HYPERSENSITIVE REACTION TRIGGERS DERIVED PEPTIDES AND THEIR USE
Patent Information
- Application Number
- DE602017091191
- Authority / Receiving Office
- DE · DE
- Patent Type
- Patents
- Current Assignee / Owner
- Priority Date
- 2016-04-06
- Filing Date
- 2017-03-31
- Publication Date
- 2025-08-13
- Estimated Expiration
- 2037-03-31
AI Technical Summary
Existing harpin proteins have limited solubility and stability in aqueous solutions, leading to rapid degradation and reduced effectiveness in inducing hypersensitive responses and other active plant responses.
Development of isolated peptides with specific amino acid sequences, such as L-X-X-L-L-L-X-(F/L)-(I/L)-X-X-X-L, that exhibit improved solubility, stability, and resistance to chemical degradation, allowing for enhanced plant responses like disease resistance and growth enhancement.
The peptides provide stable and effective plant responses, including disease resistance, growth enhancement, and stress tolerance, with improved solubility and stability, facilitating better application and delivery to plants.
Description
FIELD OF THE INVENTION
[0001] The present invention relates to novel hypersensitive response elicitor peptides and their use for inducing active plant responses including, among others, growth enhancement, disease resistance, pest or insect resistance, and stress resistance.BACKGROUND OF THE INVENTION
[0002] The identification and isolation of harpin proteins came from basic research at Cornell University attempting to understand how plant pathogenic bacteria interact with plants. A first line of defense is the hypersensitive response (HR), a localized plant cell death at the site of infection. Cell death creates a physical barrier to movement of the pathogen and in some plants dead cells can release compounds toxic to the invading pathogen. Research had indicated that pathogenic bacteria were likely to have a single factor that was responsible for triggering the HR. A basic aim of the Cornell research was to identify a specific bacterial protein responsible for eliciting the HR. The target protein was known to be encoded by one of a group of bacteria genes called the Hypersensitive Response and Pathogenicity (hrp) gene cluster. The hrp cluster in the bacterium Erwinia amylovora (Ea), which causes fire blight in pear and apple, was dissected and a single protein was identified that elicited HR in certain plants. This protein was given the name harpin (and, later, harpin Ea) and the corresponding gene designated hrpN. This was the first example of such a protein and gene identified from any bacterial species.
[0003] A number of different harpin proteins have since been identified from Erwinia, Pseudomonas, Ralstonia, Xanthomonas, and Pantoea species, among others. Harpin proteins, while diverse at the primary amino acid sequence level, share common biochemical and biophysical characteristics as well as biological functions. Based on their unique properties, the harpin proteins are regarded in the literature as belonging to a single class of proteins.
[0004] Subsequent to their identification and isolation, it was thereafter discovered that harpins could elicit disease resistance in plants and increase plant growth. An important early finding was that application of purified harpin protein made a plant resistant to a subsequent pathogen attack, and in locations on the plant well away from the injection site. This meant that harpin proteins can trigger a Systemic Acquired Resistance (SAR), a plant defense mechanism that provides resistance to a variety of viral, bacterial, and fungal pathogens.
[0005] In crop protection, there is a continuous need for compositions that improve the health of plants. Healthier plants are desirable since they result in better yields and / or a better quality of the plants or crops. Healthier plants also better resist biotic and abiotic stress. A high resistance against biotic stresses in turn allows the growers to reduce the quantity of pesticides applied and consequently to slow down the development of resistances against the respective pesticides.
[0006] Harpin αβ is a fusion protein that is derived from several different harpins. Harpin αβ has been shown to suppress nematode egg production, enhance the growth, quality and yield of a plant, and increase a plant's vigor. Its amino acid and nucleotide sequences are described in detail in U.S. Application Publ. No. 2010 / 0043095.
[0007] To date, harpin and harpin αβ production and their use in agricultural and horticultural applications have been as a powdered solid coated on starch. This limits the use and versatility of the harpin proteins, because liquid suspensions of the powdered harpin proteins in water have an effective useful life of only 48-72 hours before significant degradation and loss of activity occurs. Another problem with harpin solutions is protein solubility and stability.
[0008] It would be desirable to identify synthetic and derivative harpin peptides that are readily soluble in aqueous solution, stable, resistant to chemical degradation, and effective in initiating one or more active plant responses including, without limitation, the hypersensitive plant response.
[0009] The present invention is directed to overcoming these and other limitations in the art.SUMMARY OF THE INVENTION
[0010] A first aspect of the invention relates to an isolated peptide that is 12 to 50 amino acids in length, the peptide comprising the amino acid sequence of L-X-X-L-L-L-X-(F / L)-(I / L)-X-X-X-L (SEQ ID NO: 2), wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 3 is optional and, when present, is Gln (Q); and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate. In one embodiment, X at position 3 is present. In another embodiment, X at position 3 is not present. In other embodiments, the isolated peptide is free of cysteine or free of both cysteine and methionine. In certain embodiments, the isolated peptide further includes a hydrophilic amino acid sequence that is located N-terminal or C-terminal to SEQ ID NO: 2.
[0011] The first aspect of the invention further relates to an isolated peptide that is 12 to 50 amino acids in length and comprises the amino acid sequence of: wherein X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 5 is optional and, when present, is Gln (Q); and each X at positions 9, 12, 13, and 14 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate. In one embodiment, X at position 5 is present. In another embodiment, X at position 5 is not present.
[0012] The first aspect of the invention further relates to an isolated peptide that is 12 to 50 amino acids in length and comprises the amino acid sequence of: wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 3 is optional and, when present, is Gln (Q); and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate. In one embodiment, X at position 3 is present. In another embodiment, X at position 3 is not present.
[0013] The first aspect of the invention further relates to an isolated peptide that is 12 to 50 amino acids in length and comprises the amino acid sequence of: wherein X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 5 is optional and, when present, is Gln (Q); and each X at positions 9, 12, 13, and 14 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate. In one embodiment, X at position 5 is present. In another embodiment, X at position 5 is not present.
[0014] A further aspect of the invention relates to a fusion protein comprising a plurality of amino acid sequences linked together in series, each of the plurality of amino acid sequences comprising the peptide according to the first aspect of the invention.
[0015] A further aspect of the invention relates to a composition that includes one or more peptides according to the invention, or a fusion protein according to the invention, and a carri er.
[0016] A further aspect of the invention relates to a method of imparting disease resistance to plants. This method includes: applying an effective amount of an isolated peptide according to the invention, a fusion protein according to the invention, or a composition according to the invention to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to impart disease resistance.
[0017] A further aspect of the invention relates to a method of enhancing plant growth. This method includes: applying an effective amount of an isolated peptide according to the invention, a fusion protein according to the invention, or a composition according to the invention to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to enhance plant growth.
[0018] A further aspect of the invention relates to a method of increasing a plant's tolerance and resistance to biotic stressors. This method includes: applying an effective amount of an isolated peptide according to the invention, a fusion protein according to the invention, or a composition according to the invention to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance and resistance to biotic stress factors selected from the group consisting of pests such as insects, arachnids, nematodes, weeds, and combinations thereof.
[0019] A further aspect of the invention relates to a method of increasing a plant's tolerance to abiotic stress. This method includes: applying an effective amount of an isolated peptide according to the invention, a fusion protein according to the invention, or a composition according to the invention to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to increase the plant's tolerance to abiotic stress factors selected from the group consisting of salt stress, water stress (including drought and flooding), ozone stress, heavy metal stress, cold stress, heat stress, nutritional stress (including phosphate, potassium, nitrogen deficiency), and combinations thereof.
[0020] A further aspect of the invention relates to a method of modulating plant biochemical signaling. This method includes: applying an effective amount of an isolated peptide according the invention, a fusion protein according to the invention, or a composition according to the invention to a plant or the locus where the plant is growing, wherein said applying is effective to modulate plant biochemical signaling.
[0021] A further aspect of the invention relates to a DNA construct including a first nucleic acid molecule encoding a polypeptide according to the invention or a fusion protein according to the invention; and a promoter-effective nucleic acid molecule operably coupled to the first nucleic acid molecule. This aspect of the invention also encompasses a recombinant expression vector containing the DNA construct, a recombinant host cell containing the DNA construct, as well as transgenic plants or plant seeds that include a recombinant plant cell of the invention (which contains the DNA construct).
[0022] By providing HR-eliciting peptides and active but non-HR-eliciting peptides that exhibit improved solubility, stability, resistance to chemical degradation, or a combination of these properties, it will afford growers with greater flexibility in preparing, handling, and delivering to plants in their fields or greenhouses effective amounts of compositions containing these HR-eliciting and non-HR-eliciting peptides. Simplifying the application process for growers will lead to greater compliance and, thus, improved results with respect to one or more of disease resistance, growth enhancement, tolerance and resistance to biotic stressors, tolerance to abiotic stress, desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants. These and other benefits are described herein, and the utility of these peptides is demonstrated by the accompanying Examples where resistance to tobacco mosaic virus was shown in tobacco, resistance to nematodes was demonstrated in soy and tomato, and drought resistance was demonstrated in soy and corn.BRIEF DESCRIPTION OF THE DRAWINGS
[0023] Figure 1 shows a solubility and stability test of peptide P5 (SEQ ID NO: 8) in the following 50mM buffer solutions: citrate, pH 7.2; EDDS, pH 7.3; imidazole, pH 7.5; EDTA, pH 8.0; sodium phosphate, pH 8.0; and TES, pH 8.0. Peptide P5 exhibited poor solubility below pH 7.0, and exhibited its best results in an EDTA buffer at pH 8.0 (about 40% remaining after 14 days). Figure 2 shows a solubility and stability test of peptide P5-9 (SEQ ID NO: 15) in deionized water and the following 50mM buffer solutions: citrate, pH 5.6; MES, pH 6.0; MOPS, pH 6.5; citrate, pH 7.2; EDDS, pH 7.3; imidazole, pH 7.5; EDTA, pH 8; sodium phosphate, pH 8.0; and TES, pH 8.0. Peptide P5-9 exhibited better solubility performance at 500 ug / ml as well as better stability compared with P5. In both citrate at pH 7.2 and phosphate at pH 8.0, peptide P5-9 exhibited around 80% remaining after 45 days. Figure 3 shows a solubility and stability test of peptide P5-21 (SEQ ID NO: 33) in the following 50mM buffer solutions: citrate, pH 5.6; MES, pH 6.0; MOPS, pH 6.5; citrate, pH 7.2; EDDS, pH 7.3; imidazole, pH 7.5; EDTA, pH 8; sodium phosphate, pH 8.0; and TES, pH 8.0. Peptide P5-21 exhibited good solubility at pH 5.6 and higher, as well as excellent stability (>90% after 14 days) for all buffers pH > 7.0 except EDTA (around 80%). DETAILED DESCRIPTION OF THE INVENTION
[0024] One aspect of the invention relates to novel peptides that possess the ability to either induce a hypersensitive response in plants or promote active plant responses (or both) that afford one or more of the following attributes: disease resistance, growth enhancement, tolerance and resistance to biotic stressors, and tolerance to abiotic stress. The induction of these plant responses involves modulating plant biochemical signaling.
[0025] As used herein, naturally occurring amino acids are identified throughout by the conventional three-letter and / or one-letter abbreviations, corresponding to the trivial name of the amino acid, in accordance with the following list: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V). The abbreviations are accepted in the peptide art and are recommended by the IUPAC-IUB commission in biochemical nomenclature. Naturally occurring variations of these amino acids are well known and include, without limitation, gamma-glutamate (g-Glu) and isoaspartate (iso-Asp or isoD).
[0026] The term "amino acid" further includes analogues, derivatives, and congeners of any specific amino acid referred to herein, as well as C-terminal or N-terminal protected amino acid derivatives (e.g., modified with an N-terminal , C-terminal, or side-chain protecting group, including but not limited to acetylation, formylation, methylation, amidation, esterification, PEGylation, and addition of lipids. Non-naturally occurring amino acids are well known and can be introduced into peptides of the present invention using solid phase synthesis as described below. Furthermore, the term "amino acid" includes both D- and L-amino acids. Hence, an amino acid which is identified herein by its name, three letter or one letter symbol and is not identified specifically as having the D or L configuration, is understood to assume any one of the D or L configurations. In one embodiment, a peptide comprises all L-amino acids.
[0027] In certain embodiments, peptides are identified to "consist of" a recited sequence, in which case the peptide includes only the recited amino acid sequence(s) without any extraneous amino acids at the N- or C-terminal ends thereof. To the extent that a recited sequence is in the form of a consensus sequence where one or more of the denoted X or Xaa residues can be any of one or more amino acids, then multiple peptide sequences are embraced by a peptide consisting of such a recited sequence.
[0028] In certain other embodiments, peptides are identified to "consist essentially of' a recited sequence, in which case the peptide includes the recited amino acid sequence(s) optionally with one or more extraneous amino acids at the N- and / or C-terminal ends thereof, which extraneous amino acids do not materially alter one or more of the following properties: (i) the ability of the peptide to induce a hypersensitive response or other active response in plants, (ii) solubility of the peptide in water or aqueous solutions, (iii) stability of the peptide dissolved in water or aqueous solution at 50°C over a period of time (e.g., 3 weeks), and (iv) resistance of the peptide to chemical degradation in the presence of an aqueous buffered solution that includes a biocidal agent (e.g., Proxel ®< GXL) at 50°C over a period of time (e.g., 3 weeks).
[0029] Briefly, the stability and resistance to chemical degradation of peptides can be assessed as follows using peptide samples having an initial purity of at least about 80%, at least about 82%, at least about 84%, at least about 86%, at least about 88%, at least about 90%, at least about 92%, at least about 94%, at least about 96%, or at least about 98%. For water stability, the peptide is dissolved directly in de-ionized water. For chemical degradation tests, the peptide is dissolved in an aqueous solution containing 50 mM pH buffer and 0.25% Proxel GXL. Exemplary pH buffers include, without limitation: (i) Citrate pH 5.6; (ii) MES pH 6.0; (iii) MOPS pH 6.5; (iv) imidazole pH 7.5; (v) Citrate pH 7.2; (vi) EDDS, pH 7.3; (vii) EDTA pH 8.0; (viii) sodium phosphate pH 8.0; or (ix) TES pH 8.0. Peptides are first dissolved in the aqueous solution at a concentration of 0.5 mg / ml. The samples are incubated at 50°C to allow for accelerated degradation. An initial sample of the peptide is removed, diluted 10x with water, and analyzed by reverse-phase HPLC. Briefly, 20 µl of the sample is injected into the solvent flow of an HPLC instrument and analyzed on a C18 HPLC column (YMC ProPack C18, YMC, Japan, or C18 Stablebond, Agilent Technologies, USA) using either a triethylamine phosphate in water / acetonitrile gradient or a 0.1% TFA in water / 0.1% TFA in acetonitrile gradient to separate different peptide species. Eluting peptides are monitored by UV absorbance at 218 nm and quantified based on the area under the peak. The area under the peak for the initial peptide sample is treated as the standard for relative quantification in subsequent runs. At regular intervals (e.g., 1, 3, 7, 10, and 14 days), each peptide sample is surveyed and analyzed by HPLC as described above. If necessary to observe degradation (i.e., where the peptide exhibits a high degree of chemical stability), this protocol can be extended by several weeks to observe degradation. The quantification of subsequent peptide runs is expressed as a percentage of the original (day 0) HPLC result.
[0030] A peptide that is at least partially soluble in water or aqueous solution exhibits a solubility of greater than 0.1 mg / ml, preferably at least about 1.0 mg / ml, at least about 2.0 mg / ml, at least about 3.0 mg / ml, or at least about 4.0 mg / ml. In certain embodiments, the peptide exhibits high solubility in water or aqueous solution, with a solubility of at least about 5.0 mg / ml, at least about 10.0 mg / ml, at least about 15.0 mg / ml, or at least about 20 mg / ml.
[0031] A peptide that is stable in water or aqueous solution exhibits at least about 66%, at least about 68%, at least about 70%, at least about 72 %, at least about 74 %, at least about 76%, at least about 78%, at least about 80%, at least about 82%, at least about 84%, at least about 86%, at least about 88%, or at least about 90% of the original peptide concentration over the designated period of time incubated at 50°C. In certain embodiments, the designated period of time is 3 days, 7 days, 14 days, 21 days, 28 days, one month, two months, three months, or four months.
