Cucumber CsaV36G042280 gene overexpression vector and application of cucumber CsaV36G042280 gene overexpression vector in quantity regulation and control of plant leaves or fruit epidermal hairs
By overexpressing the cucumber CsaV3_6G042280 gene, we solved the unknown problem of the regulation of cucumber epidermal hair development by WRKY transcription factors, and achieved a significant reduction in the number of epidermal hairs on fruits and leaves, improving fruit appearance and plant health, enriching breeding resources and improving agricultural efficiency.
Patent Information
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2026-02-11
- Publication Date
- 2026-04-17
AI Technical Summary
In the existing technology, the function of WRKY transcription factor in the regulation of cucumber epidermal hair development is not clear, resulting in a scarcity of cucumber varieties with smooth skin, making it difficult to effectively improve the number of epidermal hairs on fruits and leaves through molecular breeding.
Overexpression of the cucumber CsaV3_6G042280 gene and its negative regulatory function were utilized. By constructing a recombinant vector and using transgenic technology, the gene was overexpressed in cucumber, which significantly reduced the number of hairs on the leaf or fruit epidermis.
It significantly improves the appearance and quality of cucumber fruits, enhances fruit smoothness and leaf light transmittance, strengthens plant health, enriches cucumber breeding resources, promotes variety diversification, and improves market competitiveness and agricultural efficiency.
Smart Images

Figure CN121874208A_ABST
Abstract
Description
Technical Field
[0001] This invention relates to the field of plant genetic engineering technology, and in particular to a cucumber CsaV3_6G042280 Gene overexpression vectors and their application in regulating the number of hairs on the epidermis of plant leaves or fruits. Background Technology
[0002] The hairs on the cucumber fruit's epidermis (commonly known as "spines") and their warty appearance formed by the protuberances are key agronomic traits determining the cucumber's appearance quality, processing suitability, and commercial value. Cucumber varieties are typically classified into two types: warty (Wty) and non-warty (nWty). Compared to the spiny warty fruit, the smooth-surfaced non-warty fruit has significant advantages such as lower pesticide residues, easier cleaning, crisper taste, better storage and transportation resistance, and lower packaging losses. Therefore, breeding cucumber varieties with few or smooth spines is of great importance for improving the industry's economic benefits.
[0003] The development of epidermal hairs is a complex biological process precisely regulated by multiple factors. In cucumber, preliminary research has revealed that this process involves a synergistic network of multiple endogenous hormones and a series of transcription factors. Gibberellins (GA) and cytokinins (CTKs) are known key signaling molecules regulating fruit spine development. For example, low concentrations of GA promote spine initiation, while overexpression of the gibberellin oxidase gene CsGAox1 reduces spine density. The hydroxylase gene CsCHL1 in the cytokinin pathway is directly regulated by transcription factors, affecting CTK accumulation and thus participating in the formation of spines and tubercles. Furthermore, the auxin transporter NS gene has been shown to be a negative regulator of spine density.
[0004] At the transcriptional regulation level, multiple transcription factor families have been confirmed to participate in the developmental regulation of cucumber epidermal trichomes. The HD-ZIP family plays a particularly central role, with its members having different functions during initiation and differentiation. Genes such as CsGL1, CsTBH, and CsMICT, belonging to the HD-ZIP I subgroup, mainly regulate the development of multicellular epidermal trichomes; their loss of function leads to a reduction in the number of epidermal trichomes, but they are not initiation determinants. In contrast, the CsGL3 and TRIL genes of the HD-ZIP IV subgroup are key positive regulators of epidermal trichome initiation. Their mutants exhibit a completely smooth phenotype in leaves, stems, flowers, and fruits, indicating that they are located upstream in the regulatory network. Studies have shown that CsTBH can directly bind to the promoter of the ethylene synthesis gene CsACS, thereby linking hormone signaling with epidermal trichome development.
