15 or the pharmaceutical composition of embodiment 23.
[0386] 28. A method of treating a 5T4-related disease, disorder, or condition in a subject, comprising administering to the subject the antibody or fragment thereof of any one of embodiments 1-15 or the pharmaceutical composition of embodiment 23.
[0387] 29. The method of any one of embodiments 24-28, wherein one or more therapeutic agents in combination with the antibody or fragment thereof or the pharmaceutical composition are administered to the subject.
[0388] 30. The method of any one of embodiments 24-29, wherein the subject is a human subject.
[0389] Throughout this application, reference is made to various publications, patents, patent applications and other documents. For all purposes, including in order to more fully describe the prior art related to the subject matter disclosed herein, the disclosures of these publications, patents, patent applications and other documents are all incorporated herein by reference. Although the disclosed subject matter has been described with reference to the examples provided above, it should be understood that various modifications can be made without departing from the spirit of the disclosed subject matter. After reviewing this specification, many variations of the present invention will become apparent to those skilled in the art.
Claims
1. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (i) VH CDR1, VH CDR2, and VH CDR3 set forth in VH comprising the amino acid sequence of SEQ ID NO: 25, and VL CDR1, VL CDR2, and VL CDR3 set forth in VL comprising the amino acid sequence of SEQ ID NO: 26; (ii) VH CDR1, VH CDR2, and VH CDR3 set forth in VH comprising the amino acid sequence of SEQ ID NO: 44, and VL CDR1, VL CDR2, and VL CDR3 set forth in VL comprising the amino acid sequence of SEQ ID NO: 45; or (iii) VH CDR1, VH CDR2 and VH CDR3 shown in VH comprising the amino acid sequence of SEQ ID NO: 62, and VL CDR1, VL CDR2 and VL CDR3 shown in VL comprising the amino acid sequence of SEQ ID NO:
63.
2. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (a) a VH region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 7, 12, 13, and 18; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 2, 8, 14, 19, and 24; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 3, 9, 15, and 20; as well as (b) a VL region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22; and (3) A VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 6, 17, and 23.
3. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (i) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6; (ii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 7, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 8, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6; (iii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 12, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 2, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6; (iv) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 13, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 14, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 15; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 16, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 17; (v) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 18, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 19, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 20; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 23; or (vi) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 1, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 24, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO:
6.
4. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (a) a VH region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 27, 31, 34, 35, and 39; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 28, 32, 36, 40, and 43; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 33, 37, and 41; and (b) a VL region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21; (2) a VL CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 11, and 22; and (3) A VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 38, and 42.
5. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (i) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 27, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 28, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 29; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30; (ii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 31, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 32, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 33; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30; (iii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 34, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 28, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 29; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 30; (iv) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 35, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 36, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 37; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 16, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 38; (v) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 39, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 40, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 41; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 42; or (vi) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 27, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 43, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 29; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO:
30.
6. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (a) a VH region comprising: (1) a VH CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 46, 50, 53, 13, and 57; (2) a VH CDR2 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 47, 51, 54, 58, and 61; and (3) a VH CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 48, 52, 55, and 59; and (b) a VL region comprising: (1) a VL CDR1 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 10, 16, and 21; (2) having a VL CDR2 selected from the group consisting of the amino acid sequences of SEQ ID NOs: 5, 11, and 22; and (3) A VL CDR3 having an amino acid sequence selected from the group consisting of SEQ ID NOs: 49, 56, and 60.
7. An antibody or fragment thereof that binds to 5T4, wherein the antibody or fragment thereof comprises: (i) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 46, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 47, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 48; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49; (ii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 50, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 51, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 52; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 10, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49; (iii) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 53, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 47, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 48; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 49; (iv) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 13, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 54, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 55; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 16, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 11, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 56; (v) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 57, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 58, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 59; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 21, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 22, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 60; or (vi) a VH region comprising a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 46, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 61, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 48; and a VL region comprising a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO:
49.
8. The antibody or fragment thereof according to any one of claims 1 to 7, wherein the antibody or fragment thereof further comprises a framework 1 (FR1), framework 2 (FR2), framework 3 (FR3) and / or framework 4 (FR4) sequence shown in any one of SEQ ID NOs: 25, 26, 44, 45, 62 and 63.
9. The antibody or fragment thereof according to any one of claims 1 to 7, wherein the antibody or fragment thereof further comprises a human framework sequence.
10. The antibody or fragment thereof according to any one of claims 1 to 8, wherein the antibody or fragment thereof comprises: (i) a VH comprising the amino acid sequence of SEQ ID NO: 25 and a VL comprising the amino acid sequence of SEQ ID NO: 26; (ii) a VH comprising the amino acid sequence of SEQ ID NO: 44 and a VL comprising the amino acid sequence of SEQ ID NO: 45; or (iii) VH comprising the amino acid sequence of SEQ ID NO: 62 and VL comprising the amino acid sequence of SEQ ID NO: 63.
Citation Information
Patent Citations
Multispecific antibodies, multispecific activatable antibodies and methods of using the same
US20150079088A1
Antibody constructs
US20180118811A1
Precision / context-dependent activatable antibodies, and methods of making and using the same
US20190241886A1
Method of making an inflatable balloon catheter
US3832253A
Drug-delivery system
US3854480A