[0032] A peptide that is resistant to chemical degradation exhibits at least about 66%, at least about 68%, at least about 70%, at least about 72 %, at least about 74 %, at least about 76%, at least about 78%, at least about 80%, at least about 82%, at least about 84%, at least about 86%, at least about 88%, or at least about 90% of the original peptide concentration over the designated period of time incubated at 50°C. In certain embodiments, the designated period of time is 3 days, 7 days, 14 days, 21 days, 28 days, one month, two months, three months, or four months.
[0033] A property of a peptide to elicit a hypersensitive response, or not, upon infiltration or application of the peptide to plant tissues can be measured by applying the peptide in dry powder form or in solution form to a plant, particularly though not exclusively a plant leaf. Application rates include 1-500 ug / ml for liquid solution and 0.0001 - 0.5% (w / w for powder application. Exemplary application of the peptide in solution form is described in the accompanying Examples. Plants are considered HR-positive ("HR+") if they exhibit widespread macroscopic cell death visible to the naked eye, accompanied by wilting and browning of the affected tissue within 48 hours. Plants are considered HR-negative ("HR-") if they exhibit no discernible wilting or tissue death observable by naked eye.
[0034] In certain embodiments, material alteration of the one or more properties is intended to mean that there is less than 20% variation, less than 15% variation, less than 10% variation, or less than 5% variation in a recited property when comparing a peptide possessing the one or more extraneous amino acids to an otherwise identical peptide lacking the one or more extraneous amino acids. In certain embodiments, the number of extraneous amino acids at the N- or C-terminal ends is up to 20 amino acids at one or both ends, up to 15 amino acids at one or both ends, up to 10 amino acids at one or both ends, up to 7 amino acids at one or both ends, up to 5 amino acids at one or both ends, or up to 3 amino acids at one or both ends. Further, to the extent that a recited sequence is in the form of a consensus sequence where one or more of the denoted X or Xaa residues can be any of one or more amino acids, then multiple peptide sequences are embraced by the peptide consisting essentially of such a recited sequence, without regard to additional variations of such sequences that are afforded by the presence of extraneous amino acids at the N- and / or C-terminal ends thereof.
[0035] In various embodiments of the invention, the disclosed peptides may include a hydrophilic amino acid sequence, e.g., at either the N-terminal or C-terminal end of a designated peptide sequence. The hydrophilic amino acid sequence is at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acids in length, and includes amino acid residues that contribute to a hydrophilic property of the amino acid sequence that is adjacent to the amino acid sequence of the designated peptide (i.e., the peptide that induces an active plant response). Different methods have been used in the art to calculate the relative hydrophobicity / hydrophilicity of amino acid residues and proteins (Kyte et al., "A Simple Method for Displaying the Hydropathic Character of a Protein," J. Mol. Biol. 157: 105-32 (1982); Eisenberg D, "Three-dimensional Structure of Membrane and Surface Proteins," Ann. Rev. Biochem. 53: 595-623 (1984); Rose et al., "Hydrogen Bonding, Hydrophobicity, Packing, and Protein Folding," Annu. Rev. Biomol. Struct. 22: 381-415 (1993); Kauzmann, "Some Factors in the Interpretation of Protein Denaturation," Adv. Protein Chem. 14: 1-63 (1959)). Any one of these hydrophobicity scales can be used for the purposes of the present invention; however, the Kyte-Doolittle hydrophobicity scale is perhaps the most often referenced scale. These hydropathy scales provide a ranking list for the relative hydrophobicity of amino acid residues. For example, amino acids that contribute to hydrophilicity include Arg (R), Lys (K), Asp (D), Glu (E), Gln (Q), Asn (N), and His (H) as well as, albeit to a lesser extent, Ser (S), Thr (T), Gly (G), Pro (P), Tyr (Y), and Trp (W). For example, polyglutamate sequences can be used to enhance solubility of proteins and other drug molecules (Lilie et al, Biological Chemistry 394(8):995-1004(2013); Li et al., Cancer Research 58: 2404-2409(1998))).
[0036] The "hydropathy index" of a protein or amino acid sequence is a number representing its average hydrophilic or hydrophobic properties. A negative hydropathy index defines the hydrophilicity of the amino acid sequence of interest. The hydropathy index is directly proportional to the hydrophilicity of the amino acid sequence of interest; thus, the more negative the index, the greater its hydrophilicity. In certain embodiments, the added hydrophilic amino acid sequence described above has a hydropathy index of less than 0, -0.4, -0.9, -1.3, -1.6, -3.5, -3.9, or -4.5. In certain embodiments, the resulting entire peptide will have a hydropathy index of less than 0.7, 0.3, 0.2, 0.1, or 0.0, preferably less than -0.1, -0.2, -0.3, -0.4, more preferably less than -0.5, -0.6, -0.7, -0.8, -0.9, or -1.0.
[0037] In the peptides of the present invention, amino acids that contribute to a hydrophilic hydropathy index, for either the peptide as a whole or the added hydrophilic amino acid sequence, include Arg (R), Lys (K), Asp (D), Glu (E), Gln (Q), Asn (N), His (H), Ser (S), Thr (T), Gly (G), Pro (P), Tyr (Y), and Trp (W). Of these, Asp (D), Glu (E), Gln (Q), Asn (N) or their variants are preferred. Exemplary variants include g-glutamate for Glu and isoaspartic acid (or isoD) for Asp.
[0038] As used herein, in this and in other aspects of the invention, the term "hydrophobic amino acid" is intended to refer to an amino acid that contributes hydrophobicity to the hydropathy index of a designated amino acid sequence. Amino acids that contribute to a hydrophobic hydropathy index, for either the peptide as a whole or a particular amino acid sequence thereof, include Ile (I), Val (V), Leu (L), Phe (F), Cys (C), Met (M), and Ala (A). In certain embodiments, the term "hydrophobic amino acid" may refer to any one of Ile (I), Val (V), Leu (L), Phe (F), Cys (C), Met (M), and Ala (A); or, alternatively, to any one of Ile (I), Val (V), Leu (L), Phe (F), and Ala (A). In certain other embodiments, the term "hydrophobic amino acid" may refer to one of Ile (I), Val (V), Leu (L), and Phe (F).
[0039] As used herein, the term "non-hydrophobic amino acid" is intended to mean an amino acid that is hydrophilic (or not hydrophobic) on one of the above-identified hydrophobicity scales. This term generally refers to those amino acids that contribute to a hydrophilic hydropathy index for either the peptide as a whole or the added hydrophilic amino acid sequence.
[0040] In one aspect of the invention, the peptide includes the amino acid sequence of: (i) L-X-X-L-L-L-X-(F / L)-(I / L)-X-X-X-L (SEQ ID NO: 2), wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD, X at position 3 is optional and, when present, is Gln (Q); and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate.
[0041] In a related aspect of the invention, the peptide includes the amino acid sequence of SEQ ID NO: 2 (shown above), wherein the peptide is free of cysteine or free of both cysteine and methionine; X at position 3 is optional and, when present, is Gln (Q); and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate.
[0042] According to one embodiment, X at position 3 is not present (i.e., the gap between the first hydrophobic amino acid and the first hydrophobic amino acid triplet is reduced from two to one amino acid residue. In this embodiment, it is contemplated that these peptides exclude the amino acid at only position 3.
[0043] In an alternative embodiment, X at position 3 is present (i.e., the gap between the hydrophobic amino acids is maintained at two amino acid residues).
[0044] The peptide is 12 to 50 amino acids in length.
[0045] X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD and X at position 3 (when present) is Gln (Q).
[0046] X at positions 7, 10, 11, and 12 is selected independently from Ala (A), Met (M), Glu (E) and γ-glutamate.
[0047] In this embodiment, the isolated peptide is stable when dissolved in water; resistant to chemical degradation in aqueous conditions in the presence of a pH buffer and a biocide, as described above; and / or has a solubility in an aqueous solution of at least about 1.0 mg / ml.
[0048] One set of peptides according to the first aspect of the invention have the amino acid sequence of: (Q / E)-(Q / E)-(L / I / V / F)-X-X-(L / I / V / F)-(L / I / V / F)-(L / I / V / F)-X-(L / I / V / F)-(L / I / V / F)-X-X-X-(L / I / V / F)-(D / G / Q / E)-(D / G / Q / E), (SEQ ID NO: 3), wherein X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD, X at position 5 is optional and, when present, Gln (Q); and each X at positions 9, 12, 13, and 14 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate.In one embodiment, X at position 5 is present. In another embodiment, X at position 5 is not present.
[0049] X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD and X at position 5 (when present) is Gln (Q).
[0050] X at positions 9 and 12 to 14 is selected independently from Ala (A), Met (M), Glu (E) and γ-glutamate.
[0051] In certain embodiments, these peptides also meet the structural features defining the peptides of SEQ ID NO: 1, in which case methionine and cysteine residues are not present.
[0052] Another set of peptides according to the first aspect of the invention have the amino acid of: (L / I / V / F)-X-X-(L / I / V / F)-(L / I / V / F)-(L / I / V / F)-X-(L / I / V / F)-(L / I / V / F)-X-X-X-(L / I / V / F)-(D / G / Q / E)-(D / G / Q / E), (SEQ ID NO: 4), wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD, X at position 3 is optional and, when present, is Gln (Q); and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate. In one embodiment, X at position 3 is present. In another embodiment, X at position 3 is not present.
[0053] X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD and X at position 3 (when present) is Gln (Q).
[0054] X at positions 7, 10, 11, and 12 is selected independently from Ala (A), Met (M), Glu (E) and γ-glutamate.
[0055] A further set of peptides according to the first aspect of the invention have the amino acid sequence of: (Q / E)-(Q / E)-(L / I / V / F)-X-X-(L / I / V / F)-(L / I / V / F)-(L / I / V / F)-X-(L / I / V / F)-(L / I / V / F)-X-X-X-(L / I / V / F), (SEQ ID NO: 5), wherein X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD, X at position 5 is optional and, when present, is Gln (Q); and each X at positions 9, 12, 13, and 14 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate.In one embodiment, X at position 5 is present. In another embodiment, X at position 5 is not present.
[0056] X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD and X at position 5 (when present) Gln (Q).
[0057] X at positions 9 and 12 to 14 is selected independently from Ala (A), Met (M), Glu (E) and γ-glutamate.
[0058] Also disclosed is an isolated peptide comprising the amino acid sequence of J-X-X-J-J-J-X-J-J-X-X-X-J (SEQ ID NO: 6) wherein X at position 3 is optional and, when present, is any amino acid; and each X at positions 2, 7, 10, 11, and 12 is any amino acid; one to three of the J residues at positions 1, 4, 5, 6, 8, 9, and 13 is a non-hydrophobic amino acid or A, and all other of the J residues are L, I, V, or F, and the peptide induces an active plant response, but does not induce a hypersensitive response, when applied to plant tissue. These active plant responses afford one or more of the following attributes: modified biochemical signaling; enhanced growth; pathogen resistance; and / or biotic or abiotic stress resistance.
[0059] In the embodiments described above, where X at each of positions 2, 3 (when present), 7, 10, 11, and 12 of SEQ ID NO: 6 can be any amino acid, in certain embodiments these residues are hydrophilic in nature. As described above, these hydrophilic amino acids include Arg (R), Lys (K), Asp (D), Glu (E), Gln (Q), Asn (N), His (H), Ser (S), Thr (T), Gly (G), Pro (P), Tyr (Y), and Trp (W). Of these, Asp (D), Glu (E), Gln (Q), Asn (N) or their variants are preferred. Exemplary variants include g-glutamate for Glu and isoaspartic acid (or isoD) for Asp.
[0060] In certain embodiments, X at positions 2 and 3 (when present) is selected independently from Asp (D), Glu (E), and Gln (Q).
[0061] In certain embodiments, X at positions 7, 10, 11, and 12 is selected independently from Ala (A), Met (M), Gly (G), Ser (S), and Glu (E).
[0062] In this embodiment, the isolated peptide is stable when dissolved in water; resistant to chemical degradation in aqueous conditions in the presence of a pH buffer and a biocide, as described above; and / or has a solubility in an aqueous solution of at least about 1.0 mg / ml.