[0005] Besides the HD-ZIP family, other types of transcription factors also constitute part of a complex regulatory network. MYB transcription factors CsMYB6 and CsTRY have been shown to negatively regulate the initiation of fruit spines. The C2H2 zinc finger protein gene Tu is a key factor controlling fruit tumor formation; it is upstream regulated by CsGL1 and can activate the expression of cytokinin synthesis genes. Tu also directly binds to the promoter of the auxin-related gene CsTS1, synergistically regulating fruit protuberance size. The bHLH-type transcription factor CsHEC2 is highly expressed in the pericarp and, through direct interaction with CsGL3 and Tu proteins, enhances the transcriptional activation of CsCHL1, positively regulating spine density and CTK accumulation. The WD repeat protein CsTTG1 plays a crucial role in flowering, epidermal trichomes, and fruit tumor formation.
[0006] Although our understanding of the regulatory network for cucumber trichome development has deepened, the known regulatory factors are mainly concentrated in the HD-ZIP, MYB, bHLH, C2H2, and WD-repeat families. WRKY transcription factors, as a large and versatile class of transcriptional regulators in plants, possess characteristic domains (WRKYGQK and zinc finger structures) that enable them to specifically recognize W-box elements in target gene promoters, thereby playing important activating or inhibiting roles in plant growth, development, metabolism, and biotic / abiotic stress responses. However, while members of this family play important roles in many plant developmental processes, whether and how WRKY transcription factors participate in the regulation of the specific developmental process of cucumber organ-specific structures (such as spines and trichomes) remains unclear, and their function is still unknown.
[0007] Against this backdrop, this study identifies for the first time a WRKY transcription factor coding sequence (CsaV3_6G042280) that regulates the number of epidermal hairs in cucumber. The expression of this sequence is negatively correlated with the number of epidermal hairs, providing a new gene resource and technical approach for molecular breeding of cucumbers with smooth skin. Summary of the Invention
[0008] The purpose of this invention is to provide a cucumber CsaV3_6G042280 Gene overexpression vectors and their application in regulating the number of hairs on the epidermis of plant leaves or fruits are proposed to address the problems existing in the above-mentioned technologies.
[0009] To achieve the above objectives, the present invention provides the following solution: One of the technical solutions of this invention, CsaV3_6G042280 Application of genes or their encoded proteins in reducing the number of hairs on the epidermis of cucumber leaves or fruits.
[0010] The second technical solution of this invention is a method for reducing the number of hairs on the epidermis of cucumber leaves or fruits, by overexpression... CsaV3_6G042280Genes that reduce the number of hairs on the surface of cucumber leaves or fruits.
[0011] The third technical solution of the present invention contains CsaV3_6G042280 Application of gene recombinant vectors, expression cassettes, transgenic cell lines, or recombinant bacteria in reducing the number of hairs on the epidermis of cucumber leaves or fruits.
[0012] The fourth technical solution of the present invention CsaV3_6G042280 Application of genes or their encoded proteins in the breeding of new cucumber varieties with reduced number of hairs on the leaf or fruit epidermis.
[0013] The fifth technical solution of the present invention contains CsaV3_6G042280 Application of gene recombinant vectors, expression cassettes, transgenic cell lines, or recombinant bacteria in the cultivation of new cucumber varieties with reduced number of hairs on the leaf or fruit epidermis.
[0014] The sixth technical solution of this invention is a method for cultivating new cucumber varieties with reduced leaf or fruit epidermal hairs, utilizing ingredients containing... CsaV3_6G042280 Recombinant gene vectors, expression cassettes, transgenic cell lines, or recombinant bacteria can enhance the expression of genes in cucumber plants. CsaV3_6G042280 Gene expression.
[0015] Based on the above technical solution, the present invention has the following technical effects: (1) Significantly improves the appearance and marketability of cucumber fruits: The presence and density of epidermal hairs / tufts are key traits determining the appearance quality of cucumber fruits. This can be achieved by overexpressing... CsaV3_6G042280 Genes can significantly reduce the number of hairs or tubercles on the surface of leaves or fruits, resulting in cucumbers with smooth surfaces. Smooth fruits are easier to clean and more hygienic to eat, meeting the market demand for pollution-free and green vegetables, and helping to increase product added value and market competitiveness.
