A traditional Chinese medicine composition for activating GLP-1 receptor, preparation method and application

By combining traditional Chinese medicine ingredients such as ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia, and employing modern extraction and separation technology, the safety and preparation process issues of existing GLP-1 receptor agonists have been resolved, achieving safe and effective blood sugar lowering and weight loss effects, and demonstrating industrialization potential.

CN122140839APending Publication Date: 2026-06-05HUBEI UNIV OF SCI & TECH
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
CN202610494295.5
Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Filing Date
2026-04-15
Publication Date
2026-06-05

AI Technical Summary

Technical Problem

Existing GLP-1 receptor agonists have problems such as high price, gastrointestinal adverse reactions, and long-term oral administration may lead to gastrointestinal damage, hypoglycemia and abnormal liver function, which limit their widespread application. Traditional Chinese medicine has the advantages of multiple components, multiple targets and overall regulation, but there is a lack of controllable preparation processes for traditional Chinese medicine compositions that can activate GLP-1 receptors.

Method used

By combining ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia with modern extraction and separation processes, a traditional Chinese medicine composition with highly efficient GLP-1 receptor activation activity is prepared. The preparation of health food formulations is carried out by using 60%-80% ethanol extraction, ethyl acetate and n-butanol extraction, resin separation, and other steps, combined with food-grade solvents and environmentally friendly processes.

Benefits of technology

It achieves safe and effective GLP-1 receptor activation, with good blood sugar lowering and weight loss effects, ensuring the safety of raw materials and the environmental friendliness of the processing, and is suitable for industrial promotion.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN122140839A_ABST
    Figure CN122140839A_ABST
Patent Text Reader

Abstract

The application provides a traditional Chinese medicine composition for activating GLP-1 receptor, a preparation method and application, and relates to the technical field of traditional Chinese medicinal materials, wherein ginseng, astragalus root, ophiopogon, schisandra chinensis, pueraria, and gardenia are used as raw materials. Through compounding, extraction, separation and preparation development, and synergistic effect among the components, the traditional Chinese medicine composition for directly activating GLP-1 receptor, improving blood glucose level and reducing weight is optimized. The traditional Chinese medicine composition obtained by the technical scheme provided in the application can directly activate GLP-1 receptor, achieve the effects of improving blood glucose and reducing weight, and can provide a new solution for the reduction of blood glucose and the improvement of weight.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] This invention relates to the field of traditional Chinese medicine technology, and in particular to a traditional Chinese medicine composition that activates the GLP-1 receptor, its preparation method, and its application. Background Technology

[0002] With changes in lifestyle and dietary structure, the prevalence of diabetes is increasing year by year. Data from the International Diabetes Federation (IDF) in 2025 shows that 589 million adults aged 20 to 79 worldwide will have diabetes, accounting for approximately one-ninth of the total population. Sustained high blood sugar can lead to complications in multiple organs, placing a heavy burden on society and families. First-line hypoglycemic drugs include metformin, sulfonylureas, DPP-4 inhibitors, glucagon-like peptide-1 (GLP-1) receptor agonists, and SGLT-2 inhibitors. Among these, GLP-1 receptor agonists have become an important target for the treatment of type 2 diabetes (T2DM) due to their multiple effects, including glucose-dependent insulinotropic secretion, glucagon inhibition, delayed gastric emptying, weight reduction, and β-cell protection. In addition to their hypoglycemic effect, GLP-1 receptor agonists also have a good effect on weight control. However, existing GLP-1 receptor agonists are mostly peptides, which suffer from high prices and adverse gastrointestinal reactions. In particular, long-term oral administration of Western medicines carries risks such as gastrointestinal damage, hypoglycemia, and abnormal liver function, limiting their widespread application. Traditional Chinese medicine (TCM) has a long history of treating diabetes, characterized by its "multi-component, multi-target, and holistic regulation." Compared to single-component drugs, it also offers the advantage of "synergistic effects." Furthermore, modern TCM extraction, separation, and activity screening technologies provide a solid technical foundation for developing safe, orally administered, low-cost hypoglycemic products that leverage the holistic regulatory advantages of TCM. Therefore, developing TCM compositions and health foods with controllable preparation processes that can directly activate GLP-1 receptors has significant technological application value and market potential. Summary of the Invention

[0003] This invention addresses the problems existing in the prior art by providing a traditional Chinese medicine composition with GLP-1 receptor activating activity and its application in health food preparations. Through the compounding, extraction, and separation processes of ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia, a traditional Chinese medicine composition with highly efficient GLP-1 receptor activating activity is prepared, achieving good hypoglycemic and weight-loss effects.