[0063] Exemplary peptides that meet the consensus structure of one or more of SEQ ID NO: 1 to 6 are identified in Table 1 and Table 2 below: Table 1: Peptide Variants of Peptide P5 / P5A (SEQ ID NOS: 8 and 9) Peptide Name Sequence SEQ ID NO: wildtypeSAGSEQQLDQLLAMFIMMMLQQ7P5SAGSEQQLDLLLMFIMMMLQQ8P5ASAGSEQQLDQLLLMFIMMMLQQ9P5-2SAGSEQQLDLLLMFIAAALQQ10P5-3SAGSEQQLDLLLAFIAAALQQ11P5-4SAGSEQQLELLLAFIAAALQQ12P5-7SEEEEELDLLLAFIAAAL13P5-8SEEEEELDLLLAFIAAALQQ14P5-9LDLLLAFIAAALEEEEEE15P5-10LDLLLAFIEEELEEEE16P5-11SEEELDLLLAFIAAALEE17P5-12SEEELDLLLAFIEEELEE18P5-13SEEELDLLLAFIAAALDD19P5-14SEEEEELDLLLAFIAAALGG20P5-1000SEEEEEEELDLLLAFIAAALAA21P5-1001SEEEEEELDLLLAFIAAALSS22P5-1002SAGSEQQLDLLLGFIGGGLQQ23P5-1003SAGSEQQLDLLLSFISSSLQQ24P5-15SEEEEELDLLLAFIAAALQ25P5-16SEEEEELDLLLAFIAAALS26P5-17SEEEEELDLLLAFIAAALA27P5-18SEEEEELDLLLAFIAAALE28P5-19SELELLLAFIAAALEEEEE29P5-22SEEELELLLAFIAAALEEEE30P5-1004SELDLLLAFIAAALEEEEE31P5-1005SEEEEELDLLLALIAAALQQ32P5-21SEEQLELLLAFIAAALQQEE33P5-26SEEQLDLLLAFIAAALQEE34P5-1006SELELLLAFIEEELEE35P5-20SELELLLEFIEEELEE36P5-1007SELELLLEFIEEELE37P5-1008SELELLLELIEEELE38P5-48SEEQLDLLLEFIEEELQQEE39P5-1009SELDLLLAFIDDDLEEEEE40P5-29SEEELDLLLMFIMMMLEE42P5-31SEEEQLDLLLMFIMMMLEE43P5-33SEEEQLDLLLMFIMMMLQEE44P5-47SEEQLDLLLMFIMMMLQQEE45P5-1010LELLLEFIEEELE46P5-1011LELLLEFIEEELEE47P5-1012SELELLLEFIEEEL48P5A variantLDQLLLMFIMMMLQQ49P5-23SEEEEELDQLLLAFIAAALQQ50P5-24SEEEEELDQLLLAFIAAAL51P5-25SEEEEQLDQLLLAFIAAALQQ52P5-27SEEQLDQLLLAFIAAALQEE53P5-28SEEQLDQLLLAFIAAALEE54P5-30SEEELDQLLLMFIMMMLEE55P5-32SEEEQLDQLLLMFIMMMLEE56P5-34SEEEQLDQLLLMFIMMMLQEE57P5-46SEEQLDQLLLMFIMMMLQQEE58P5A variant M to ALDQLLLA FIAAA LQQ59P5A variant M to ELDQLLLE FIEEE LQQ60P5A variantQLDQLLLMFIMMMLQQ61P5A variant M to AQLDQLLLA FIAAA LQQ62P5A variant M to EQLDQLLLE FIEEE LQQ63P5A variantQQLDQLLLMFIMMMLQQ64P5A variant M to AQQLDQLLLA FIAAA LQQ65P5A variant M to EQQLDQLLLE FIEEE LQQ66P5A variantLDQLLLMFIMMML67P5A variant M to ALDQLLLAFIAAA L68P5A variant M to ELDQLLLEFIEEE L69P5A variant Q to ESAGSEEE LDQ LLLMFIMMMLEE 70P5 variant Q to ESAGSEEE LDLLLMFIMMMLEE 41P5 mut 8E P5-35SAGSEQQE DLLLMFIMMMLQQ71P5 mut 10E P5-36SAGSEQQLDE LLMFIMMMLQQ72P5 mut 11E P5-37SAGSEQQLDLE LMFIMMMLQQ73P5 mut 12E P5-38SAGSEQQLDLLE MFIMMMLQQ74P5 mut 13E P5-39SAGSEQQLDLLLE FIMMMLQQ75P5 mut 14E P5-40SAGSEQQLDLLLME IMMMLQQ76P5 mut 15E P5-41SAGSEQQLDLLLMFE MMMLQQ77P5 mut 16E P5-42SAGSEQQLDLLLMFIE MMLQQ78P5 mut 17E P5-43SAGSEQQLDLLLMFIME MLQQ79P5 mut 18E P5-44SAGSEQQLDLLLMFIMME LQQ80P5 mut 19E P5-45SAGSEQQLDLLLMFIMMME QQ81P5 mut 9KSAGSEQQLK LLLMFIMMMLQQ82P5 SS mutSAGSESS LDLLLMFIMMMLQQ83P5 SS mutSAGSEQQLDLLLMFIMMMLSS 84P5 GG mutSAGSEGG LDLLLMFIMMMLQQ85P5 GG mutSAGSEQQLDLLLMFIMMMLGG 86P5 single mut 8VSAGSEQQV DLLLMFIMMMLQQ87P5 single mut 10VSAGSEQQLDV LLMFIMMMLQQ88P5 single mut 11VSAGSEQQLDLV LMFIMMMLQQ89P5 single mut 12VSAGSEQQLDLLV MFIMMMLQQ90P5 single mut 13VSAGSEQQLDLLLV FIMMMLQQ91P5 single mut 14VSAGSEQQLDLLLMV IMMMLQQ92P5 single mut 15VSAGSEQQLDLLLMFV MMMLQQ93P5 single mut 16VSAGSEQQLDLLLMFIV MMLQQ94P5 single mut 17VSAGSEQQLDLLLMFIMV MLQQ95P5 single mut 18VSAGSEQQLDLLLMFIMMV LQQ96P5 single mut 19VSAGSEQQLDLLLMFIMMMV QQ97P5A single mut 8E, P5-53SAGSEQQE DQLLLMFMMMLQQ98P5A single mut 11E, P5-54SAGSEQQLDQE LLMFIMMMLQQ99P5A single mut 12ESAGSEQQLDQLE LMFIMMMLQQ100P5A single mut 13ESAGSEQQLDQLLE MFIMMMLQQ101P5A single mut 14ESAGSEQQLDQLLLE FIMMMLQQ102P5A single mut 15ESAGSEQQLDQLLLME IMMMLQQ103P5A single mut 16ESAGSEQQLDQLLLMFE MMMLQQ104P5A single mut 17ESAGSEQQLDQLLLMFIE MMLQQ105P5A single mut 18ESAGSEQQLDQLLLMFIME MLQQ106P5A single mut 19ESAGSEQQLDQLLLMFIMME LQQ107P5A single mut 20ESAGSEQQLDQLLLMFIMMME QQ108P5A single mut 9KSAGSEQQLK QLLLMFIMMMLQQ109P5A single mut 10ESAGSEQQLDE LLLMFIMMMLQQ110P5A single mut 10SSAGSEQQLDS LLLMFIMMMLQQ111P5A single mut 10ASAGSEQQLDA LLLMFIMMMLQQ112P5A SS mutSAGSESS LDQLLLMFIMMMLQQ113P5A SS mutSAGSEQQLDQLLLMFIMMMLSS 114P5A GG mutSAGSEGG LDQLLLMFIMMMLQQ115P5A GG mutSAGSEQQLDQLLLMFIMMMLGG 116P5A single mut 8VSAGSEQQV DQLLLMFIMMMLQQ117P5A single mut11VSAGSEQQLDQV LLMFIMMMLQQ118P5A single mut 12VSAGSEQQLDQLV LMFIMMMLQQ119P5A single mut 13VSAGSEQQLDQLLV MFIMMMLQQ120P5A single mut 14VSAGSEQQLDQLLLV FIMMMLQQ121P5A single mut 15VSAGSEQQLDQLLLMV IMMMLQQ122P5A single mut 16VSAGSEQQLDQLLLMFV MMMLQQ123P5A single mut 17VSAGSEQQLDQLLLMFIV MMLQQ124P5A single mut 18VSAGSEQQLDQLLLMFIMV MLQQ125P5A single mut 19VSAGSEQQLDQLLLMFIMMV LQQ126P5A single mut 20VSAGSEQQLDQLLLMFIMMMV QQ127P5-1013SAGSEQQLDQLLLMFIMMML128P5-1014QQLDQLLLMFIMMML129P5-55SAGSEQQLDQLLLAFIAAALQQ130P5-1015SAGSEQQLDQLLLEFIEEELQQ131P5-1016QQLDLLLMFIMMMLQQ132P5-1017LDLLLMFIMMMLQQ133P5-1018SAGSEQQLDLLLMFIMMML134P5-1019QQLDLLLMFIIMMML135P5-1020LDLLLMFIMMML136P5-1021SAGSEQQLDLLLEFIEEELQQ137Cleavable tag seqHHHHHHRQQLDLLLAFIAAALQQ138P5-5QLELLLAFIAAALQQ139P5-6SAGSEQQLDLLLAFIAAAL140P5-49SAGSEQQE DLLLAFIAAALQQ510P5-50SAGSEQQLDE LLAFIAAALQQ511P5-51SAGSEQQEDELLAFIAAALQQ512P5-52SAGSEQQE DE LLMFIMMMLQQ513P5-56SEEQE ELLLAFIAAALQQEE514P5-57SEEQLEE LLAFIAAALQQEE515P5-58SEEQE EELLAFIAAALQQEE516P5-59, P5-RSAGSEQQLDLLLMFIMMMLQQR517P5-60, P5-21-RSEEQLELLLAFIAAALQQEER518P5-61SAGSEQQE DLLLAFIALQQ519P5-62SAGSEQQLDE LLAFIALQQ520P5-63SAGSEQQLDLLLE FIALQQ521P5-64SAGSEQQLDLLLAE IALQQ522P5-65SAGSEQQLDLLLAFIE ALQQ523P5-66SAGSEQQLDLLLAFIAE ALQQ524P5-67SAGSEQQLDLLLAFIE AALQQ525P5-68SAGSEQQLDLLLAFIAAE LQQ526P5-69SAGSEQQLDLLLAE IAAALQQ527P5-70SAGSEQQLDLLLE FIAAALQQ528P5-71SAGSEQQE DLLLAFIAAALQQ529P5-72SAGSEQQLDE LLAFIAAALQQ530P5-73SQAGSE QLDLLLMFIMMMLQQ531P5-74AEQGSS QLDLLLMFIMMMLQQ532P5-75NQGISEKQQLDLLLMFIMMMLQQ533P5-76NQGISEKQQLDLLLAFIAAALQQ534P5-77535P5-78536P5-79537P5-80538P5-87SEEQLD LLLAFIAAALQQEE539P5-88SEEQLE LLLAFIAAALQEE540P5-89SAGSEEELDLLLMFIMMMLQQ541P5-90SAGSEQQLDLLLMFIMMMLEE542P5-91SEEQQLDLLLMFIMMMLQQEE543P5-92SEEEEQLDQLLLAFIAAALQQR544P5-1022QLEQLLAFIAAALQQ545P5-1023QLDLLLAFIAAALQQ546 Select peptides in Table 1 include N- or C-terminal solubility tags, indicated by italic print, including SEEEEEEE, SEEEEEE, SEEEEE, SEEEE, SEEE, SEE, EE, EE, and EEE. Peptides comprising the sequences shown in Table 1 but lacking these specific solubility tags (or having a different solubility tag) are also contemplated herein. Table 2: Peptide Variants of Peptide P5 / P5A (SEQ ID NOS: 8 and 9) P5 / P5A Core / Core Variants SEQ ID NO: LDLLLMFIMMML136LDQLLLMFIMMML67LDLLL (A / E) FIMMML141LDLLLMFI(A / E)MML142LDLLLMFIM (A / E) ML143LDLLLMFIMM (A / E) L144LDLLL (A / E) FI (A / E) MML145LDLLL (A / E) FIM (A / E) ML146LDLLL (A / E) FIMM (A / E) L147LDLLLMFI (A / E) (A / E) ML148LDLLLMFI (A / E) M (A / E) L149LDLLLMFIM (A / E) (A / E) L150LDLLLMFI (A / E) (A / E) (A / E) L151LDLLL (A / E) FIM (A / E) (A / E) L152LDLLL (A / E) FI (A / E) M (A / E) L153LDLLL (A / E) FI (A / E) (A / E) ML154LDLLL (A / E) FI (A / E) (A / E) (A / E) L155LDQLLL (A / E) FIMMML156LDQLLLMFI(A / E)MML157LDQLLLMFIM (A / E) ML158LDQLLLMFIMM (A / E) L159LDQLLL (A / E) FI (A / E) MML160LDQLLL (A / E) FIM (A / E) ML161LDQLLL (A / E) FIMM (A / E) L162LDQLLLMFI (A / E) (A / E) ML163LDQLLLMFI (A / E) M (A / E) L164LDQLLLMFIM (A / E) (A / E) L165LDQLLLMFI (A / E) (A / E) (A / E) L166LDQLLL (A / E) FIM (A / E) (A / E)L167LDQLLL (A / E) FI (A / E) M ( A / E)L168LDQLLL (A / E) FI (A / E) (A / E)ML169LDQLLL (A / E) FI (A / E) (A / E) (A / E)L170(E / V) DLLLMFIMMML171(E / V)DLLL (A / E) FIMMML172(E / V)DLLLMFI (A / E) MML173(E / V) DLLLMFIM (A / E) ML174(E / V) DLLLMFIMM (A / E) L175(E / V) DLLL (A / E) FI (A / E) MML176(E / V) DLLL (A / E) FIM (A / E) ML177(E / V) DLLL (A / E) FIMM (A / E) L178(E / V) DLLLMFI (A / E) (A / E)ML179(E / V) DLLLMFI (A / E) M (A / E) L180(E / V) DLLLMFIM (A / E) (A / E) L181(E / V)DLLLMFI(A / E) (A / E) (A / E)L182(E / V) DLLL (A / E) FIM (A / E) (A / E)L183(E / V) DLLL (A / E) FI (A / E) M (A / E) L184(E / V)DLLL(A / E)FI(A / E)M(A / E)ML185(E / V)DLLL(A / E)FI(A / E) (A / E) (A / E)L186(E / V) DQLLLMFIMMML187(E / V) DQLLL (A / E) FIMMML188(E / V)DQLLLMFI (A / E) MML189(E / V) DQLLLMFIM (A / E) ML190(E / V) DQLLLMFIMM (A / E) L191(E / V) DQLLL (A / E) FI (A / E) MML192(E / V) DQLLL (A / E) FIM (A / E) ML193(E / V) DQLLL (A / E) FIMM (A / E) L194(E / V) DQLLLMFI (A / E) (A / E)ML195(E / V) DQLLLMFI (A / E) M (A / E) L196(E / V) DQLLLMFIM (A / E) (A / E) L197(E / V)DQLLLMFI (A / E) (A / E) (A / E) L198(E / V)DQLLL(A / E)FIM(A / E) (A / E)L199(E / V) DQLLL (A / E) FI (A / E) M (A / E) L200(E / V)DQLLL(A / E)FI(A / E) (A / E)ML201(E / V)DQLLL(A / E)FI(A / E) (A / E) (A / E)L202LD (E / V) LLMFIMMML203LD(E / V)LL (A / E) FIMMML204LD (E / V) LLMFI (A / E) MML205LD (E / V) LLMFIM (A / E) ML206LD (E / V) LLMFIMM (A / E) L207LD (E / V) LL (A / E) FI (A / E) MML208LD (E / V) LL (A / E) FIM (A / E) ML209LD (E / V) LL (A / E) FIMM (A / E) L210LD (A / E)ML211LD (E / V) LLMFI (A / E) M (A / E) L212LD (E / V) LLMFIM (A / E) (A / E) L213LD(E / V)LLMFI(A / E) (A / E) (A / E)L214LD(E / V)LL(A / E)FIM(A / E) (A / E)L215LD(E / V)LL(A / E)FI(A / E)M(A / E)L216LD(E / V)LL(A / E)FI(A / E) (A / E)ML217LD(E / V)LL(A / E)FI(A / E) (A / E) (A / E)L218LDQ (E / V) LLMFIMMML219LDQ (E / V)LL (A / E) FIMMML220LDQ (E / V) LLMFI (A / E) MML221LDQ (E / V) LLMFIM (A / E) ML222LDQ (E / V) LLMFIMM (A / E) L223LDQ (E / V) LL (A / E) FI (A / E) MML224LDQ (E / V) LL (A / E) FIM (A / E) ML225LDQ (E / V) LL (A / E) FIMM (A / E) L226LDQ (E / V) LLMFI (A / E) (A / E)ML227LDQ (E / V) LLMFI (A / E) M (A / E) L228LDQ (E / V) LLMFIM (A / E) (A / E) L229LDQ (E / V) LLMFI (A / E) (A / E) (A / E)L230LDQ (E / V) LL (A / E) FIM (A / E) (A / E) L231LDQ (E / V) LL (A / E) FI (A / E) M (A / E) L232LDQ(E / V)LL(A / E)FI(A / E) (A / E)ML233LDQ(E / V)LL(A / E)FI(A / E) (A / E) (A / E)L234LDL (E / V) LMFIMMML235LDL (E / V) L (A / E) FIMMML236LDL (E / V) LMFI (A / E) MML237LDL (E / V) LMFIM (A / E) ML238LDL (E / V) LMFIMM (A / E) L239LDL (E / V) L (A / E) FI (A / E) MML240LDL (E / V) L (A / E) FIM (A / E) ML241LDL (E / V) L (A / E) FIMM (A / E) L242LDL (E / V) LMFI (A / E) (A / E)ML243LDL (E / V) LMFI (A / E) M (A / E) L244LDL (E / V) LMFIM (A / E) (A / E) L245LDL (E / V) LMFI (A / E) (A / E) (A / E)L246LDL (E / V) LL (A / E) FIM (A / E) (A / E)L247LDL(E / V)LL(A / E)FI(A / E)M(A / E)L248LDL (E / V) LL (A / E) FI (A / E) (A / E)ML249LDL(E / V)L(A / E)FI(A / E) (A / E) (A / E)L250LDQL (E / V) LMFIMMML251LDQL (E / V) L (A / E) FIMMML252LDQL (E / V) LMFI (A / E) MML253LDQL (E / V) LMFIM (A / E) ML254LDQL (E / V) LMFIMM (A / E) L255LDQL (E / V) L (A / E) FI (A / E) MML256LDQL (E / V) L (A / E) FIM (A / E) ML257LDQL (E / V) L (A / E) FIMM (A / E) L258LDQL (E / V) LMFI (A / E) (A / E)ML259LDQL (E / V) LMFI (A / E) M (A / E) L260LDQL (E / V) LMFIM (A / E) (A / E)L261LDQL (E / V) LMFI (A / E) (A / E) (A / E)L262LDQL (E / V) LL (A / E) FIM (A / E) (A / E)L263LDQL(E / V)LL(A / E)FI(A / E)M(A / E)L264LDQL(E / V)LL(A / E)FI(A / E) (A / E)ML265LDQL (E / V) L (A / E) FI (A / E) (A / E) (A / E)L266LDLL(E / V)MFIMMML267LDLL(E / V) (A / E) FIMMML268LDLL (E / V) MFI (A / E) MML269LDLL (E / V) MFIM (A / E) ML270LDLL (E / V) MFIMM (A / E) L271LDLL(E / V) (A / E)FI(A / E)MML272LDLL(E / V) (A / E) FIM (A / E) ML273LDLL(E / V) (A / E) FIMM (A / E) L274LDLL (E / V) MFI (A / E) (A / E)ML275LDLL (E / V) MFI (A / E) M (A / E) L276LDLL(E / V)MFIM(A / E) (A / E)L277LDLL (E / V) MFI (A / E) (A / E) (A / E)L278LDLL (E / V) LL (A / E) FIM (A / E) (A / E)L279LDLL (E / V) LL (A / E) FI (A / E) M (A / E) L280LDLL(E / V)LL(A / E)FI(A / E) (A / E)ML281LDLL(E / V) (A / E)FI(A / E) (A / E) (A / E)L282LDQLL (E / V) MFIMMML283LDQLL(E / V) (A / E)FIMMML284LDQLL (E / V) MFI (A / E) MML285LDQLL (E / V) MFIM (A / E) ML286LDQLL (E / V) MFIMM (A / E) L287LDQLL (E / V) (A / E) FI (A / E) MML288LDQLL(E / V) (A / E) FIM (A / E) ML289LDQLL(E / V) (A / E) FIMM (A / E) L290LDQLL (E / V) MFI (A / E) (A / E)ML291LDQLL (E / V) MFI (A / E) M (A / E) L292LDQLL(E / V)MFIM(A / E) (A / E)L293LDQLL (E / V) MFI (A / E) (A / E) (A / E)L294LDQLL (E / V) LL (A / E) FIM (A / E) (A / E)L295LDQLL (E / V) LL (A / E) FI (A / E) M (A / E) L296LDQLL (E / V) LL (A / E) FI (A / E) (A / E)ML297LDQLL(E / V) (A / E)FI(A / E) (A / E) (A / E)L298LDLLL (E / V) FIMMML299LDLLL (E / V) FI (A / E) MML300LDLLL (E / V) FIM (A / E) ML301LDLLL (E / V) FIMM (A / E) L302LDLLL(E / V)FI(A / E) (A / E)ML303LDLLL (E / V) FI (A / E) M (A / E) L304LDLLL(E / V)FIM(A / E) (A / E)L305LDLLL(E / V)FI(A / E) (A / E) (A / E)L306LDQLLL (E / V) FIMMML307LDQLLL (E / V) FI (A / E) MML308LDQLLL (E / V) FIM (A / E) ML309LDQLLL (E / V) FIMM (A / E) L310LDQLLL(E / V)FI(A / E) (A / E)ML311LDQLLL (E / V) FI (A / E) M (A / E) L312LDQLLL (E / V) FIM (A / E) (A / E) L313LDQLLL (E / V) FI (A / E) (A / E) (A / E) L314LDLLLM (E / V) IMMML315LDLLL(A / E) (E / V) IMMML316LDLLLM (E / V) I (A / E) MML317LDLLLM (E / V) IM (A / E) ML318LDLLLM (E / V) IMM (A / E) L319LDLLL(A / E) (E / V) I (A / E)MML320LDLLL (A / E) (E / V) IM (A / E) ML321LDLLL (A / E) (E / V) IMM (A / E) L322LDLLLM (E / V) I (A / E) (A / E)ML323LDLLLM (E / V) I (A / E) M (A / E) L324LDLLLM (E / V) IM (A / E) (A / E) L325LDLLL(A / E) (E / V) IM (A / E) (A / E)L326LDLLL (A / E) (E / V) I (A / E) M (A / E) L327LDLLL(A / E) (E / V) I (A / E) (A / E)ML328LDLLLM (E / V) I (A / E) (A / E) (A / E) L329LDQLLLM (E / V) IMMML330LDQLLL (A / E) (E / V)IMMML331LDQLLLM (E / V) I (A / E) MML332LDQLLLM (E / V) IM (A / E) ML333LDQLLLM (E / V) IMM (A / E) L334LDQLLL(A / E) (E / V) I (A / E)MML335LDQLLL (A / E) (E / V) IM (A / E) ML336LDQLLL (A / E) (E / V) IMM (A / E) L337LDQLLLM (E / V) I (A / E) (A / E)ML338LDQLLLM (E / V) I (A / E) M (A / E) L339LDQLLLM (E / V) IM (A / E) (A / E) L340LDQLLL (A / E) (E / V) IM (A / E) (A / E) L341LDQLLL (A / E) (E / V) I (A / E) M (A / E) L342LDQLLL(A / E) (E / V) I (A / E) (A / E)ML343LDQLLLM (E / V) I (A / E) (A / E) (A / E) L344LDLLLMF (E / V) MMML345LDLLL (A / E) F(E / V) MMML346LDLLLMF(E / V) (A / E)MML347LDLLLMF (E / V) M (A / E) ML348LDLLLMF (E / V) MM (A / E) L349LDLLL (A / E) F (E / V) (A / E)MML350LDLLL (A / E) F (E / V) M (A / E) ML351LDLLL (A / E) F (E / V) MM (A / E) L352LDLLLMF(E / V) (A / E) (A / E)ML353LDLLLMF (E / V) (A / E) M (A / E) L354LDLLLMF (E / V) M (A / E) (A / E)L355LDLLLMF(E / V) (A / E) (A / E) (A / E)L356LDLLL (A / E) F (E / V) M (A / E) (A / E) L357LDLLL (A / E) F (E / V) (A / E)M(A / E)L358LDLLL (A / E) F (E / V) (A / E) (A / E)ML359LDLLL(A / E)F(E / V) (A / E) (A / E) (A / E)L360LDQLLLMF (E / V) MMML361LDQLLL (A / E) F (E / V) MMML362LDQLLLMF(E / V) (A / E)MML363LDQLLLMF (E / V) M (A / E) ML364LDQLLLMF (E / V) MM (A / E) L365LDQLLL (A / E) F (E / V) (A / E)MML366LDQLLL (A / E) F (E / V) M (A / E) ML367LDQLLL (A / E) F (E / V) MM (A / E) L368LDQLLLMF(E / V) (A / E) (A / E)ML369LDQLLLMF(E / V) (A / E)M(A / E)L370LDQLLLMF (E / V) M (A / E) (A / E) L371LDQLLLMF(E / V) (A / E) (A / E) (A / E)L372LDQLLL (A / E) F (E / V) M (A / E) (A / E)L373LDQLLL (A / E) F (E / V) (A / E)M(A / E)L374LDQLLL (A / E) F (E / V) (A / E) (A / E)ML375LDQLLL (A / E) F (E / V) (A / E) (A / E) (A / E)L376LDLLLMFI (E / V) MML377LDLLL (A / E) FI (E / V) MML378LDLLLMFI(E / V) (A / E)ML379LDLLLMFI (E / V) M (A / E) L380LDLLL (A / E) FI (E / V) (A / E)ML381LDLLL (A / E) FI (E / V) (A / E)ML382LDLLL (A / E) FI (E / V) M (A / E) L383LDLLLMFI(E / V) (A / E) (A / E)L384LDLLL (A / E) FI (E / V) (A / E) (A / E)L385LDQLLLMFI (E / V) MML386LDQLLL (A / E) FI (E / V) MML387LDQLLLMFI(E / V) (A / E)ML388LDQLLLMFI (E / V) M (A / E) L389LDQLLL (A / E) FI (E / V) (A / E)ML390LDQLLL (A / E) FI (E / V) M (A / E) L391LDQLLLMFI(E / V) (A / E) (A / E)L392LDQLLL (A / E) FI (E / V) (A / E) (A / E)L393LDLLLMFIM (E / V) ML394LDLLL (A / E) FIM (E / V) ML395LDLLLMFIM (E / V) (A / E) L396LDLLLMFI (A / E) (E / V)ML397LDLLL (A / E) FIM (E / V) (A / E) L398LDLLL (A / E) FI (A / E) (E / V)ML399LDLLLMFI(A / E) (E / V) (A / E)L400LDLLL (A / E) FI (A / E) (E / V) (A / E) L401LDQLLLMFIM (E / V) ML402LDQLLL (A / E) FIM (E / V) ML403LDQLLLMFIM (E / V) (A / E) L404LDQLLLMFI(A / E) (E / V)ML405LDQLLL (A / E) FIM (E / V) (A / E)L406LDQLLL (A / E) FI (A / E) (E / V)ML407LDQLLLMFI (A / E) (E / V) (A / E) L408LDQLLL (A / E) FI (A / E) (E / V) (A / E) L409LDLLLMFIMM (E / V) L410LDLLL (A / E) FIMM (E / V) L411LDLLLMFI (A / E) M (E / V) L412LDLLLMFIM (A / E) (E / V) L413LDLLL (A / E) FI (A / E) M (E / V) L414LDLLL (A / E) FIM (A / E) (E / V)L415LDLLLMFI (A / E) (A / E) (E / V) L416LDLLL (A / E) FI (A / E) (A / E) (E / V)L417LDQLLLMFIMM (E / V) L418LDQLLL (A / E) FIMM (E / V) L419LDQLLLMFI (A / E) M (E / V) L420LDQLLLMFIM (A / E) (E / V) L421LDQLLL (A / E) FI (A / E) M (E / V) L422LDQLLL(A / E)FIM(A / E) (E / V)L423LDQLLLMFI (A / E) (A / E) (E / V) L424LDQLLL (A / E) FI (A / E) (A / E) (E / V) L425LDLLLMFIMMM (E / V)426LDLLL (A / E) FIMMM (E / V)427LDLLLMFI (A / E) MM (E / V)428LDLLLMFIM (A / E) M (E / V)429LDLLLMFIMM(A / E) (E / V)430LDLLL (A / E) FI (A / E) MM (E / V)431LDLLL (A / E) FIM (A / E) M (E / V)432LDLLL (A / E) FIMM (A / E) (E / V) (E / V)433LDLLLMFI(A / E) (A / E)M(E / V)434LDLLLMFI (A / E) M (A / E)435LDLLLMFIM (A / E) (A / E) (E / V)436LDLLLMFI (A / E) (A / E) (A / E) (E / V)437LDLLL (A / E) FIM (A / E) (A / E) (E / V)438LDLLL (A / E) FI (A / E) M (A / E) (E / V)439LDLLL (A / E) FI (A / E) (A / E)M(E / V)440LDLLL (A / E) FI (A / E) (A / E) (A / E) (E / V)441LDQLLLMFIMMM (E / V)442LDQLLL (A / E) FIMMM (E / V)443LDQLLLMFI (A / E) MM (E / V)444LDQLLLMFIM (A / E) M (E / V)445LDQLLLMFIMM (A / E) (E / V)446LDQLLL (A / E) FI (A / E) MM (E / V)447LDQLLL (A / E) FIM (A / E) M (E / V)448LDQLLL (A / E) FIMM (A / E) (E / V)449LDQLLLMFI (A / E)450(A / E)M(E / V) LDQLLLMFI (A / E) M (A / E) (E / V)451LDQLLLMFIM (A / E) (A / E) (E / V)452LDQLLLMFI (A / E) (A / E) (A / E) (E / V)453LDQLLL (A / E) FIM (A / E) (A / E) (E / V)454LDQLLL (A / E) FI (A / E) M (A / E) (E / V)455LDQLLL (A / E) FI (A / E) (A / E)M(E / V)456LDQLLL (A / E) FI (A / E) (A / E) (A / E) (E / V)457LKLLLMFIMMML458LKLLL (A / E) FIMMML459LKLLLMFI (A / E) MML460LKLLLMFIM (A / E) ML461LKLLLMFIMM (A / E) L462LKLLL (A / E) FI (A / E)MML463LKLLL (A / E) FIM (A / E) ML464LKLLL (A / E) FIMM (A / E) L465LKLLLMFI (A / E) (A / E) ML466LKLLLMFI (A / E) M (A / E) L467LKLLLMFIM (A / E) (A / E) L468LKLLLMFI (A / E) (A / E) (A / E) L469LKLLL (A / E) FIM (A / E) (A / E) (E / V)470LKLLL (A / E) FI (A / E) M (A / E) (E / V)471LKLLL (A / E) FI (A / E) (A / E)M(E / V)472LKLLL (A / E) FI (A / E) (A / E) (A / E) L473LKQLLLMFIMMML474LKQLLL (A / E) FIMMML475LKQLLLMFI (A / E) MML476LKQLLLMFIM (A / E) ML477LKQLLLMFIMM (A / E) L478LKQLLL (A / E) FI (A / E)MML479LKQLLL (A / E) FIM (A / E) ML480LKQLLL (A / E) FIMM (A / E) L481LKQLLLMFI (A / E) (A / E) ML482LKQLLLMFI (A / E) M (A / E) L483LKQLLLMFIM (A / E) (A / E) L484LKQLLLMFI (A / E) (A / E) (A / E) L485LKQLLL (A / E) FIM (A / E) (A / E) (E / V)486LKQLLL (A / E) FI (A / E) M (A / E) (E / V)487LKQLLL (A / E) FI (A / E) (A / E)M(E / V)488LKQLLL (A / E) FI (A / E) (A / E) (A / E) L489LD (E / S / A) LLLMFIMMML490LD (E / S / A) LLL (A / E) FIMMML491LD (E / S / A) LLLMFI (A / E) MML492LD (E / S / A) LLLMFIM (A / E) ML493LD (E / S / A) LLLMFIMM (A / E) L494LD (E / S / A) LLL (A / E) FI (A / E) MML495LD(E / S / A)LLL(A / E)FIM(A / E)ML496LD (E / S / A) LLL (A / E) FIMM (A / E) L497LD (E / S / A) LLLMFI (A / E) (A / E) ML498LD (E / S / A) LLLMFI (A / E) M (A / E) L499LD (E / S / A) LLLMFIM (A / E) (A / E) L500LD (E / S / A) LLLMFI (A / E) (A / E) (A / E) L501LD (E / S / A) LLL (A / E) FIM (A / E) (A / E) L502LD (E / S / A) LLL (A / E) FI (A / E) M (A / E) L503LD (E / S / A) LLL (A / E) FI (A / E) (A / E)ML504LD (E / S / A) LLL (A / E) FI (A / E) (A / E) (A / E) L505
[0064] In certain embodiments, the peptide includes one or more mutations relative to the corresponding wildtype amino acid sequence of SAGSEQQLDQLLAMFIMMMLQQ (SEQ ID NO: 7), which corresponds to amino acid residues 33-54 of the HreX protein of Xanthomonas campestris pv. pelargonii (see U.S. Pat. No. 6,960,705). These one or more mutations include, in addition to truncation of the full length, 114 aa HreX protein at both its N-terminal and C-terminal ends, one or more deletions or substitutions relative to SEQ ID NO: 7. In certain embodiments, the one or more mutations improve the solubility in aqueous solution, stability, and / or resistance to chemical degradation of the isolated peptide relative to a polypeptide comprising or consisting of the corresponding wildtype amino acid sequence of SEQ ID NO:7. In this embodiment, the isolated peptide is stable when dissolved in water; resistant to chemical degradation in aqueous conditions in the presence of a pH buffer and a biocide, as described above; and / or has a solubility in an aqueous solution of at least about 1.0 mg / ml. In alternative embodiments, the one or more mutations disrupt the sequence of one or more of the hydrophobic residues, and thereby alter the activity of the peptide. For instance, in some embodiments, peptides will no longer induce a hypersensitive response, but they will induce other active plant responses including those described herein.
[0065] The isolated peptides of the invention can also be presented in the form of a fusion peptide that includes, in addition, a second amino acid sequence coupled to the inventive peptides via peptide bond. The second amino acid sequence can be a purification tag, such as poly-histidine (His 6 -), a glutathione-S-transferase (GST-), or maltose-binding protein (MBP-), which assists in the purification but can later be removed, i.e., cleaved from the peptide following recovery. Protease-specific cleavage sites or chemical-specific cleavage sites (i.e., in a cleavable linker sequence) can be introduced between the purification tag and the desired peptide. Protease-specific cleavage sites are well known in the literature and include, without limitation, the enterokinase specific cleavage site (Asp) 4 -Lys (SEQ ID NO: 547), which is cleaved after lysine; the factor Xa specific cleavage site Ile-(Glu or Asp)-Gly-Arg (SEQ ID NO: 548), which is cleaved after arginine; the trypsin specific cleavage site, which cleaves after Lys and Arg; and the Genenase ™< I specific cleavage site Pro-Gly-Ala-Ala-His-Tyr (SEQ ID NO: 549). Chemicals and their specific cleavage sites include, without limitation, cyanogen bromide (CNBr), which cleaves at methionine (Met) residues; BNPS-skatole, which cleaves at tryptophan (Trp) residues; formic acid, which cleaves at aspartic acid-proline (Asp-Pro) peptide bonds; hydroxylamine, which cleaves at asparagine-glycine (Asn-Gly) peptide bonds; and 2-nitro-5-thiocyanobenzoic acid (NTCB), which cleaves at cysteine (Cys) residues (see Crimmins et al., "Chemical Cleavage of Proteins in Solution," Curr. Protocol. Protein Sci., Chapter 11:Unit 11.4 (2005)). In order to use one of these cleavage methods, it may be necessary to remove unwanted cleavage sites from within the desired peptide sequences by mutation. For example, P5-3 is a mutant sequence derived from P5 with the methionine residues mutated to alanine. Peptides comprising this sequence can be produced by cyanogen bromide-mediated cleavage of a tandem repeated sequence of P5-3 separated by methionine residues.