[0016] (2) Providing key gene resources for optimizing the cucumber variety structure in my country: Currently, most of the dominant cucumber varieties in my country are densely spined, while smooth-spined varieties are relatively scarce. The gene resources provided by this invention... CsaV3_6G042280 Genes provide an effective molecular tool for the targeted creation of new low-spine / spineless cucumber germplasm, which helps to enrich the genetic basis of cucumber breeding in my country and promote the diversification of variety types.
[0017] (3) Synergistically improve leaf surface characteristics and plant adaptability: While reducing fruit epidermal hairs, the overexpression of this gene can also significantly reduce the number of leaf epidermal hairs, thereby reducing the attachment of leaf dust and pathogens, improving leaf light transmittance and photosynthetic efficiency, which is conducive to healthy plant growth and stress resistance, and achieving synchronous improvement of fruit and leaf traits.
[0018] (4) Provides a reference for the improvement of surface traits in other cucurbit crops: CsaV3_6G042280The gene has a conserved function in regulating the development of epidermal hairs. This vector and technology system can be extended to the breeding of smooth-surfaced varieties of other cucurbit crops such as melons, watermelons, and pumpkins, and has broad application prospects.
[0019] In summary, this invention discloses a cucumber CsaV3_6G042280 Gene overexpression vector and its application in regulating the number of epidermal hairs on plant leaves or fruits; the vector contains a 35S promoter and cucumber CsaV3_6G042280 Gene expression vector for plants. Overexpression in cucumber. CsaV3_6G042280 , obtained CsaV3_6G042280 The transgenic plants showed a significant reduction in the number of epidermal hairs on their leaves. (Utilizing...) CsaV3_6G042280 Its gene functional characteristics can be used for crop breeding applications and have certain agricultural value.
[0020] This invention not only reveals CsaV3_6G042280 This study reveals a novel function of genes in regulating the development of plant epidermal hairs and provides a practical molecular breeding program for cultivating new varieties of cucumbers and similar crops with smooth fruit surfaces and optimized leaf physiological characteristics. This has positive significance for promoting vegetable quality breeding and industrial upgrading. Attached Figure Description
[0021] Figure 1 For overexpression CsaV3_6G042280 Phenotypic analysis of transgenic cucumber leaves. In the figure, A represents leaf phenotypic analysis, and B represents statistical analysis of leaf trichomes.
[0022] Figure 2 For overexpression CsaV3_6G042280 A statistical chart showing the number of epidermal hairs on the leaves of genetically modified cucumber plants. Detailed Implementation
[0023] Unless otherwise specified, the technical solutions described in this invention are all conventional solutions in the field, and the reagents or raw materials used are all purchased from commercial channels or are publicly available unless otherwise specified.
[0024] The embodiments of the present invention provide CsaV3_6G042280 Application of genes or their encoded proteins in reducing the number of hairs on the epidermis of cucumber leaves or fruits.
[0025] In some specific implementation schemes, the CsaV3_6G042280 The nucleotide sequence of the gene is shown in SEQ ID NO.3, and the amino acid sequence of the protein it encodes is shown in SEQ ID NO.4.
[0026] In some specific implementation schemes, overexpression CsaV3_6G042280 Genes that reduce the number of hairs on the surface of cucumber leaves or fruits.
[0027] This invention also provides a method for reducing the number of hairs on the epidermis of cucumber leaves or fruits, by overexpressing... CsaV3_6G042280 Genes that reduce the number of hairs on the surface of cucumber leaves or fruits.
[0028] Embodiments of the present invention also provide containing CsaV3_6G042280 Application of gene recombinant vectors, expression cassettes, transgenic cell lines, or recombinant bacteria in reducing the number of hairs on the epidermis of cucumber leaves or fruits.
[0029] The embodiments of the present invention also provide CsaV3_6G042280 Application of genes or their encoded proteins in the breeding of new cucumber varieties with reduced number of hairs on the leaf or fruit epidermis.
[0030] Embodiments of the present invention also provide containing CsaV3_6G042280 Application of gene recombinant vectors, expression cassettes, transgenic cell lines, or recombinant bacteria in the cultivation of new cucumber varieties with reduced number of hairs on the leaf or fruit epidermis.