[0004] One of the objectives of this invention is to provide a method for preparing a traditional Chinese medicine composition with high efficiency in activating GLP-1 receptors.

[0005] The composition comprises the following components: 50-90 parts ginseng, 60-90 parts astragalus, 20-50 parts ophiopogon japonicus, 40-70 parts schisandra chinensis, 10-40 parts kudzu root, and 10-40 parts gardenia, calculated by mass parts.

[0006] Preferably, the composition comprises the following components: 60-80 parts ginseng, 70-80 parts astragalus, 30-40 parts ophiopogon japonicus, 50-70 parts schisandra chinensis, 20-30 parts kudzu root, and 20-30 parts gardenia.

[0007] Preferably, the composition comprises the following medicinal materials: 70 parts ginseng, 80 parts astragalus, 30 parts ophiopogon japonicus, 60 parts schisandra chinensis, 20 parts kudzu root, and 30 parts gardenia.

[0008] Preferably, the composition is extracted in groups: component 1 (ginseng, astragalus, and ophiopogon japonicus) is extracted with a mixture of 60%-80% ethanol as the extraction solvent, with an extraction ratio of 6-8 times, and extracted twice, each time for 1.5-2 hours; component 2 (schisandra chinensis, kudzu root, and gardenia) is extracted with a mixture of 50%-60% ethanol, with an extraction ratio of 10-12 times, and extracted three times, each time for 0.5-1 hours.

[0009] Preferably, after extraction and concentration, component 1 is extracted successively with food-grade acetic acid and n-butanol, wherein the ethyl acetate extraction temperature is 40-50℃; the n-butanol extract is concentrated and dried and dispersed in water, and then separated using D101 or AB-8 resin, and eluted stepwise with water, 30%, 50%, 60%, 80%, and 95% ethanol, respectively. The 50% and 80% components are combined, concentrated, and vacuum dried to obtain extract I.

[0010] Preferably, after extraction and concentration, component 2 is incubated at 50-60°C with 1-2% citric acid and 80°C with 0.01-0.05% activated carbon for 0.5-1.5 h, and the pH is adjusted to 6-7. Diatomaceous earth is added for filtration, and separation is performed using D101 or AB-8 resin. Elution is carried out with water, 10%, 20%, 50%, 60%, and 95% eluents, respectively. The 20% and 60% eluents are collected, combined, and passed through an LX-68 resin column. The permeate is collected, concentrated, and vacuum dried to obtain extract II. The herbal composition is prepared by mixing extract I and extract II according to the composition ratio of the selected herbal raw materials.

[0011] A second objective of this invention is to provide a health food preparation comprising the above-mentioned traditional Chinese medicine composition, wherein the health food preparation further comprises food-grade excipients.

[0012] The health food containing the above composition also includes food-grade excipients, including at least one of resistant dextrin, mogroside, steviol, erythritol, xylitol, magnesium stearate, and edible flavoring.

[0013] More preferably, the excipients are resistant dextrin, steviol glycosides, and mannitol.

[0014] Preferably, the health food preparation is in the form of tablets, capsules, granules, powders, or pills.

[0015] A third objective of this invention relates to the application of the above-mentioned composition or health food preparations containing the above-mentioned composition in lowering blood sugar and reducing weight.

[0016] Preferably, the blood sugar lowering and weight loss product can effectively lower blood sugar and reduce weight.

[0017] Compared with the prior art, the present invention has the following significant advantages and technical effects: 1. Safer raw materials: The Chinese herbal raw materials in the composition of this invention are all derived from the food and health food raw material catalogs, with a wide history of consumption, making the source of raw materials safer and ensuring the safety of the formulation, product development and application process.

[0018] 2. Green and environmentally friendly processing: The entire processing and preparation process uses food-grade solvents and is recycled, making it green and pollution-free, and more suitable for industrial promotion.

[0019] 3. Comprehensive product regulation and "synergistic effect": Comparative studies were conducted on the formulation, extraction and separation processes using GLP-1 receptors to screen for combination methods and processes with better GLP-1 receptor activation effects, and natural compositions with better hypoglycemic effects were developed based on the activation effect of GLP-1 receptors. Attached Figure Description

[0020] Figure 1 The results of the GLP-1 receptor binding assay of the various traditional Chinese medicine compositions of this invention are shown (n=5). Detailed Implementation

[0021] The following are specific embodiments of the present invention, which are described in conjunction with the accompanying drawings. However, the present invention is not limited to these embodiments.