[0066] The isolated peptides of the invention can also be presented in the form of a fusion peptide that includes multiple peptide sequences of the present invention linked together by a linker sequence, which may or may not take the form of a cleavable amino acid sequence of the type described above. Such multimeric fusion proteins may or may not include purification tags. In one embodiment, each monomeric sequence can include a purification tag linked to a peptide of the invention by a first cleavable peptide sequence; and the several monomeric sequences can be linked to adjacent monomeric sequences by a second cleavable peptide sequence. Consequently, upon expression of the multimeric fusion protein, i.e., in a host cell, the recovered fusion protein can be treated with a protease or chemical that is effective to cleave the second cleavable peptide sequence, thereby releasing individual monomeric peptide sequences containing purification tags. Upon affinity purification, the recovered monomeric peptide sequences can be treated with a protease or chemical that is effective to cleave the first cleavable peptide sequence and thereby release the purification tag from the peptide of interest. The latter can be further purified using gel filtration and / or HPLC as described infra.
[0067] According to one approach, the peptides of the present invention can be synthesized by standard peptide synthesis operations. These include both FMOC (9-fluorenylmethyloxy-carbonyl) and tBoc (tert-butyloxy-carbonyl) synthesis protocols that can be carried out on automated solid phase peptide synthesis instruments including, without limitation, the Applied Biosystems 431A, 433A synthesizers and Peptide Technologies Symphony or large scale Sonata or CEM Liberty automated solid phase peptide synthesizers. The use of alternative peptide synthesis instruments is also contemplated. Peptides prepared using solid phase synthesis are recovered in a substantially pure form.
[0068] The peptides of the present invention may be also prepared by using recombinant expression systems followed by separation and purification of the recombinantly prepared peptides. Generally, this involves inserting an encoding nucleic acid molecule into an expression system to which the molecule is heterologous (i.e., not normally present). One or more desired nucleic acid molecules encoding a peptide of the invention may be inserted into the vector. The heterologous nucleic acid molecule is inserted into the expression system or vector in proper sense (5'→3') orientation and correct reading frame relative to the promoter and any other 5' and 3' regulatory molecules.
[0069] Representative nucleotide sequences for expression in representative bacteria and plant hosts are included in Table 3 below: Table 3 Peptide & Optimized Host Nucleotide Sequence SEQ ID NO: P5 in E. coli506P5-21 in E. coli507P5 in Zea mays508P5-21 in Zea mays509 With knowledge of the encoded amino acid sequence listed herein and the desired transgenic organism, additional codon-optimized DNA sequences and RNA sequences can be generated with nothing more than routine skill.
[0070] Expression (including transcription and translation) of a peptide or fusion polypeptide of the invention by the DNA construct may be regulated with respect to the level of expression, the tissue type(s) where expression takes place and / or developmental stage of expression. A number of heterologous regulatory sequences (e.g., promoters and enhancers) are available for controlling the expression of the DNA construct in plants. These include constitutive, inducible and regulatable promoters, as well as promoters and enhancers that control expression in a tissue- or temporal-specific manner. Exemplary constitutive promoters include the raspberry E4 promoter (U.S. Pat. Nos. 5,783,393 and 5,783,394), the nopaline synthase (NOS) promoter (Ebert et al., Proc. Natl. Acad. Sci. (U.S.A.) 84:5745-5749 (1987)), the octopine synthase (OCS) promoter (which is carried on tumor-inducing plasmids of Agrobacterium tumefaciens), the caulimovirus promoters such as the cauliflower mosaic virus (CaMV) 19S promoter (Lawton et al., Plant Mol. Biol. 9:315-324 (1987)) and the CaMV 35S promoter (Odell et al., Nature 313:810-812 (1985)), the figwort mosaic virus 35S-promoter (U.S. Pat. No. 5,378,619), the light-inducible promoter from the small subunit of ribulose-1,5-bis-phosphate carboxylase (ssRUBISCO), the Adh promoter (Walker et al., Proc. Natl. Acad. Sci. (U.S.A.) 84:6624-6628 (1987)), the sucrose synthase promoter (Yang et al., Proc. Natl. Acad. Sci. (U.S.A.) 87:4144-4148 (1990)), the R gene complex promoter (Chandler et al., Plant Cell 1:1175-1183 (1989)), the chlorophyll a / b binding protein gene promoter, the CsVMV promoter (Verdaguer et al., Plant Mol Biol., 37:1055-1067 (1998)), and the melon actin promoter (PCT Publ. No. WO00 / 56863). Exemplary tissue-specific promoters include the tomato E4 and E8 promoters (U.S. Pat. No. 5,859,330) and the tomato 2AII gene promoter (Van Haaren et al., Plant Mol Bio., 21:625-640 (1993)).
[0071] In one preferred embodiment, expression of the DNA construct is under control of regulatory sequences from genes whose expression is associated with early seed and / or embryo development. Indeed, in a preferred embodiment, the promoter used is a seed-enhanced promoter. Examples of such promoters include the 5' regulatory regions from such genes as napin (Kridl et al., Seed Sci. Res. 1:209:219 (19), globulin (Belanger and Kriz, Genet. 129: 863-872 (1991), GenBank Accession No. L22295), gamma zein Z 27 (Lopes et al., Mol Gen Genet. 247:603-613 (1995)), L3 oleosin promoter (U.S. Pat. No. 6,433,252), phaseolin (Bustos et al., Plant Cell 1(9):839-853 (1989)), arcelin5 (U.S. Application Publ. No. 2003 / 0046727), a soybean 7S promoter, a 7Sa promoter (U.S. Application Publ. No. 2003 / 0093828), the soybean 7Sαβ conglycinin promoter, a 7Sα promoter (Beachy et al., EMBO J. 4:3047 (1985); Schuler et al., Nucleic Acid Res. 10(24):8225-8244 (1982)), soybean trypsin inhibitor (Riggs et al., Plant Cell 1(6):609-621 (1989)), ACP (Baerson et al., Plant Mol. Biol., 22(2):255-267 (1993)), stearoyl-ACP desaturase (Slocombe et al., Plant Physiol. 104(4):167-176 (1994)), soybean a' subunit of β-conglycinin (Chen et al., Proc. Natl. Acad. Sci. 83:8560-8564 (1986)), Vicia faba USP (U.S. Application Publ. No. 2003 / 229918) and Zea mays L3 oleosin promoter (Hong et al., Plant Mol. Biol., 34(3):549-555 (1997)).
[0072] Nucleic acid molecules encoding the peptides of the present invention can be prepared via solid-phase synthesis using, e.g., the phosphoramidite method and phosphoramidite building blocks derived from protected 2'-deoxynucleosides. To obtain the desired oligonucleotide, the building blocks are sequentially coupled to the growing oligonucleotide chain in the order required by the sequence of the product. Upon the completion of the chain assembly, the product is released from the solid phase to solution, deprotected, collected, and typically purified using HPLC. The limits of solid phase synthesis are suitable for preparing oligonucleotides up to about 200 nt in length, which encodes peptides on the order of about 65 amino acids or less. The ends of the synthetized oligonucleotide can be designed to include specific restriction enzyme cleavage site to facilitate ligation of the synthesized oligonucleotide into an expression vector.
[0073] For longer peptides, oligonucleotides can be prepared via solid phase synthesis and then the synthetic oligonucleotide sequences ligated together using various techniques. Recombinant techniques for the fabrication of whole synthetic genes are reviewed, for example, in Hughes et al., "Chapter Twelve - Gene Synthesis: Methods and Applications," Methods in Enzymology 498:277-309 (2011).
[0074] Synthetic oligonucleotides of the present invention include both DNA and RNA, in both D and L enantiomeric forms, as well as derivatives thereof (including, but not limited to, 2'-fluoro-, 2'-amino, 2'O-methyl, 5'iodo-, and 5'-bromo-modified polynucleotides). Nucleic acids containing modified nucleotides (Kubik et al., "Isolation and Characterization of 2'fluoro-, 2'amino-, and 2'fluoro-amino-modified RNA Ligands or Human IFN-gamma that Inhibit Receptor Binding," J. Immunol. 159:259-267 (1997); Pagratis et al., "Potent 2'-amino, and 2'-fluoro-2'-deoxy-ribonucleotide RNA Inhibitors of Keratinocyte Growth Factor," Nat. Biotechnol. 15:68-73 (1997)) and the L-nucleic acids (sometimes termed Spiegelmers ®< ), enantiomeric to natural D-nucleic acids (Klussmann et al., "Mirror-image RNA that Binds D-adenosine," Nat. Biotechnol. 14:1112-1115 (1996) and Williams et al., "Bioactive and nuclease-resistant L-DNA Ligand of Vasopressin," Proc. Natl. Acad. Sci. USA 94:11285-11290 (1997)), and non-natural bases are used to enhance biostability. In addition, the sugar-phosphate backbone can be replaced with a peptide backbone, forming a peptide nucleic acid (PNA), other natural or non-natural sugars can be used (e.g., 2'-deoxyribose sugars), or phosphothioate or phosphodithioate can be used instead of phosphodiester bonds. The use of locked nucleic acids (LNA) is also contemplated. These nucleic acid molecules can be used for multiple purposes, including application to plants or plants seeds as naked oligonucleotides or for in vitro translation of encoding oligonucleotides for production of the peptides of the present invention.
[0075] Once a suitable expression vector is selected, the desired nucleic acid sequences are cloned into the vector using standard cloning procedures in the art, as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Springs Laboratory, Cold Springs Harbor, N.Y. (1989), or U.S. Pat. No. 4,237,224 to Cohen and Boyer. The vector is then introduced to a suitable host.
[0076] A variety of host-vector systems may be utilized to recombinantly express the peptides of the present invention. Primarily, the vector system must be compatible with the host used. Host-vector systems include, without limitation, the following: bacteria transformed with bacteriophage DNA, plasmid DNA, or cosmid DNA; microorganisms such as yeast containing yeast vectors; mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); and plant cells infected by Agrobacterium. The expression elements of these vectors vary in their strength and specificities. Depending upon the host-vector system utilized, any one of a number of suitable transcription and translation elements can be used to carry out this and other aspects of the present invention.
[0077] Purified peptides may be obtained by several methods. The peptide is preferably produced in purified form (preferably at least about 80% or 85% pure, more preferably at least about 90% or 95% pure) by conventional techniques. Depending on whether the recombinant host cell is made to secrete the peptide into growth medium (see U.S. Pat. No. 6,596,509 to Bauer et al.), the peptide can be isolated and purified by centrifugation (to separate cellular components from supernatant containing the secreted peptide) followed by sequential ammonium sulfate precipitation of the supernatant. The fraction containing the peptide is subjected to gel filtration in an appropriately sized dextran or polyacrylamide column to separate the peptides from other proteins. If necessary, the peptide fraction may be further purified by HPLC.
[0078] Alternatively, if the peptide of interest of interest is not secreted, it can be isolated from the recombinant cells using standard isolation and purification schemes. This includes disrupting the cells (e.g., by sonication, freezing, French press, etc.) and then recovering the peptide from the cellular debris. Purification can be achieved using the centrifugation, precipitation, and purification procedures described above. The use of purification tags, described above, can simplify this process.
[0079] In certain embodiments, purification is not required. Where purification is not performed, cell-free lysates can be recovered following centrifugation for removal of cellular debris. The resulting cell-free lysate can be treated with heat for a sufficient amount of time to deactivate any native proteases in the recovered fraction, e.g., 10 min at 100°C. If desired, one or more of biocidal agents, protease inhibitors, and non-ionic surfactants can be introduced to such a cell-free preparation (see U.S. Application Publ. No. 20100043095 to Wei).
[0080] Once the peptides of the present invention are recovered, they can be used to prepare a composition that includes a carrier, and one or more additives selected from the group consisting of a bacteriocidal or biocidal agent, a protease inhibitor, a non-ionic surfactant, a fertilizer, an herbicide, an insecticide, a fungicide, a nematicide, biological inoculants, plant regulators, and mixtures thereof.
[0081] In certain embodiments, the compositions include greater than about 1 nM of the peptide, greater than about 10 nM of the peptide, greater than about 20 nM of the peptide, greater than about 30 nM of the peptide, greater than about 40 nM of the peptide, greater than about 50 nM of the peptide, greater than about 60 nM of the peptide, greater than about 70 nM of the peptide, greater than 80 about nM of the peptide, greater than about 90 nM of the peptide, greater than about 100 nM of the peptide, greater than about 150 nM of the peptide, greater than about 200 nM of the peptide, or greater than about 250 nM of the peptide. In certain embodiments, the compositions include less than about 1 nM of the peptide. For example, certain peptides can be present at a concentration of less than about 2 ng / ml, less than about 1.75 ng / ml, less than about 1.5 ng / ml, less than about 1.25 ng / ml, less than about 1.0 ng / ml, less than about 0.75 ng / ml, less than about 0.5 ng / ml, less than about 0.25 ng / ml, or even less than about 0.1 ng / ml.
[0082] Suitable carriers include water, aqueous solutions optionally containing one or more co-solvents, slurries, and solid carrier particles. Exemplary solid carriers include mineral earths such as silicates, silica gels, talc, kaolins, limestone, lime, chalk, bole, loess, clays, dolomite, diatomaceous earth, calcium sulfate, magnesium sulfate, magnesium oxide, ground synthetic materials, and products of vegetable origin, such as cereal meal, tree bark meal, wood meal and nutshell meal, cellulose powders, starches and starch derivatives, as well as other mono-, di-, and poly-saccharides.
[0083] Suitable fertilizers include, without limitation, ammonium sulfate, ammonium phosphate, ammonium nitrate, ureas, and combinations thereof.
[0084] Suitable insecticides include, without limitation, members of the neonicotinoid class such as imidicloprid, clothianidin, and thiamethoxam; members of the organophosphate class such as chlorpyrifos and malathion; members of the pyrethroid class such as permethrin; other natural insecticides such as nicotine, nornicotine, and pyrethrins; members of the carbamate class such as aldicarb, carbofuran, and carbaryl; members of the macrocyclic lactone class such as various abamectin, avermectin, and ivermectin products; members of the diamide class such as chlorantraniliprole, cyantraniliprole, and flubendiamide; chitin synthesis inhibitors, particularly those of the benzoylurea class such as lufenuron and diflubenzuron; and any combination thereof, including combinations of two or more, three or more, or four or more insecticides. Additional insecticides are listed in the Compendium of Pesticide Common Names, which is database operated by Alan Wood and available in electronic form at the alanwood.net internet site.
[0085] Suitable fungicides include, without limitation, members of the strobilurin class such as azoxystrobin, pyraclostrobin, trifloxystrobin, picoxystrobin, and fluoxastrobin; members of the triazole class such as ipconazole, metconazole, tebuconazole, triticonazole, tetraconazole, difenoconazole, flutriafol, propiconazole and prothioconazole; members of the succinate dehydrogenase class such as carboxin, fluxapyroxad, boscalid and sedaxane: members of the phenylamide class such as metalaxyl, mefenoxam, benalaxyl, and oxadiyxl; members of the phenylpyrrole class such as fludioxonil; members of the phthalimide class such as captan; members of the dithiocarbamate class such as mancozeb and thiram; members of the benzimidazole class such as thiabendazole; and any combination thereof, including combinations of two or more, three or more, or four or more fungicides. Additional fungicides are listed in the Compendium of Pesticide Common Names, which is a database operated by Alan Wood and available in electronic form at the alanwood.net internet site.
[0086] Suitable nematicides include, without limitation, chemicals of the carbamate class such as aldicarb, aldoxycarb, oxamyl, carbofuran, and cleothocarb; and chemicals of the organophosphate class such as thionazin, ethoprophos, fenamiphos, fensulfothion, terbufos, isazofos, and ebufos. Additional nematicides are listed in the Compendium of Pesticide Common Names, which is a database operated by Alan Wood and available in electronic form at the alanwood.net internet site.
[0087] Suitable bactericides include, without limitation, those based on dichlorophene and benzylalcohol hemi formal (Proxel ®< from ICI or Acticide ®< RS from Thor Chemie and Kathon ®< MK from Rohm & Haas) and isothiazolinone derivatives such as alkylisothiazolinones and benzisothiazolinones (Acticide ®< MBS from Thor Chemie; Proxel ®< GXL from ICI). Additional bactericides are listed in the Compendium of Pesticide Common Names, which is a database operated by Alan Wood and available in electronic form at the alanwood.net internet site.