[0031] This invention also provides a method for cultivating new cucumber varieties with reduced leaf or fruit epidermal hairs, utilizing a method containing… CsaV3_6G042280 Recombinant gene vectors, expression cassettes, transgenic cell lines, or recombinant bacteria can enhance the expression of genes in cucumber plants. CsaV3_6G042280 Gene expression.
[0032] The inventor is researching hairless mutants nwd Transcriptome analysis of leaves from both wild-type and wild-type plants revealed differences in the expression levels of 2,650 genes among the different materials, including one encoding a WRKY transcription factor. CsaV3_ 6G042280 Genes in nwd It is clearly upregulated in mutants, which suggests... CsaV3_6G042280 This gene is involved in the development of epidermal hairs in cucumber leaves (Zhou et al., 2024). Therefore, it was selected as a candidate gene for further research. We first cloned... CsaV3_6G042280 The gene was linked to the overexpression vector pFGC5941 containing the 35S promoter, resulting in the overexpression vector pFGC5941- CsaV3_6G042280 Overexpression was found after transforming cucumbers. CsaV3_6G042280 Genes can significantly reduce the number of epidermal hairs on plant leaves. This characteristic can be effectively utilized in other species to alter the number of epidermal hairs on leaves or fruits.
[0033] The carrier of the present invention contains cucumber CsaV3_6G042280 The gene has a 35S promoter attached upstream. The plant expression vector of this invention is pFGC5941- CsaV3_6G042280 It is constructed by the following method: based on CuGI ( http: / / cucurbitgenomics.org / organism / 20Cucumbers published on ) CsaV3_6G042280 Primers were designed at both ends of the sequence, and PCR amplification was performed using cucumber leaf cDNA as a template to obtain... CsaV3_6G042280 Total length. Use Nco I and Xba The pFGC5941 vector plasmid was double-digested with enzymes to obtain the linearized pFGC5941 vector, which was then recovered by gel electrophoresis and coupled with the target gene. CsaV3_6G042280 Ligation and transformation of competent cells yielded the plant expression vector pFGC5941- CsaV3_6G042280 .
[0034] cucumber CsaV3_6G042280 After the gene was introduced into the cucumber, the result was CsaV3_6G042280 The number of epidermal hairs on the leaves of transgenic plants is significantly reduced, which can be applied in production practice to modify the number of epidermal hairs on plant leaves or fruits.
[0035] Example 1 Expression vector pFGC5941- CsaV3_6G042280 Construction (1) Primer design: Based on CuGI ( http: / / cucurbitgenomics.org / organism / 20 Cucumbers published on ) CsaV3_6G042280 The sequence is given, and primers are designed at both ends: CsaV3_6G042280-F (SEQ ID NO.1): 5'-ttacatttacaattaccatggATGAACTCCCTTCAAAACCCTAAC-3' (inclusive Nco I site); CsaV3_6G042280-R (SEQ ID NO.2): 5'-ggtcttaattaactctcttagaTCAAAGGGTAGTGGTAGAAGAATAGG-3' (incl. Xba I site).
[0036] (2) Extraction of total RNA from cucumber leaves The cucumber variety used was the North China type cucumber HB. Leaves were immediately frozen in liquid ammonia after collection. Total RNA was extracted using the TRIzol (Invitrogen, USA) reagent method. 1.5 ml of Trizol was added to induce complete lysis. The mixture was centrifuged at 12,000 rpm for 5 min, and the precipitate was discarded. 200 μL of chloroform was added, and the mixture was incubated at room temperature for 15 min. The mixture was then centrifuged at 12,000 g for 15 min at 4°C. The supernatant was transferred to another centrifuge tube. 0.5 ml of isopropanol was added, and the mixture was incubated at room temperature for 30 min. The mixture was then centrifuged at 12,000 g for 10 min at 4°C, and the supernatant was discarded. The precipitate was washed twice with 1 ml of 75% ethanol. The mixture was then centrifuged at 8,000 g for 5 min at 4°C, and the supernatant was discarded. The RNA was dissolved in 50 μL of RNase-free H2O.