[0022] In the following examples, resistant dextrin was purchased from Shandong Bailong Chuangyuan Biotechnology Co., Ltd.; steviol glycosides were purchased from Guilin Rhein Biotechnology Co., Ltd.; and other raw materials were commercially available.

[0023] The present invention will be further described in detail below with reference to specific embodiments.

[0024] One of the objectives of this invention is to provide a method for preparing a traditional Chinese medicine composition with high efficiency in activating GLP-1 receptors.

[0025] The composition comprises the following components: 50-90 parts ginseng, 60-90 parts astragalus, 20-50 parts ophiopogon japonicus, 40-70 parts schisandra chinensis, 10-40 parts kudzu root, and 10-40 parts gardenia.

[0026] Examples 1-6 Preparation of Traditional Chinese Medicine Compositions Example

[0027] 1) Pretreatment: Take ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia slices separately, crush them, pulverize them and pass them through a 0.8 mm sieve for later use.

[0028] 2) Extraction of component 1: Take 70 g of ginseng, 80 g of astragalus and 30 g of ophiopogon japonicus, mix them, add 8 times the amount of 70% ethanol and extract twice, 1.5 h each time, and combine the extracts.

[0029] 3) Separation of Component 1: The extract was concentrated to 180 mL, extracted once with 8 times the amount of ethanol ethyl ester (50℃), and extracted three times with n-butanol. The n-butanol extract was concentrated under vacuum to obtain a paste, dispersed in 180 mL of water, and then separated with 270 g of D101 macroporous resin. The components were eluted stepwise with 4-8 times the amount of resin (V / m) of water, 30%, 50%, 60%, 80%, and 95% ethanol, respectively. The 50% and 80% eluent components were combined, concentrated under vacuum, and dried to obtain 6.3 g of extract I.

[0030] 4) Extraction of component 2: Take 60g of Schisandra chinensis, 20g of Pueraria lobata and 30g of Gardenia jasminoides, add 12 times the amount of 55% ethanol and extract 3 times, 0.5h each time, and combine the extracts.

[0031] 5) Separation of Component II: The extract was concentrated to 110 mL, 1.65 g citric acid and 0.033 g activated carbon were added and kept at 80 °C for 1 h. The pH was adjusted to 6 with NaOH, 300 mesh diatomaceous earth was added, and the mixture was filtered. The filtrate was directly separated using AB-8 resin. The eluents were eluted with 4-8 times the resin volume (V / m) of water, 10%, 20%, 50%, 60%, and 95%, respectively. The 20% and 60% eluents were collected, mixed evenly, and then adsorbed and purified using an LX-68 resin column. The permeate was collected, concentrated under vacuum, and dried to obtain 4.2 g of extract II.

[0032] 5) Mixing: Mix the above extract I and extract II to obtain 10.5g of traditional Chinese medicine composition. Example

[0033] 1) Pre-treatment: Take ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia slices separately, crush them, pulverize them and pass them through a 0.8mm sieve for later use.

[0034] 2) Extraction of component 1: Take 60 g of ginseng, 70 g of astragalus and 40 g of ophiopogon japonicus, mix them, add 8 times the amount of 60% ethanol and extract twice, 2 hours each time, and combine the extracts.

[0035] 3) Separation of Component 1: The extract was concentrated to 170 mL, extracted once with 8 times the amount of ethanol ethyl ester (40℃), and extracted three times with n-butanol. The n-butanol extract was concentrated under vacuum to obtain a paste, dispersed in 170 mL of water, and then separated with 255 g of D101 macroporous resin. The eluent was eluted stepwise with 8 times the amount of resin (V / m) of water, 30%, 50%, 60%, 80%, and 95% ethanol, respectively. The 50% and 80% eluent components were combined, concentrated under vacuum, and dried to obtain 5.9 g of extract I.

[0036] 4) Extraction of component 2: Take 55g of Schisandra chinensis, 30g of Pueraria lobata and 25g of Gardenia jasminoides, add 10 times the amount of 60% ethanol and extract 3 times, 1 hour each time, and combine the extracts.