[0088] Suitable inoculants include, without limitation, Bradyrhizobium spp., particularly Bradyrhizobium japonicum (BASF Vault ®< products), Bacillus subtilis, Bacillus firmus, Bacillus pumilis, Streptomyces lydicus, Trichoderma spp., Pasteuria spp., other cultures of rhizobial cells (BASF Nodulator ®< and Rhizo-Flo ®< ), and any combination thereof, including combinations of two or more, three or more, or four or more inoculants. The inoculants can be recombinant in nature, as described hereinafter, to facilitate expression and optionally secretion of a polypeptide of the invention. Alternatively, these inoculants can be otherwise commercially available forms that are unable to express / secrete a polypeptide of the invention.
[0089] Plant regulators are chemical substances, whether natural or synthetic, that either stimulate or inhibit plant biochemical signaling. These are usually, but not exclusively, recognized by receptors on the surface of the cell, causing a cascade of reactions in the cell. Suitable plant regulators include, without limitation, ethephon; ethylene; salicylic acid; acetylsalicylic acid; jasmonic acid; methyl jasmonate; methyl dihydrojasmonate; chitin; chitosan; abscisic acid; any auxin compound or inhibitor, including but not limited to (4-chlorophenoxy)acetic acid, (2,4-dichlorophenoxy)acetic acid, and 2,3,5-triiodobenzoic acid; any cytokinin, including but not limited to kinetin and zeatin; gibberellins; brassinolide; and any combination thereof, including combinations of two or more, three or more, or four or more regulators.
[0090] Other suitable additives include buffering agents, wetting agents, coating agents, and abrading agents. These materials can be used to facilitate application of the compositions in accordance with the present invention. In addition, the compositions can be applied to plant seeds with other conventional seed formulation and treatment materials, including clays and polysaccharides.
[0091] Compositions or systems use for plant seed treatment include: one or more of the peptides of the present invention, preferably though not exclusively one of P5, P5-8, P5-21, P5-25, P5-27, P5-35, or P5-46 (SEQ ID NOS: 8, 14, 33, 52, 53, 71, and 58 respectively) in combination with one or more insecticides, nematicides, fungicides, other inoculants, or other plant regulators, including combinations of multiple insecticides, or multiple nematicides, multiple fungicides, multiple other inoculants, or multiple plant regulators. Suitable insecticides, nematicides, fungicides, inoculants, and plant regulators for these combination treatments include those identified above. These compositions are presented in the form of a single composition at the time of seed treatment. In contrast, a system used for seed treatment may involve multiple treatments, e.g., a composition containing the peptides is used in one treatment and a composition containing the one or more insecticides, nematicides, fungicides, plant regulators and / or bactericides, is used in a separate treatment. In the latter embodiment, both of these treatments are carried out at about the same time, i.e., before planting or at about the time of planting.
[0092] One such example includes one or more of peptides of the present invention, including (without limitation) one of P5, P5-8, P5-21, P5-25, P5-27, P5-35, or P5-46 (SEQ ID NOS: 8, 14, 33, 52, 53, 71, and 58 respectively), in combination with Poncho ™< (clothianidin) available from Bayer Crop Science, Poncho ™< VOTiVO (clothianidin and Bacillus firmus biological nematicide) available from Bayer Crop Science, and Gaucho ™< (imidicloprid) available from Bayer Crop Science.
[0093] Another example includes one or more of peptides of the present invention, including (without limitation) one of P5, P5-8, P5-21, P5-25, P5-27, P5-35, or P5-46 (SEQ ID NOS: 8, 14, 33, 52, 53, 71, and 58 respectively), in combination with Cruiser ™< (thiamethoxam) available from Syngenta, CruiserMaxx ™< (thiamethoxam, mefenoxam, and fludioxynil) available from Syngenta, Cruiser Extreme ™< (thiamethoxam, mefenoxam, fludioxynil, and azoxystrobin) available from Syngenta, Avicta ™< (thiamethoxam and abamectin) available from Syngenta, and Avicta ™< Complete (thiamethoxam, abamectin, and Clariva Complete ™< which contains the Pasteuria nishizawae - Pn1 biological inoculant) available from Syngenta, and Avicta Complete ™< Corn (thiamethoxam, mefenoxam, fludioxynil, azoxystrobin, thiabendazole and abamectin) available from Syngenta.
[0094] Another example includes one or more of peptides of the present invention, including (without limitation) one of P5, P5-8, P5-21, P5-25, P5-27, P5-35, or P5-46 (SEQ ID NOS: 8, 14, 33, 52, 53, 71, and 58 respectively), in combination with Vault Liquid plus Integral (Bradyrhizobium species and Bacillus subtilis strain MBI 600 inoculants) available from BASF, Vault NP (Bradyrhizobium japonicum inoculant) available from BASF, and Subtilex NG (Bacillus subtilis biological inoculant) available from BASF.
[0095] As an alternative to using peptides or compositions to apply the peptides of the present invention to plants, the use of beneficial microbes to deliver the peptide to the plant or plant seed, or the locus where the plant seed is planted in soil (and where the mature plant is grown), is also contemplated. Thus, a further aspect of the invention involves the engineering and application of beneficial microbes to produce peptides of the present invention. Beneficial microbes execute a number of useful activities, reviewed in Glick, "Plant Growth-Promoting Bacteria: Mechanisms and Applications," Scientifica, Article ID 963401 (2012). Beneficial microbes can provide nutrition to a plant. This may come in the form of amino acids and other nitrogen-containing compounds through the process of nitrogen fixation. Beneficial microbes may also liberate phosphate from inaccessible mineral deposits in the soil and make these available. For example, bacteria can synthesize siderophores which bind and solubilize inaccessible iron deposits. These iron-siderophore complexes can be absorbed by plants. Microbes can produce analogs of plant signaling hormones which stimulate growth and reduce stress signaling. Finally, beneficial microbes can compete with pathogenic organisms by removing resources including iron as well as synthesis of antibiotic compounds. Beneficial microbes may exhibit other behaviors and are not limited to the behaviors listed above. Beneficial organisms are classified as epiphytic (living on or near the surface of plant tissues) or endophytic (living within plant tissues).
[0096] Suitable beneficial bacterium include, without limitation, Pseudomonas (e.g., P. fluorescens, P. aureofaciens, P. chlororaphis, P. solanacearum, and P. syringae), Sphingomonas (e.g., S. phyllosphaerae, S. roseiflava, S. melonis, S. azotifigens, and S. mali) (see also Innerebner et al., "Protection of Arabidopsis thaliana Against Leaf-Pathogenic Pseudomonas syringae by Sphingomonas Strains in a Controlled Model System," Appl. Environ. Microbiol. 77:3202-3210 (2011)), Bacillus (B. firmus, B. licheniformis, B. megaterium, B. mucilaginous, B. pumilus, B. subtilis, and B. subtilis var. amyloliquefaciens), Streptomyces (e.g., S. griseoviridis and S. lydicus), Rhizobium (e.g., R. meliloti, R. trifolii, R. leguminosarum, R. phaseolin, R. lupine, and R. japonicum), Frankia (e.g., F. alni), and Azospirillum (e.g., A. brasilense and A. lipoferum).
[0097] Additional beneficial bacterium, include, without limitation, Agrobacterium radiobacter, Azotobacter chroococcum, Burkholderia cepacia, Delfitia acidovorans, Paenobacillus macerans, Pantoea agglomerans, and Serratia entomophilia.
[0098] In certain embodiments, the beneficial microbe may be a filamentous fungal host cell. In some embodiments, the host cell may be a cell of a strain that has a history of use for production of proteins that has GRAS status, i.e., a Generally Recognized as Safe, by the FDA.
[0099] In some embodiments, beneficial fungal microbes may be of a strain of Aspergillus niger which include ATCC 22342, ATCC 44733, ATCC 14331, ATCC 11490, NRRL 3112, and strains derived therefrom. In some embodiments, beneficial fungal microbes may be strains of Trichoderma (e.g. T. harzianum, T. viride, T. koningi, T. reesei and T. hamatum) which include functional equivalents of RL-P37 (Sheir-Neiss et al. (1984) Appl. Microbiol. Biotechnology 20:46-53). Other useful beneficial fungal microbes include, without limitation, NRRL 15709, ATCC 13631, ATCC 26921 (QM 9414) ATCC 32098, ATCC 32086, and ATCC 56765 (RUT-30). In some embodiments, beneficial fungal microbes may be strains of non-filamentous fungal yeasts, including, without limitation, strains of Rhodotorula (e.g., R. graminis WP1 and R. mucilaginosa) (see U.S. Pat. No. 8,728,781 and Xin et al., "Characterization of Three Endophytic, Indole-3-Acetic Acid-Producing Yeasts Occurring in Populus Trees," Mycol. Res. 113:973-980 (2009)).
[0100] Peptide expression systems can be created using existing plasmid systems by one skilled in the art. One notable guideline is that regulation of peptide expression should be well controlled. High peptide concentrations detected by the plant will likely trigger an intense immune response with widespread cell death characteristic of the hypersensitive response. In contrast, lower peptide expression levels should stimulate the immunity while minimizing cell death. This effect may be further balanced by careful choice of secretion sequences. Expression of peptides in Pseudomonas fluorescens may be accomplished using the expression strains and tools described by Retallack et al., "Reliable protein production in a Pseudomonas fluorescens expression system," Protein Expression and Purification 81:157-65 (2012). Expression of peptides in Bacillus subtilis can be accomplished through vectors utilizing a subtilisin (aprE) promoter system. This can optionally be augmented using signal peptides to direct secretion of the peptide outside of the microbe. These functions are implemented in the "Bacillus Subtilis Secretory Protein Expression System" manual available from Clontech. Expression of proteins in Streptomyces has been demonstrated using plasmids as described by Fernandez-Abalos et al., "Posttranslational processing of the xylanase Xys1L from Streptomyces halstedii JM8 is carried out by secreted serine proteases," Microbiology 149:1623-32 (2003). Additional peptide expression systems can be produced by one skilled in the art.
[0101] Once engineered microbes are raised, e.g., in a fermentation apparatus, the engineered microbes can be recovered and then provided in either a dry composition or a liquid composition or suspension. For liquid compositions or suspensions, the microbes can be mixed in water, or a buffer solution, and applied as a spray treatment to the plants or the locus where plants are grown. Alternatively, the solution can be used as a seed treatment prior to planting the seeds. For dry compositions, the microbes can be dried with or without inert carrier particles, and the dry composition can be applied to seeds, the locus where seeds will be planted or plants are being grown, or directly to plants.
[0102] Colony forming units (c.f.u.) are used to quantify microbes. 1 c.f.u. of a microbe generates a single colony when spread onto a solid nutrient agar compatible with the organism and corresponds to one healthy, replication competent cell. In a dry powder formulation, the concentration of microbes can exceed 5x10 10< cfu / gram of material. Suitable concentrations for a dry formulation include > 10 11< , >5x10 10< , >10 10< , >10 9< , >10 8< , 10 7< , or >10 6< cfu / gram. Likewise, microbes can be provided as a liquid suspension. Suitable concentrations for a liquid formulation include >10 10< , >10 9< , >10 8< , > 10 7< , >10 6< , >10 5< cfu / ml.
[0103] The present invention further relates to methods of imparting disease resistance to plants, enhancing plant growth, effecting pest control, imparting biotic or abiotic stress tolerance to plants, and / or modulating plant biochemical signaling. According to one embodiment, these methods involve applying an effective amount of an isolated peptide of the invention, or a composition of the invention to a plant or plant seed or the locus where the plant is growing or is expected to grow. As a consequence of such application, the peptide contacts cells of the plant or plant seed, and induces in the plant or a plant grown from the plant seed disease resistance, growth enhancement, tolerance to biotic stress, tolerance to abiotic stress, or altered biochemical signaling. According to an alternative embodiment, the peptide or composition of the invention can be applied to plants such that seeds recovered from such plants themselves are able to impart disease resistance in plants, to enhance plant growth, to affect insect control, to impart tolerance to biotic or abiotic stress, and / or to modulate biochemical signaling, to modulate maturation. According to yet another embodiment, these methods involve applying a recombinant inoculant to the plant seeds or plants, or the locus where the plant is growing or is expected to grow. As a consequence of such application, the recombinant inoculant expresses or secretes a peptide of the invention and the peptide contacts cells of the plant or plant seeds and induces in the plant or a plant grown from the plant seed disease resistance, growth enhancement, tolerance to biotic stress, tolerance to abiotic stress, or altered biochemical signaling.
[0104] In these embodiments, it is also possible to select plants or plant seeds or the locus to which the isolated peptide or composition of the invention is applied. For example, for fields known to contain a high nematode content, the plants or plant seeds to be grown in such fields, or the fields (locus), can be selectively treated by applying the isolated peptide or composition or recombinant inoculant of the invention as described herein; whereas no such treatment may be necessary for plants or plant seeds grown in fields containing low nematode content. Similarly, for fields having reduced irrigation, the plants or plant seeds to be grown in such fields, or the fields (locus), can be selectively treated by applying the isolated peptide or composition or recombinant inoculant of the invention as described herein; whereas no such treatment may be necessary for plants or plant seeds grown in fields having adequate irrigation. Likewise, for fields prone to flooding, the plants or plant seeds to be grown in such fields, or the fields (locus), can be selectively treated by applying the isolated peptide or composition or recombinant inoculant of the invention as described herein; whereas no such treatment may be necessary for plants or plant seeds grown in fields that are not prone to flooding. As yet another example of such selection, for fields prone to insect attack at certain times of the growing season, the plants or plant seeds to be grown in such fields, or the fields (locus), can be selectively treated by applying the isolated peptide or composition of the invention as described herein; whereas the same field may not be treated at ineffective times of the growing season or other fields that are not prone to such attack may go untreated. Such selection steps can be carried out when practicing each of the methods of use described herein, i.e., imparting disease resistance to plants, enhancing plant growth, effecting pest control (including insects and nematodes), imparting biotic or abiotic stress tolerance to plants, and / or modulating plant biochemical signaling.
[0105] As an alternative to applying an isolated peptide or a composition containing the same to plants or plant seeds in order to impart disease resistance in plants, to effect plant growth, to control insects, to impart stress resistance and / or modulated biochemical signaling to the plants or plants grown from the seeds, transgenic plants or plant seeds can be utilized. When utilizing transgenic plants, this involves providing a transgenic plant transformed with a DNA molecule encoding a peptide of the invention and growing the plant under conditions effective to permit that DNA molecule to impart disease resistance to plants, to enhance plant growth, to control insects, to impart tolerance to biotic or abiotic stress, and / or to modulate biochemical signaling. Alternatively, a transgenic plant seed transformed with a DNA molecule encoding a peptide of the invention can be provided and planted in soil. A plant is then propagated from the planted seed under conditions effective to permit that DNA molecule to express the peptide and thereby impart disease resistance to the transgenic plant, to enhance plant growth, to control insects, to impart tolerance to biotic or abiotic stress, and / or to modulate biochemical signaling. This transgenic approach can be used in combination with the recombinant inoculant, or topical application of the isolated peptide or composition.
[0106] Also disclosed are methods of improving desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants. These methods involve applying an effective amount of an isolated peptide of the present invention or a composition according to the present invention to a plant or the locus where the plant is growing. As a consequence of such application, the peptide contacts cells of the plant or plant seed, and induces desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants. Alternatively, an effective amount of an isolated peptide of the present invention or a composition according to the present invention can be applied to a harvested fruit or vegetable. As a consequence of such application, the peptide contacts cells of the harvested fruit or vegetable, and induces post-harvest disease resistance or desiccation resistance to the treated fruit or vegetables, and / or improved longevity of fruit or vegetable ripeness for the treated fruit or vegetables.
[0107] As an alternative to applying an isolated peptide or a composition containing the same to plants or plant seeds in order to induce desiccation resistance to cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants, transgenic plants or plant seeds can be utilized. When utilizing transgenic plants, this involves providing a transgenic plant transformed with a DNA molecule encoding a peptide of the invention and growing the plant under conditions effective to permit that DNA molecule to induce desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from the transgenic plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from the transgenic plants. Alternatively, a transgenic plant seed transformed with a DNA molecule encoding a peptide of the invention can be provided and planted in soil. A plant is then propagated from the planted seed under conditions effective to permit that DNA molecule to express the peptide and thereby induce desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from the transgenic plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from the transgenic plants.