[0037] (3) Synthesis of total cDNA in cucumber leaves Cucumber leaf RNA was treated with DNase I and then analyzed using Oligo(dT) 18 For reverse transcription with primers: Take 15 uL of RNA and add Oligo(dT) 18 Incubate 1 μL at 70°C for 5 min, then immediately place in an ice-water bath. Add 2 μL of 10×M-MLV Buffer, 1 μL of dNTP (10 mM), 1 μL of RNasin (40 U / μL), and 1 μL of M-MLV (200 U / μL) sequentially, for a total volume of 20 μL. Incubate at 42°C for 60 min, then at 95°C for 10 min to inactivate M-MLV enzyme activity. Store at -20°C.
[0038] (4) CsaV3_6G042280 Gene amplification PCR amplification was performed using CsaV3_6G042280-F and CsaV3_6G042280-R primers with cDNA as a template. The reaction conditions were: 94℃ for 5 min; 94℃ for 30 s; 58℃ for 30 s; 72℃ for 1 min, for 40 cycles; 72℃ for 5 min.
[0039] (5) CsaV3_6G042280 Fragment glue recycling After performing 1.5% agarose gel electrophoresis on the PCR products, the target fragment was excised and recovered according to the instructions of the gel recovery kit.
[0040] (6) Expression vector pFGC5941- CsaV3_6G042280 Construction use Nco I and Xba The pFGC5941 vector plasmid was double-digested with enzymes, linearized, and then recovered by gel electrophoresis and compared with the target gene. CsaV3_6G042280 Connect for 4 hours. In 100 μl of competent Enterobacteriaceae. E . coli Add 5 μl of ligation system to DH5α, mix well, incubate on ice for 30 min, heat at 42℃ for 90 s, then incubate on ice for 5 min; add 800 μl of LB liquid medium, and incubate at 37℃ and 200 rpm for 45 min to allow the cells to recover; centrifuge at 3,000 rpm for 1 min to collect the cells; aspirate the bacterial solution and place it in a container with a Kansas membrane. + Spread the resistant bacteria evenly on LB agar plates using a sterile triangular stick; incubate overnight at 37°C; pick colonies and inoculate onto plates containing Kans. + After culturing in LB liquid medium at 37°C and 180 rpm for 12 h, plasmids were extracted. Recombinant plasmid pFGC5941- was obtained by enzyme digestion and identification. CsaV3_6G042280 The enzyme digestion steps are as follows: Add 2 μl of plasmid DNA (50 ng / μl) to each 0.5 ml centrifuge tube. Bam H I 0.5μl, Xba I 0.5 μl, 10×buffer(K) 2 μl, and add sterile water to make up to 20 μl; react at 37℃ for 4 h; detect plasmid pFGC5941- by 1.5% agarose gel electrophoresis. CsaV3_6G042280 The plasmid was digested with enzymes to obtain fragments of approximately the expected size. The plasmid was then sent to General Biotechnology (Anhui) Co., Ltd. for sequencing (its nucleotide sequence is shown in SEQ ID NO. 3, and its encoded protein sequence is shown in SEQ ID NO. 4). Sequencing revealed that the obtained... CsaV3_6G042280 The sequence is completely correct.