[0037] 5) Separation of Component II: The extract was concentrated to 110 mL, 1.2 g citric acid and 0.022 g activated carbon were added, and the mixture was kept at 80℃ for 1.5 h. The pH was adjusted to 6.5 with NaOH, 300 mesh diatomaceous earth was added, and the mixture was filtered. The filtrate was directly separated using D101 resin, eluted with 6 times the resin volume (V / m) of water, 10%, 20%, 50%, 60%, and 95% respectively. The 20% and 60% eluents were collected, mixed evenly, and then adsorbed and purified using an LX-68 resin column. The permeate was collected, concentrated under vacuum, and dried to obtain 4.1 g of extract II.

[0038] 5) Mixing: Mix the above extract I and extract II to obtain 10.0 g of traditional Chinese medicine composition. Example

[0039] 1) Pre-treatment: Take ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia slices separately, crush them, pulverize them and pass them through a 0.8mm sieve for later use.

[0040] 2) Extraction of component 1: Take 80 g of ginseng, 70 g of astragalus and 40 g of ophiopogon japonicus, mix them, add 6 times the amount of 70% ethanol and extract twice, each time for 1.75 h, and combine the extracts.

[0041] 3) Separation of Component 1: The extract was concentrated to 190 mL, extracted once with 8 times the amount of ethanol ethyl ester (45℃), and extracted twice with n-butanol. The n-butanol extract was concentrated under vacuum to obtain a paste, dispersed in 190 mL of water, and then separated with 285 g of AB-8 macroporous resin. The components were eluted stepwise with 7 times the amount of resin (V / m) of water, 30%, 50%, 60%, 80%, and 95% ethanol, respectively. The 50% and 80% eluent components were combined, concentrated under vacuum, and dried to obtain 6.7 g of extract I.

[0042] 4) Extraction of component 2: Take 60g of Schisandra chinensis, 20g of Pueraria lobata and 30g of Gardenia jasminoides, add 12 times the amount of 55% ethanol and extract 3 times, 0.5h each time, and combine the extracts.

[0043] 5) Separation of Component II: The extract was concentrated to 110 mL, 2.2 g citric acid and 0.055 g activated carbon were added, and the mixture was kept at 80 °C for 0.5 h. The pH was adjusted to 6.8 with NaOH, 300 mesh diatomaceous earth was added, and the mixture was filtered. The filtrate was directly separated using AB-8 resin, eluted with 8 times the resin volume (V / m) of water, 10%, 20%, 50%, 60%, and 95%, respectively. The 20% and 60% eluents were collected, mixed evenly, and then adsorbed and purified using an LX-68 resin column. The permeate was collected, concentrated under vacuum, and dried to obtain 4.1 g of extract II.

[0044] 5) Mixing: Mix the above extract I and extract II to obtain 10.8g of traditional Chinese medicine composition. Example

[0045] The extraction and separation process of the medicinal materials was the same as in Example 1, but the dosage of the two groups of medicinal materials was different. Component 1 consisted of 90 g of ginseng, 60 g of astragalus, and 40 g of ophiopogon japonicus; Component 2 consisted of 40 g of schisandra chinensis, 10 g of kudzu root, and 60 g of gardenia. After extraction and separation, 9.2 g of the traditional Chinese medicine composition was obtained. Example

[0046] The extraction and separation process of the medicinal materials was the same as in Example 1, but the dosage of the two groups of medicinal materials was different. Component 1 consisted of 50 g of ginseng, 60 g of astragalus, and 50 g of ophiopogon japonicus; Component 2 consisted of 70 g of schisandra chinensis, 40 g of kudzu root, and 10 g of gardenia. After extraction and separation, 9.0 g of the traditional Chinese medicine composition was obtained. Example

[0047] The extraction and separation process of the medicinal materials was the same as in Example 1, but the dosage of the two groups of medicinal materials was different. Component 1 consisted of 60 g of ginseng, 90 g of astragalus, and 10 g of ophiopogon japonicus; Component 2 consisted of 70 g of schisandra chinensis, 10 g of kudzu root, and 40 g of gardenia. After extraction and separation, 8.7 g of the traditional Chinese medicine composition was obtained.

[0048] Example 7: Granule Preparation Method The obtained traditional Chinese medicine composition was mixed with 30 parts resistant dextrin and 12 parts mannitol, with steviol glycosides as a flavoring agent. After mixing, 60% ethanol was added as a wetting agent for wet granulation, and the mixture was dried at 50°C to obtain granules of the traditional Chinese medicine composition.