[0108] In these embodiments, it is also possible to select transgenic plants or plant seeds for carrying out the present invention. For example, for fields known to contain a high nematode content, the transgenic plants or plant seeds can be selectively grown in such fields; whereas non-transgenic plants or plant seeds can be grown in fields containing low nematode content. Similarly, for fields having reduced irrigation, the transgenic plants or plant seeds can be selectively grown in such fields; whereas non-transgenic plants or plant seeds can be grown in fields having adequate irrigation. Likewise, for fields prone to flooding, the transgenic plants or plant seeds can be grown in such fields; whereas non-transgenic plants or plant seeds can be grown in fields that are not prone to flooding. As yet another example of such selection, for fields prone to insect attack at certain times of the growing season, the transgenic plants or plant seeds can be selectively grown in such fields; whereas non-transgenic plants or plant seeds can be grown in fields that are not prone to such insect attack. Such selection steps can be carried out when practicing each of the methods of use described herein, i.e., imparting disease resistance to plants, enhancing plant growth, effecting pest control (including insects and nematodes), imparting biotic or abiotic stress tolerance to plants, and / or modulating plant biochemical signaling.
[0109] Also disclosed are methods of improving desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants. These methods involve applying an effective amount of an isolated peptide of the present invention or a composition according to the present invention to a plant or the locus where the plant is growing. As a consequence of such application, the peptide contacts cells of the plant or plant seed, and induces desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants. Alternatively, an effective amount of an isolated peptide of the present invention or a composition according to the present invention can be applied to a harvested fruit or vegetable. As a consequence of such application, the peptide contacts cells of the harvested fruit or vegetable, and induces post-harvest disease resistance or desiccation resistance to the treated fruit or vegetables, and / or improved longevity of fruit or vegetable ripeness for the treated fruit or vegetables.
[0110] In these embodiments, it is also possible to select plants, cuttings, fruits, vegetables, or the locus to which the isolated peptide or composition of the invention is applied. For example, for harvested cuttings or fruit or vegetables that are being shipped great distances or stored for long periods of time, then these can be selectively treated by applying the isolated peptide or composition of the invention as described herein; whereas harvested cuttings or fruit or vegetables that are being shipped locally and intended to be consumed without substantially periods of storage can be excluded from such treatment.
[0111] As an alternative to applying an isolated peptide or a composition containing the same to plants or plant seeds in order to induce desiccation resistance to cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from plants, transgenic plants or plant seeds can be utilized. When utilizing transgenic plants, this involves providing a transgenic plant transformed with a DNA molecule encoding a peptide of the invention and growing the plant under conditions effective to permit that DNA molecule to induce desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from the transgenic plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from the transgenic plants. Alternatively, a transgenic plant seed transformed with a DNA molecule encoding a peptide of the invention can be provided and planted in soil. A plant is then propagated from the planted seed under conditions effective to permit that DNA molecule to express the peptide and thereby induce desiccation resistance for cuttings removed from ornamental plants, post-harvest disease resistance or desiccation resistance to fruit or vegetables harvested from the transgenic plants, and / or improved longevity of fruit or vegetable ripeness for fruit or vegetables harvested from the transgenic plants.
[0112] In these embodiments, it is also possible to select transgenic plants or plant seeds for carrying out the present invention. For example, transgenic plants or plant seeds can be selected for growing when it is known that harvested cuttings or fruit or vegetables are intended to be shipped great distances or stored for long periods of time post-harvest; whereas non-transgenic plants or plant seeds can be selected for growing when it is known that harvested cuttings or fruit or vegetables are intended to be shipped locally and / or consumed without substantially periods of storage.
[0113] Suitable plants include dicots and monocots, including agricultural, silvicultural, ornamental and horticultural plants, whether in a natural or genetically modified form. Exemplary plants include, without limitation, alfalfa, apple, apricot, asparagus, avocados, bananas, barley, beans, beech (Fagus spec.), begonia, birch, blackberry, blueberry, cabbage, camphor, canola, carrot, castor oil plant, cherry, cinnamon, citrus, cocoa bean, coffee, corn, cotton, cucumber, cucurbit, eucalyptus, fir, flax, fodder beet, fuchsia, garlic, geranium, grapes, ground nut, hemp, hop, juneberry, juncea (Brassica juncea), jute, lentil, lettuce, linseed, melon, mustard, nectarine, oak, oats, oil palm, oil-seed rape, olive, onion, paprika, pea, peach, pear, pelargonium, peppers, petunia, pine (Pinus spec.), plum, poplar (Populus spec.), pome fruit, potato, rape, raspberry, rice, rubber tree, rye, sorghum, soybean, spinach, spruce, squash, strawberry, sugar beet, sugar cane, sunflower, tea, teak, tobacco, tomato, triticale, turf, watermelon, wheat and willow (Salix spec.), Arabidopsis thaliana, Saintpaulia, poinsettia, chrysanthemum, carnation, and zinnia.
[0114] With respect to modified biochemical signaling, this includes both enhancement of certain plant biochemical pathways and diminishment of certain other plant biochemical pathways. Biochemical signaling pathways that can be altered in accordance with the present invention include gene expression and protein production, production of metabolites, and production of signaling molecules / secondary metabolites. Exemplary biochemical signaling pathways and their modifications include, without limitation, induction of nitric oxide production, peroxide production, and other secondary metabolites; agonist of the ethylene signaling pathway and induction of ethylene-responsive gene expression (see Dong et al., Plant Phys. 136:3628-3638 (2004); Li et al., Planta 239:831-46 (2014); Chang et al., PLoS One 10,e0125498 (2015)); agonist of the salicylic acid signaling pathway and induction of salicylic acid-responsive gene expression (see Dong et al., Plant J. 20:207-215 (1999)); agonist of the abscisic acid pathway and induction of abscisic acid-responsive gene expression (see Dong et al., Planta 221: 313-327 (2005)); agonist of the gibberellin signaling pathway and induction of gibberellin-responsive gene expression (see Li et al., Planta 239:831-46 (2014)); antagonist of jasmonic acid signaling and inhibiting expression of jasmonic acid-responsive genes (see Dong et al., Plant Phys. 136:3628-3638 (2004)); inducing protease inhibitor expression (see Laluk and Mengiste, Plant J. 68:480-494 (2011); Xia et al., Chin. Sci. Bull 56: 2351-2358 (2011)); inducing reactive oxygen species production in plant tissues; inducing immune-related and antimicrobial peptide production, such as, without limitation, peroxidase, superoxide dismutase, chitinase, and β-1,3-glucanase (Wang et al., J. Agric. Food Chem. 59:12527-12533 (2011)); and inducing expansin gene expression and production (see Li et al., Planta 239:831-46 (2014)).
[0115] With respect to disease resistance, absolute immunity against infection may not be conferred, but the severity of the disease is reduced and symptom development is delayed. Lesion number, lesion size, and extent of sporulation of fungal pathogens are all decreased. This method of imparting disease resistance has the potential for treating previously untreatable diseases, treating diseases systemically which might not be treated separately due to cost, and avoiding the use of infectious agents or environmentally harmful materials.
[0116] The method of imparting pathogen resistance to plants in accordance with the present invention is useful in imparting resistance to a wide variety of pathogens including viruses, bacteria, and fungi. Resistance, inter alia, to the following viruses can be achieved by the method of the present invention: Tobacco mosaic virus and Tomato mosaic virus. Resistance, inter alia, to the following bacteria can also be imparted to plants in accordance with present invention: pathogenic Pseudomonas spp., pathogenic Erwinia spp., pathogenic Xanthomonas spp., and pathogenic Ralstonia spp. Plants can be made resistant, inter alia, to the following fungi by use of the method of the present invention: Fusarium spp. and Phytophthora spp.
[0117] With regard to the use of the peptides or compositions of the present invention to enhance plant growth, various forms of plant growth enhancement or promotion can be achieved. This can occur as early as when plant growth begins from seeds or later in the life of a plant. For example, plant growth according to the present invention encompasses greater yield, increased plant vigor, increased vigor of seedlings (i.e., post-germination), increased plant weight, increased biomass, increased number of flowers per plant, higher grain and / or fruit yield, increased quantity of seeds produced, increased percentage of seeds germinated, increased speed of germination, increased plant size, decreased plant height (for wheat), greater biomass, more and bigger fruit, earlier fruit coloration, earlier bud, fruit and plant maturation, more tillers or side shoots, larger leaves, delayed leaf senescence, increased shoot growth, increased root growth, altered root / shoot allocation, increased protein content, increased oil content, increased carbohydrate content, increased pigment content, increased chlorophyll content, increased total photosynthesis, increased photosynthesis efficiency, reduced respiration (lower O 2 usage), compensation for yield-reducing treatments, increased durability of stems (and resistance to stem lodging), increased durability of roots (and resistance to root lodging), better plant growth in low light conditions, and combinations thereof. As a result, the present invention provides significant economic benefit to growers. For example, early germination and early maturation permit crops to be grown in areas where short growing seasons would otherwise preclude their growth in that locale. Increased percentage of seed germination results in improved crop stands and more efficient seed use. Greater yield, increased size, and enhanced biomass production allow greater revenue generation from a given plot of land.
[0118] With regard to the use of the peptides or compositions of the present invention to control pests (including but not limited to insects and nematodes, which are biotic stressors), such pest control encompasses preventing pests from contacting plants to which the peptide or composition of the invention has been applied, preventing direct damage to plants by feeding injury, causing pests to depart from such plants, killing pests proximate to such plants, interfering with insect larval feeding on such plants, preventing pests from colonizing host plants, preventing colonizing insects from releasing phytotoxins, interfering with egg deposition on host plants, etc. The present invention also prevents subsequent disease damage to plants resulting from pest infection.
[0119] The present invention is effective against a wide variety of insects (biotic stressors). European corn borer is a major pest of corn (dent and sweet corn) but also feeds on over 200 plant species including green, wax, and lima beans and edible soybeans, peppers, potato, and tomato plus many weed species. Additional insect larval feeding pests which damage a wide variety of vegetable crops include the following: beet armyworm, cabbage looper, corn ear worm, fall armyworm, diamondback moth, cabbage root maggot, onion maggot, seed corn maggot, pickleworm (melonworm), pepper maggot, and tomato pinworm. Collectively, this group of insect pests represents the most economically important group of pests for vegetable production worldwide. The present invention is also effective against nematodes, another class of economically important biotic stressors. Soybean Cyst Nematode (Heterodera glycines) is a major pest of soybeans. Reniform Nematode (Rotylenchulus reniformis) is a major pest of cotton as can parasitize additional crop species, notably soy and corn. Additional nematode pests include the root knot nematodes of the genus Meloidogyne (particularly in cotton, wheat, and barley), cereal cyst nematodes of the genus Heterodera (particularly in soy, wheat, and barley), root lesion nematodes of the genus Pratylenchus, seed gall nematodes of the genus Anguina (particularly in wheat, barley, and rye), and stem nematodes of the genus Ditylenchus. Other biotic stressors include arachnids, weeds, and combinations thereof.
[0120] With regard to the use of the peptides or compositions of the present invention to impart abiotic stress resistance to plants, such abiotic stress encompasses any environmental factor having an adverse effect on plant physiology and development. Examples of such environmental stress include climate-related stress (e.g., drought, flood, frost, cold temperature, high temperature, excessive light, and insufficient light), air pollution stress (e.g., carbon dioxide, carbon monoxide, sulfur dioxide, NO x , hydrocarbons, ozone, ultraviolet radiation, acidic rain), chemical (e.g., insecticides, fungicides, herbicides, heavy metals), nutritional stress (e.g., over- or under-abundance of fertilizer, micronutrients, macronutrients, particularly potassium, nitrogen derivatives, and phosphorus derivatives), and improved healing response to wounding. Use of peptides of the present invention imparts resistance to plants against such forms of environmental stress.
[0121] A further aspect of the present invention relates to the use of the peptides of the present invention as a safener in combination with one or more of the active agents (i.e., in a composition or in separate compositions) for the control of aquatic weeds in a body of water as described in U.S. Publ. No. 20150218099 to Mann,.
[0122] Yet another aspect of the present invention relates to the use of the peptides of the present invention as a plant strengthener in a composition for application to plants grown under conditions of reduced water irrigation, which composition also includes at least one antioxidant and at least one radiation manager, and optionally at least one plant growth regulator, as described in U.S. Publ. No. 20130116119 to Rees et al..
[0123] The methods of the present invention involving application of the peptide or composition can be carried out through a variety of procedures when all or part of the plant is treated, including leaves, stems, roots, propagules (e.g., cuttings), fruit, etc. This may (but need not) involve infiltration of the peptide into the plant. Suitable application methods include high or low pressure spraying, injection, and leaf abrasion proximate to when peptide application takes place. When treating plant seeds, in accordance with the application embodiment of the present invention, the hypersensitive response elicitor protein or polypeptide can be applied by low or high pressure spraying, coating, immersion (e.g., soaking), or injection. Other suitable application procedures can be envisioned by those skilled in the art provided they are able to effect contact of the hypersensitive response elicitor polypeptide or protein with cells of the plant or plant seed. Once treated with the peptides or compositions of the present invention, the seeds can be planted in natural or artificial soil and cultivated using conventional procedures to produce plants. After plants have been propagated from seeds treated in accordance with the present invention, the plants may be treated with one or more applications of the peptides or compositions of the invention to impart disease resistance to plants, to enhance plant growth, to control insects on the plants, to impart biotic or abiotic stress tolerance, to improve desiccation resistance of removed cuttings, to impart post-harvest disease resistance or desiccation resistance to harvested fruit or vegetables, and / or improved longevity of fruit or vegetable ripeness for harvested fruit or vegetables.
[0124] Where the peptides are applied in the form of a recombinant beneficial microbe, these microbes can be applied in the form of an aqueous solution comprising a suspension of such beneficial microbes, which is then applied to the plant by spraying, coating, or immersion as described above. When treating plant seeds, in accordance with the application embodiment of the present invention, the microbes can be applied by low or high pressure spraying, coating, immersion (e.g., soaking), or injection. Other suitable application procedures can be envisioned by those skilled in the art provided they are able to effect contact of the beneficial microbes with cells of the plant or plant seed. In accordance with the application embodiment of the present invention, the beneficial microbes can be applied to plants or plant seeds in dry form. By way of example, dry application of microbes can be accomplished using bacterial or fungal products such as Kodiak ®< HB, available from Chemtura, and T-22 ™< HC, available from BioWorks. Once treated with the microbes of the present invention, the seeds can be planted in natural or artificial soil and cultivated using conventional procedures to produce plants. After plants have been propagated from seeds treated in accordance with the present invention, the plants may be treated with one or more applications of the microbes of the invention or the peptides, fusion proteins, or compositions of the invention, to impart disease resistance to plants, to enhance plant growth, to control insects on the plants, to impart biotic or abiotic stress tolerance, to improve desiccation resistance of removed cuttings, to impart post-harvest disease resistance or desiccation resistance to harvested fruit or vegetables, and / or improved longevity of fruit or vegetable ripeness for harvested fruit or vegetables.
[0125] The peptides or compositions of the invention can be applied to plants or plant seeds in accordance with the present invention alone or in a mixture with other materials. Alternatively, the peptides or compositions can be applied separately to plants with other materials being applied at different times.
[0126] In the alternative embodiment of the present invention involving the use of transgenic plants and transgenic seeds, a peptide of the invention need not be applied topically to the plants or seeds. Instead, transgenic plants transformed with a DNA molecule encoding a peptide of the invention are produced according to procedures well known in the art. A vector suitable for expression in plants (i.e., containing translation and transcription control sequences operable in plants) can be microinjected directly into plant cells by use of micropipettes to transfer mechanically the recombinant DNA. Crossway, Mol. Gen. Genetics, 202:179-85 (1985). The genetic material may also be transferred into the plant cell using polyethylene glycol. Krens, et al., Nature, 296:72-74 (1982).
[0127] Another approach to transforming plant cells with a gene encoding the peptide of the invention is particle bombardment (also known as biolistic transformation) of the host cell. This can be accomplished in one of several ways. The first involves propelling inert or biologically active particles at cells. This technique is disclosed in U.S. Patent Nos. 4,945,050, 5,036,006, and 5,100,792, all to Sanford et al.. Generally, this procedure involves propelling inert or biologically active particles at the cells under conditions effective to penetrate the outer surface of the cell and to be incorporated within the interior thereof. When inert particles are utilized, the vector can be introduced into the cell by coating the particles with the vector containing the heterologous DNA. Alternatively, the target cell can be surrounded by the vector so that the vector is carried into the cell by the wake of the particle. Biologically active particles (e.g., dried bacterial cells containing the vector and heterologous DNA) can also be propelled into plant cells.