[0041] SEQ ID NO.3: ATGAACTCCCTTCAAAACCCTAACTTCTTCTTTGACCACCATCAACAATTCGATCAAGATCACTCATCTTCTTCAATCATGGATTTCCTTAATTTCTCGGGTTACCCGCTTCCCGATTTCGGCCTTGAAGCCGAGACCACCACGTTTTCGTTGTCCGAAGCGGAAACTGGCGACGGGAGTGGATCCATGAAAGCAACATCCATAGACAATAATACCATAGATGATGGGTGGTTTGAGGGTAAGGGTGTGAAGAGAAAAAAACCTAGAGAAAATGGACGCACTAATAGAGTTGCATTTATAACAAAGTCGGAATTGGAAATCTTGGATGATGGCTTCAAATGGAGAAAGTACGGCAAAAAATCTGTCAAGAATAGCCCTCATCCGAGGAATTACTACAAATGCTCGAGTGGAGAATGTGGAGTGAAAAAGAGAGTAGAAAGAGACAGAGATGATTCAAGCTATGTTATAACAACATATGAAGGTGTTCACAACCACGAGAGCCCTTTCCTGATGTATTGCAATGGTTCAAAACTATTTCATCCTCATCCCATTTGCCCTAATTCCTCTTCTCCTCCCTATTCTTCTACCACTACCCTTTGA。
[0042] SEQ ID NO.4: MNSLQNPNFFFDHHQQFDQDHSSSSIMDFLNFSGYPLPDFGLEAETTTFSLSEAETGDGSGSMKATSIDNNTIDDGWFEGKGVKRKKPRENGRTNRVAFITKSELEILDDGFKWRKYGKKSVKNSPHPRNYYKCSSGECGVKKRVERDRDDSSYVITTYEGVHNHESPFLMYCNGSKLFHPHPICPNSSSPPYSSTTTL 。
[0043] Example 2 pFGC5941- CsaV3_6G042280 Agrobacterium tumefaciens EHA105 Remove EHA105 competent cells from the -80 ℃ freezer and place them on ice. Take 2.5 μL of the recombinant plasmid pFGC5941-35S. CsaV3_6G042280 Add the solution to EHA105 competent cells, incubate on ice for 5 min, then immerse in liquid nitrogen for 5 min, immediately place in a 37 ℃ water bath for 5 min, and finally transfer to ice for 5 min. Add 600 μL of antibiotic-free LB medium and incubate in a shaker at 28 ℃ for 2-3 h. Transfer LB solid medium (add 20 μL of 50 mg / mL Kansas) to the culture medium. + and 10 μL 50 mg / mL Rif + Spread the bacteria evenly onto a plate, seal the plate, and incubate upside down in a 28°C incubator for 2-3 days. Use a pipette tip to gently dip the colony into 1 mL of LB broth containing antibiotics (1 μL of 50 mg / mL Kansin). + and 0.5 μL 50 mg / mL Rif + After picking bacteria, they were placed in a shaker at 28 ℃ and cultured at a constant temperature of 180 rpm until the bacterial solution became concentrated. The Agrobacterium plasmid was extracted by alkaline lysis and then verified by enzyme digestion.
[0044] Example 3 Contains pFGC5941- CsaV3_6G042280 Agrobacterium EHA105 transformation of cucumber (1) Pre-culture: Cut off the cotyledon nodes of sterile cucumber seedlings that are 3-5 days old, inoculate them on MS medium (containing 6-BA) for 2 days of pre-culture, and then infect them.
[0045] (2) Infection: Make micro-wounds on the cotyledon nodes with a scalpel and place them in an Erlenmeyer flask containing bacterial solution for 20 minutes.
[0046] (3) Co-culture: The infected cotyledonary segments are inoculated into a co-culture medium and cultured in the dark for 4-5 days, until visible colonies appear on the explants, at a temperature of 26℃.
[0047] (4) Sterilization and screening: The explants were removed and rinsed three times with sterile water (cephalosporin was added to the sterile water in the third rinse), and then transferred to sterilization and screening medium (cephalosporin and kanamycin were added to the pre-culture medium) for culture.
[0048] (5) Plant regeneration: Some explants develop resistant buds at the base and cut. When the buds grow to be clearly distinguishable, the resistant bud rate is counted. When the resistant buds grow to 2-3 cm, they are cut off from the base and transferred to a rooting medium for further culture. After the plant's root system is well developed, it is acclimatized and transplanted.
[0049] Example 4 Identification and analysis of transgenic plants (1) Extraction of cucumber DNA Take fresh cucumber leaves and place them in a 1.5 ml centrifuge tube. Add 400 μl of SDS extraction buffer and grind into a paste using a blue stick. Add an equal volume of phenol:chloroform:isoamyl alcohol (25:24:1), shake vigorously, and centrifuge at 12,000 rpm for 10 min. Transfer the supernatant to a new centrifuge tube, add 2 volumes of anhydrous ethanol and 0.1 volumes of 3M sodium acetate (pH 5.2), mix vigorously, and precipitate at -20℃ for 2 h. Then centrifuge at 12,000 rpm for 10 min. Discard the supernatant, wash the precipitate once with 70% ethanol, air dry at room temperature, and dissolve in an appropriate amount of TE buffer.