[0049] Comparative Example 1 The extraction and separation process of the medicinal materials was the same as in Example 1, but the amounts of the two groups of medicinal materials were different. Component 1 consisted of 120 g of ginseng, 10 g of astragalus, and 60 g of ophiopogon japonicus; Component 2 consisted of 20 g of schisandra chinensis, 10 g of kudzu root, and 80 g of gardenia. After extraction and separation, 11.2 g of the traditional Chinese medicine composition was obtained.

[0050] Comparative Example 2 The extraction and separation process of the medicinal materials was the same as in Example 1, but the dosage of the two groups of medicinal materials was different. Component 1 consisted of 30 g of ginseng, 20 g of astragalus, and 60 g of ophiopogon japonicus; Component 2 consisted of 20 g of schisandra chinensis, 80 g of kudzu root, and 10 g of gardenia. After extraction and separation, 9.1 g of the traditional Chinese medicine composition was obtained.

[0051] Comparative Example 3 The extraction and separation process of the medicinal materials was the same as in Example 1, but the dosage of the two groups of medicinal materials was different. Component 1 consisted of 40 g of ginseng, 130 g of astragalus, and 20 g of ophiopogon japonicus; Component 2 consisted of 80 g of schisandra chinensis, 10 g of kudzu root, and 20 g of gardenia. After extraction and separation, 11.5 g of the traditional Chinese medicine composition was obtained.

[0052] Comparative Example 4 The pretreatment, extraction and separation processes of components 1 and 2 were the same as in Example 1. However, after separation of components 1 and 2 by resin, all alcohol eluents were collected to obtain 20.1 g of extract I and 12.2 g of extract II, for a total of 32.3 g of traditional Chinese medicine composition.

[0053] Comparative Example 5 The pretreatment, extraction and separation processes of components 1 and 2 were the same as in Example 1, but component 2 was not treated with LX-68 resin adsorption. Extract I 6.3 g and extract II 6.5 g were obtained respectively, for a total of 12.8 g of traditional Chinese medicine composition.

[0054] Comparative Example 6 The pretreatment, extraction and separation processes of components 1 and 2 were the same as in Example 1, but the extraction temperature of ethyl acetate for component 1 was room temperature, and citric acid and activated carbon were not added for component 2. Extract I 8.9 g and extract II 7.6 g were obtained respectively, for a total of 16.5 g of traditional Chinese medicine composition.

[0055] Comparative Example 7 1) Pre-treatment: Take ginseng, astragalus, ophiopogon japonicus, schisandra chinensis, kudzu root, and gardenia slices separately, crush them, pulverize them and pass them through a 0.8mm sieve for later use.

[0056] 2) Mix 70 g of ginseng, 80 g of astragalus, 30 g of ophiopogon japonicus, 60 g of schisandra chinensis, 20 g of kudzu root and 30 g of gardenia, and extract twice with 8 times the amount of 70% ethanol, 1.5 h each time, and combine the extracts.

[0057] 3) The extract was concentrated and dried under vacuum to obtain 95.3g of the traditional Chinese medicine composition.

[0058] Comparative Example 8 (Gardenia control group) Comparative Example 8 (Gardenia jasminoides alone control group) Pretreatment: Take gardenia slices, crush them, pulverize them and pass them through a 0.8 mm sieve for later use.

[0059] Extraction: Take 100 g of gardenia (consistent with the actual amount of gardenia in the compound in Example 1, where gardenia was 30 g, but the total amount of raw herbs in the compound was 70+80+30+60+20+30=290 g, and the proportion of gardenia was 30 / 290≈10.34%; scale up proportionally, 100 g of gardenia alone), add 12 times the amount of 55% ethanol for extraction 3 times, 0.5 h each time, and combine the extracts.

[0060] Separation: The extract was concentrated to 110 mL, 1.65 g citric acid and 0.033 g activated carbon were added, and the mixture was kept at 80℃ for 1 h. The pH was adjusted to 6 with NaOH, 300-mesh diatomaceous earth was added, and the mixture was filtered. The filtrate was directly separated using AB-8 resin, eluted with 4-8 times the resin volume (V / m) of water, and at concentrations of 10%, 20%, 50%, 60%, and 95%. The 20% and 60% eluates were collected, mixed thoroughly, and then adsorbed onto an LX-68 resin column to remove impurities. The permeate was collected, concentrated under vacuum, and dried to obtain 4.5 g of gardenia extract. This extract served as the control sample for single-herb gardenia.

[0061] Experimental Example 1: GLP-1 Receptor Binding Assay In this experiment, fluorescence polarization (FP) assays were used to determine the activation effects of different receptors. The GLP-1 receptor and GLP-1-5-FAM SE were purchased from Wuhan Aimojiahua Biotechnology Co., Ltd., while GLP-1-31 (amino acid sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG) and GLP-1-39 (amino acid sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS) were purchased from Jier Biochemical Co., Ltd.

[0062] GLP-1R, GLP-1-5-FAM SE, and unlabeled GLP-1 or extract were prepared to final concentrations of 10 nM, 0.04 nM, and 1 nM or 10 μM, respectively, using a FP buffer of 10 mM Tris, 50 mM NaCl, 1 mM EDTA, and pH 8.0. 100 μL of the above mixed solution was transferred to a black opaque 96-well plate and centrifuged at 200 g for 5 min. The mixture was then stirred at 200 rpm for 5 min using a shaker (e.g., Thermo MB100-4A). FP measurements were performed using a microplate reader (BioTEK SYNERGY H1) with the emission wavelength set to 528 nm and the excitation wavelength set to 485 nm. GLP-1-31 and GLP-1-39 were used as positive controls, and 0.1% DMSO was used as a blank control. Stronger GLP-1 receptor activation was associated with lower polarization.

[0063] The results are as follows Figure 1 As shown, the data for different letters are significantly different (P < 0.05).

[0064] Depend on Figure 1 The results showed that the GLP-1 receptor activating activity of the traditional Chinese medicine compositions obtained in Examples 1-3 was not significantly different from that of the positive control GLP-1-31. Examples 4-6 showed significant differences from all comparative examples and the blank, indicating that they also had good activity. The difference in activity between them and Examples 1-3 shows that different formulations lead to different activities, and the optimal combination ratio can be determined through activity assay results. The activity results of Comparative Examples 1-6 further indicate that the proportion of the traditional Chinese medicine composition, resin process control, and process selection all affect the activity results; Comparative Example 7 shows that modern extraction and separation processes are very important for the enrichment of active ingredients. The GLP-1 receptor activating activity of Comparative Example 8 (single gardenia extract) was significantly weaker than that of Examples 1-6 (P<0.05), but there was no significant difference from the blank control group, indicating that although single gardenia has some activity, it is far lower than that of the compound combination. The compound of this invention significantly enhances the GLP-1 receptor activating activity through the synergistic effect of multiple herbs. Overall, the examples are superior to the comparative examples, with Examples 1-3 showing the strongest activity (P<0.05).

[0065] Experiment Example 2: Weight Loss Experiment All test samples were prepared by pilot-scale amplification according to the processes of each embodiment and comparative example; the raw materials, processing aids, process parameters, and preparation methods remained consistent. The granules obtained in Examples 1–6 and Comparative Examples 1–7 (all prepared according to the process in Example 7) were pulverized and used as samples for gavage. SPF-grade C57BL / 6 male mice, 8 weeks old and weighing 20 g ± 2 g, were randomly divided into test groups (high-fat diet + test sample), a positive control group (high-fat diet + orlistat 10 mg·kg⁻¹·d⁻¹), and all animals were given a high-fat diet (fat energy ratio 45%) for 4 consecutive weeks to establish a diet-induced obesity model. Day 1 of week 5 was designated as day 1 of administration. The same amount of raw drug (0.1 g crude drug / kg body weight) was administered by gavage, while the blank control group received an equal volume of 0.5% CMC-Na solution for 4 consecutive weeks. Body weight and 24-hour food intake were measured weekly, and the weight growth rate (%) was calculated as follows: [(weight at the end of the experiment - weight at the beginning of the experiment) / weight at the beginning of the experiment] × 100%.

[0066]

[0067] As shown in Table 1, compared with the blank control group, the compositions of each example and comparative example all showed varying degrees of weight loss. The weight loss effects of Examples 1-3 were significantly better than those of Examples 4-6. Although there were differences compared with the positive control, the weight loss effects were relatively similar. Examples 4-6 were better than the comparative examples. Meanwhile, there were certain differences among the comparative examples, with Comparative Example 7 showing the worst effect. The weight gain rate of Comparative Example 8 (gardenia extract alone) was 13.5%, which was not significantly different from the blank control group (P>0.05) but significantly higher than the groups in each example (P<0.05), indicating that the weight loss effect of gardenia alone was weak. The compound of this invention achieved a significant weight loss effect through the synergistic effect of multiple herbs. In summary, Examples 1-3 showed good weight loss effects.