[0050] (2) Identification of transgenic cucumber plants Using extracted DNA as a template, PCR amplification was performed using primers CsaV3_6G042280-F and pFGC5941-R. The system consisted of: 2.5 μl PCR buffer (10×), 0.5 μl Taq, 2 μl cDNA template, 0.5 μl 10 mM dNTP, 1 μl each of CsaV3_6G042280-F and CsaV3_6G042280-R primers, and sterile water to a final volume of 25 μl. The reaction conditions were: 94℃ for 5 min, 35 cycles, including denaturation at 94℃ for 30 s, annealing at 56℃ for 30 s, extension at 72℃ for 60 s, and reaction at 72℃ for 10 min.
[0051] (3) Phenotypic analysis of transgenic cucumber plants When the T1 generation overexpression cucumber plants reached the three-leaf-one-heart stage, a hole was punched in the first true leaf of the cucumber using a book page puncher with a hole diameter of 6 mm. The image was then photographed using a stereomicroscope with an eyepiece magnification of 2x. The data was then manually statistically analyzed and compared using software.
[0052] (4) Expression analysis of the target gene in transgenic cucumber plants To detect the expression level of the target gene in transgenic cucumber plants, leaves from T1 generation transgenic cucumber plants were used as material, and expression levels were analyzed by RT-qPCR. The results are as follows: Figure 2 As shown, the expression level of the target gene in the overexpressing cucumber plants was significantly higher than that in the blank control, and its high expression was directly related to the number of epidermal hairs on the plant leaves.
[0053] Obviously, the above embodiments of the present invention are merely examples for clearly illustrating the present invention, and are not intended to limit the implementation of the present invention. For those skilled in the art, other variations or modifications can be made based on the above description. It is neither necessary nor possible to exhaustively describe all embodiments here. Any modifications, equivalent substitutions, and improvements made within the spirit and principles of the present invention should be included within the scope of protection of the claims of the present invention.
Claims
1. CsaV3_6G042280 Use of a gene or its encoded protein in reducing the number of leaf or fruit epidermis hairs of Cucumis sativus.
2. Use according to claim 1, characterized in that, The CsaV3_6G042280 The nucleotide sequence of the gene is shown as SEQ ID NO. 3, and the amino acid sequence of the encoded protein is shown as SEQ ID NO.
4.
3. Use according to claim 1, characterized in that, overexpression CsaV3_6G042280 Genes that reduce the number of hairs on the surface of cucumber leaves or fruits.
4. A method of reducing the number of trichomes on the leaf or fruit epidermis of a cucumber plant, characterized in that, overexpression CsaV3_ 6G042280 Genes that reduce the number of hairs on the surface of cucumber leaves or fruits.
5. A composition comprising CsaV3_6G042280 Use of a recombinant vector, expression cassette, transgenic cell line, or recombinant bacteria of a gene in reducing the number of trichomes on the leaf or fruit epidermis of a cucumber.
6. CsaV3_6G042280 Use of a gene or its encoded protein in breeding new varieties of cucumber with reduced number of leaf blade or fruit skin trichomes.
7. A composition comprising CsaV3_6G042280 Use of a recombinant vector, expression cassette, transgenic cell line or recombinant bacteria of a gene in the breeding of a new variety of cucumber with reduced number of leaf blade or fruit skin trichomes.
8. A method of breeding a new variety of cucumber with reduced number of leaf blade or fruit skin hairs, characterized in that, The recombinant vector, expression cassette, transgenic cell line or recombinant bacteria containing CsaV3_6G042280 the gene can improve the expression of the gene in the cucumber plant. CsaV3_6G042280 The recombinant vector, expression cassette, transgenic cell line or recombinant bacteria containing