[0068] In summary, the natural components extracted and isolated from the traditional Chinese medicine composition of this application can bind to GLP-1 receptors, exhibiting good receptor activation and weight loss effects. The traditional Chinese medicine composition prepared by this method can serve as an important raw material for the development of hypoglycemic and weight-loss health foods.

[0069] The specific embodiments described herein are merely illustrative of the spirit of the invention. Those skilled in the art to which this invention pertains may make various modifications or additions to the described specific embodiments or use similar methods to substitute them, without departing from the spirit of the invention or exceeding the scope defined by the appended claims.

Claims

1. A traditional Chinese medicine composition for activating GLP-1 receptors, characterized in that, The composition comprises, by weight parts, the following components: 50-90 parts ginseng, 60-90 parts astragalus, 20-50 parts ophiopogon japonicus, 40-70 parts schisandra chinensis, 10-40 parts kudzu root, and 10-40 parts gardenia.

2. The traditional Chinese medicine composition for activating GLP-1 receptor according to claim 1, characterized in that, The composition comprises the following components: 60-80 parts ginseng, 70-80 parts astragalus, 30-40 parts ophiopogon japonicus, 50-70 parts schisandra chinensis, 20-30 parts kudzu root, and 20-30 parts gardenia.

3. The traditional Chinese medicine composition for activating GLP-1 receptor according to claim 1, characterized in that, The composition comprises the following medicinal materials: 70 parts ginseng, 80 parts astragalus, 30 parts ophiopogon japonicus, 60 parts schisandra chinensis, 20 parts kudzu root, and 30 parts gardenia.

4. A method for preparing the traditional Chinese medicine composition according to any one of claims 1 to 3, characterized in that, The composition is extracted in groups: ginseng, astragalus, and ophiopogon japonicus form component one, which is extracted with 60%-80% ethanol as solvent, with an extraction ratio of 6-8 times, extracted twice, each time for 1.5-2 hours; schisandra chinensis, kudzu root, and gardenia form component two, which is extracted with 50%-60% ethanol, with an extraction ratio of 10-12 times, extracted three times, each time for 0.5-1 hours.

5. The method for preparing a traditional Chinese medicine composition for activating GLP-1 receptor according to claim 4, characterized in that, After extraction and concentration, the components were extracted sequentially with food-grade acetic acid and n-butanol, with the ethyl acetate extraction temperature at 40-50℃. The n-butanol extract was concentrated, dried, and dispersed in water, then separated using D101 or AB-8 resin. The components were eluted stepwise with water, 30%, 50%, 60%, 80%, and 95% ethanol, respectively. The 50% and 80% fractions were combined, concentrated, and vacuum dried to obtain extract I.

6. The method for preparing a traditional Chinese medicine composition for activating GLP-1 receptor according to claim 1, characterized in that, After extraction and concentration, component two is incubated at 50-60℃ with 1-2% citric acid and 80℃ with 0.01-0.05% activated carbon for 0.5-1.5 h. The pH is then adjusted to 6-7, diatomaceous earth is added for filtration, and separation is performed using D101 or AB-8 resin. The eluents are eluted with water, 10%, 20%, 50%, 60%, and 95%, respectively. The 20% and 60% eluents are collected, and the eluents are combined and passed through an LX-68 resin column. The permeate is collected, concentrated, and vacuum dried to obtain extract II. The traditional Chinese medicine composition is prepared by mixing extract I and extract II according to the composition ratio of the selected traditional Chinese medicine raw materials.

7. The application of a traditional Chinese medicine composition according to any one of claims 1 to 6, characterized in that, The traditional Chinese medicine composition is mixed with food-grade excipients to form a health food preparation with weight loss effect. The food-grade excipients include at least one of resistant dextrin, mogroside, steviol, erythritol, xylitol, magnesium stearate, and edible flavoring.

8. The application of the traditional Chinese medicine composition for activating GLP-1 receptors according to claim 7, characterized in that, The excipients are resistant dextrin, steviol glycosides, and mannitol.

9. The application of the traditional Chinese medicine composition for activating GLP-1 receptors according to claim 7, characterized in that, The health food preparations are tablets, capsules, granules, powders, or pills.