[0128] Yet another method of introduction is fusion of protoplasts with other entities, either minicells, cells, lysosomes or other fusible lipid-surfaced bodies. Fraley, et al., Proc. Natl. Acad. Sci. USA, 79:1859-63 (1982). The DNA molecule may also be introduced into the plant cells by electroporation. Fromm et al., Proc. Natl. Acad. Sci. USA, 82:5824 (1985). In this technique, plant protoplasts are electroporated in the presence of plasmids containing the expression cassette. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and regenerate.
[0129] Another method of introducing the DNA molecule into plant cells is to infect a plant cell with Agrobacterium tumefaciens or A. rhizogenes previously transformed with the gene. Under appropriate conditions known in the art, the transformed plant cells are grown to form shoots or roots, and develop further into plants. Generally, this procedure involves inoculating the plant tissue with a suspension of bacteria and incubating the tissue for 48 to 72 hours on regeneration medium without antibiotics at 25-28°C. Agrobacterium is a representative genus of the gram-negative family Rhizobiaceae. Its species are responsible for crown gall (A. tumefaciens) and hairy root disease (A. rhizogenes). The plant cells in crown gall tumors and hairy roots are induced to produce amino acid derivatives known as opines, which are catabolized only by the bacteria. The bacterial genes responsible for expression of opines are a convenient source of control elements for chimeric expression cassettes. In addition, assaying for the presence of opines can be used to identify transformed tissue. Heterologous genetic sequences can be introduced into appropriate plant cells, by means of the Ti plasmid of A. tumefaciens or the Ri plasmid of A. rhizogenes. The Ti or Ri plasmid is transmitted to plant cells on infection by Agrobacterium and is stably integrated into the plant genome. J. Schell, Science, 237:1176-83 (1987).
[0130] After transformation, the transformed plant cells must be regenerated. Plant regeneration from cultured protoplasts is described in Evans et al., Handbook of Plant Cell Cultures, Vol. 1: (MacMillan Publishing Co., New York, 1983); and Nasil I.R. (ed.), Cell Culture and Somatic Cell Genetics of Plants, Acad. Press, Orlando, Vol. 1, 1984, and Vol. Ill (1986).
[0131] It is known that practically all plants can be regenerated from cultured cells or tissues. Means for regeneration varies from species to species of plants, but generally a suspension of transformed protoplasts or a petri plate containing transformed explants is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced in the callus tissue. These embryos germinate as natural embryos to form plants. The culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is usually reproducible and repeatable.
[0132] After the expression cassette is stably incorporated in transgenic plants, it can be transferred to other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.
[0133] Once transgenic plants of this type are produced, the plants themselves can be cultivated in accordance with conventional procedure with the presence of the gene encoding the hypersensitive response elicitor resulting in disease resistance, enhanced plant growth, control of insects on the plant, abiotic or biotic stress tolerance, improved desiccation resistance of removed cuttings, post-harvest disease resistance or desiccation resistance in harvested fruit or vegetables, and / or improved longevity of fruit or vegetable ripeness for harvested fruit or vegetables.
[0134] Alternatively, transgenic seeds are recovered from the transgenic plants. These seeds can then be planted in the soil and cultivated using conventional procedures to produce transgenic plants. The transgenic plants are propagated from the planted transgenic seeds under conditions effective to impart disease resistance to plants, to enhance plant growth, to control insects, to impart abiotic or biotic stress tolerance, to improve desiccation resistance of removed cuttings, to impart post-harvest disease resistance or desiccation resistance in harvested fruit or vegetables, and / or to impart improved longevity of fruit or vegetable ripeness for harvested fruit or vegetables.
[0135] When transgenic plants and plant seeds are used in accordance with the present invention, they additionally can be treated with the same materials as are used to treat the plants and seeds to which a peptide of the invention or composition of the invention is applied. These other materials, including peptides or composition of the invention, can be applied to the transgenic plants and plant seeds by the above-noted procedures, including high or low pressure spraying, injection, coating, and immersion. Similarly, after plants have been propagated from the transgenic plant seeds, the plants may be treated with one or more applications of the peptides or compositions of the invention to impart disease resistance, enhance growth, control insects, abiotic or biotic stress tolerance, desiccation resistance of removed cuttings, post-harvest disease resistance or desiccation resistance in harvested fruit or vegetables, and / or improved longevity of fruit or vegetable ripeness for harvested fruit or vegetables.
[0136] Such transgenic plants may also be treated with conventional plant treatment agents, e.g., bacteriocidal or biocidal agents, protease inhibitors, non-ionic surfactants, fertilizers, herbicides, insecticides, fungicides, nematicides, biological inoculants, plant regulators, and mixtures thereof, as described above.EXAMPLES
[0137] The following examples are provided to illustrate embodiments of the present invention but are by no means intended to limit its scope.Example 1 - Determination of a Minimal HR-Eliciting Sequence
[0138] The minimal eliciting sequence derived from was developed based on the sequence of the hrex gene from Xanthomonas campestris pv. pelargonii. A number of truncated and mutated sequences were synthesized and tested for Hypersensitive Response induction (results in Table 4). HR in tobacco was tested as described in Wei, Science 257:85-88 (1992). Briefly, peptides were dissolved at a concentration of 500 µg / ml in aqueous solution. Four serial dilutions were performed with an equal volume of water, yielding peptide samples at 500, 250, 125, 62.5, 31.25 µg / ml peptide solutions. Nicotiana tabacum cultivar xanthi plants were used at 5-7 weeks old (preflowering). Leaves were lightly punctured with a toothpick in a middle leaf panel. Peptide solutions were then infused via needle-less syringe into the wound, filling the panel. Each peptide sample was infused into a leaf of 2 different plants. The leaves were observed and scored over the next 48 hours for withering and browning, lesions typical of programmed cell death. These studies had three main goals: (1) determine the minimal sequence sufficient for HR elicitation (2) increase the solution stability of the peptides; (3) make disruptive mutations to verify the residues which are most important for HR elicitation; (4) make conservative mutations to identify the degree of specificity for particular amino acids.
[0139] The wild-type sequence from Xanthomonas campestris pv. pelargonii contains several methionine residues, which are prone to oxidation. Mutant peptides (P5-2, and P5-3) contain Met to Ala mutations, but these mutations do not affect the elicitation of HR, suggesting that the methionine residues are dispensable for HR activation.
[0140] Based on the P5 and P5a sequences (SEQ ID NOS: 8 and 9), disruptive or conservative single mutations were introduced at specific residues within the sequence. In the case of Leucine residues, these were mutated to glutamic acid (disruptive due to the introduction of a negative charge) or valine (conservative). The intervening sequences, depending on the identity of the amino acid in question, were mutated to have a negative charge (aspartic acid or glutamic acid), have a hydrophobic sidechain (valine), a minimal sidechain (alanine), or a small polar sidechain (serine). These mutant peptides were tested for elicitation of the hypersensitive response. Additional mutations are chosen based on the initial HR results. For those amino acids that were important for HR elicitation, more conservative mutations were chosen to determine the specificity of interactions. The leucine residues were mutated to isoleucine, valine, phenylalanine or tyrosine, with the latter 2 residues being less conservative. As above, these mutants were tested for HR elicitation. Table 4 Peptide name Sequence SEQ ID NO: HR: P5SAGSEQQLDLLLMFIMMMLQQ8+P5aSAGSEQQLDQLLLMFIMMMLQQ9+P5-2SAGSEQQLDLLLMFIAAALQQ10+P5-3SAGSEQQLDLLLAFIAAALQQ11+P5-4SAGSEQQLELLLAFIAAALQQ12+P5-5QLELLLAFIAAALQQ139+P5-6SAGSEQQLDLLLAFIAAAL140-P5-7SEEEEELDLLLAFIAAAL13-P5-8SEEEEELDLLLAFIAAALQQ14Weak+P5-9LDLLLAFIAAALEEEEEEE15-P5-10LDLLLAFIEEELEEEE16-P5-11SEEELDLLLAFIAAALEE17-P5-12SEEELDLLLAFIEEELEE18-P5-13SEEELDLLLAFIAAALDD19-P5-14SEEEEELDLLLAFIAAALGG20Weak+P5-15SEEEEELDLLLAFIAAALQ25-P5-16SEEEEELDLLLAFIAAALS26-P5-17SEEEEELDLLLAFIAAALA27-P5-18SEEEEELDLLLAFIAAALE28-P5-19SELELLLAFIAAALEEEEE29+P5-20SELELLLEFIEEELEE36-P5-21SEEQLELLLAFIAAALQQEE33+P5-22SEEELELLLAFIAAALEEEE30+P5-23SEEEEELDQLLLAFIAAALQQ50Weak+P5-24SEEEEELDQLLLAFIAAAL51-P5-25SEEEEQLDQLLLAFIAAALQQ52-P5-26SEEQLDLLLAFIAAALQEE34+P5-27SEEQLDQLLLAFIAAALQEE53-P5-28SEEQLDQLLLAFIAAALEE54Weak+P5-29SEEELDLLLMFIMMMLEE42+P5-30SEEELDQLLLMFIMMMLEE55+P5-31SEEEQLDLLLMFIMMMLEE43+P5-32SEEEQLDQLLLMFIMMMLEE56+P5-33SEEEQLDLLLMFIMMMLQEE44+P5-34SEEEQLDQLLLMFIMMMLQEE57+P5-35SAGSEQQE DLLLMFIMMMLQQ71Weak+P5-36SAGSEQQLDE LLMFIMMMLQQ72+P5-37SAGSEQQLDLE LMFIMMMLQQ73-P5-38SAGSEQQLDLLEMFIMMMLQQ74-P5-39SAGSEQQLDLLLEFIMMMLQQ75Strong+P5-40SAGSEQQLDLLLMEIMMMLQQ76Strong+P5-41SAGSEQQLDLLLMFEMMMLQQ77-P5-42SAGSEQQLDLLLMFIEMMLQQ78Weak+P5-43SAGSEQQLDLLLMFIMEMLQQ79Strong+P5-44SAGSEQQLDLLLMFIMMELQQ80Weak+P5-45SAGSEQQLDLLLMFIMMMEQQ81-P5-46SEEQLDQLLLMFIMMMLQQEE58+P5-47SEEQLDLLLMFIMMMLQQEE45+P5-48SEEQLDLLLEFIEEELQQEE39-P5-49SAGSEQQE DLLLAFIAAALQQ510-P5-50SAGSEQQLDE LLAFIAAALQQ511Weak+P5-51SAGSEQQE DE LLAFIAAALQQ512-P5-52SAGSEQQE DE LLMFIMMMLQQ513-P5-53SAGSEQQE DQLLLMFIMMMLQQ98-P5-54SAGSEQQLDQE LLMFIMMMLQQ99-P5-55SAGSEQQLDQ LLLA FIAAA LQQ130-P5-56SEEQEELLLAFIAAALQQEE514-P5-57SEEQLEELLAFIAAALQQEE515+P5-58SEEQEEELLAFIAAALQQEE516-P5-61SAGSEQQE DLLLAFIALQQ519-P5-62SAGSEQQLDE LLAFIALQQ520-P5-63SAGSEQQLDLLLE FIALQQ521-P5-64SAGSEQQLDLLLAE IALQQ522-P5-65SAGSEQQLDLLLAFIE ALQQ523-P5-66SAGSEQQLDLLLAFIAE ALQQ524Weak+P5-67SAGSEQQLDLLLAFIEAALQQ525-P5-68SAGSEQQLDLLLAFIAAELQQ526-P5-69SAGSEQQLDLLLAEIAAALQQ527-P5-70SAGSEQQLDLLLEFIAAALQQ528-P5-71SAGSEQQEDLLLAFIAAALQQ529-P5-72SAGSEQQLDELLAFIAAALQQ530-P5-73SQAGSEQLDLLLMFIMMMLQQ531+P5-74AEQGSSQLDLLLMFIMMMLQQ532+P5-75NQGISEKQQLDLLLMFIMMMLQQ533Strong+P5-76NQGISEKQQLDLLLAFIAAALQQ534Weak+P5-77NFGTPDSTVQNPQDASKPNQLDLLLMFIMMMLQQ535Weak+P5-78NFGTPDSTVQNPQDASKPNQLDLLLAFIAAALQQ536Weak+P5-79ITPDGOGGGQIGDNPQLDLLLMFIMMMLQQ537Strong+P5-80ITPDGQGGGQIGDNPQLDLLLAFIAAALQQ538Weak+P5-87SEEQLDLLLAFIAAALQQEE539-P5-88SEEQLELLLAFIAAALQEE540+ Example 2 - Stability Tests of Variant Peptides
[0141] Peptides were assessed for one or more of solubility, stability against chemical degradation, effect of bulking agents on solution stability, oxidation protection and solution stability studies.
[0142] Stability against chemical degradation was assessed in various pH buffers by creating 0.2% AI solutions of pure, chemically synthesized peptide in deionized water, 0.25% weight to volume of Proxel ®< GXL (biocide), and 50 millimolar (mM) of nine buffers (separately) as follows: Citrate, pH 5.6, MES pH 6.0, MOPS pH 6.5, Citrate pH 7.2, EDDS pH 7.3, imidazole pH 7.5, EDTA pH 8, Phosphate pH 8, and TES pH 8. The solutions were observed on HPLC for evidence of degradation (% loss of the peptide signal over time, relative to the time 0 sample) over a period of weeks at elevated temperature (50°C). Precipitation of P5 and P5-5 was noted in several samples, particularly those with pH < 7. Other peptides, notably P5-9 and P5-21 remained in solution. These correlate with the lower hydrophobicity values for P5-9.
[0143] Peptide P5 exhibited poor solubility below pH 7.0, which distorted the experimental results (not shown). For the buffer solutions above pH 7.0, generally poor stability was observed, with the best results in an EDTA buffer at pH 8.0 (about 40% remaining after 14 days (Figure 1). P5-9 contains a C-terminal glutamate sequence for solubility enhancement and mutations of methionine residues for increased resistance to oxidation. This peptide exhibited better solubility performance at 500 ug / ml as well as better stability compared with P5 (Figure 2). Citrate at pH 7.2 and Phosphate at pH 8.0 exhibited above 80% remaining after 14 days. Notably, after 45 days, 81% of the original peptide remained for the citrate pH 7.2 sample and 79% for the phosphate pH 8.0.
[0144] P5-21 is a minimal sequence necessary for HR elicitation containing both N- and C-terminal solubility enhancing sequences and methionine to alanine mutations. It exhibited good solubility at pH 5.6 and higher as well as excellent stability (>90%) for all buffers pH > 7.0 except EDTA (around 80%). Results are shown in Figure 3.
[0145] Samples of material P5, P5-21, and P5-25 bulked with maltodextrin and either phosphate buffer (pH 8.0) or citrate buffer (pH 7.2) were tested for stability at room temperature for 48 hours. No significant degradation (more than 5% loss) was observed.
[0146] Solution stability studies were carried out by creating 0.09% AI solutions of pure, chemically synthesized peptide in deionized water, 50 mM of pH buffer, 0.25% Proxel GXL, and 0-50% isopropanol. Peptides solutions were analyzed by HPLC for % loss of the peptide signal over time during incubation at 50°C, relative to the time 0 sample. Peptides were analyzed until the remaining peptide concentration decreased to 80% of original (20% degradation). Results are summarized in Table 5 below. Table 5: Formulation Stability of P5 Variants Peptide SEQ ID NO: Formulation: Time before 20% degradation (days) P5850 mM phosphate pH 8.02130% IPA5 mM DTPAP5-213350 mM citrate pH 7.24120% IPAP5-255250 mM citrate pH 7.253P5-275350 mM imidazole pH 7.55050% IPAIPA: isopropanol, DTPA: diethylenetriaminepentaacetic acid Example 3 - Induction of Resistance to Tobacco Mosaic Virus
[0147] Peptides were tested for the induction of resistance to tobacco mosaic virus (TMV) in tobacco. Briefly, three tobacco plants at 6-8 weeks old were selected per group (samples and controls). The bottom-most leaf of the plant was covered and the plant was sprayed with a solution of water (untreated control - UTC), peptide, or Proact (positive control). The spray was applied until the leaves were fully wetted, indicated by liquid dripping from the leaves. The plants were then allowed to dry and the leaf covering was removed.
[0148] Three days post-treatment, the previously-covered leaf and a leaf on the opposite side of the plant were then lightly dusted with diatomaceous earth and 20 ul of a 1.7 ug / ml solution of purified tobacco mosaic virus was applied. The TMV solution was then spread across the leaf surface by lightly rubbing solution and the diatomaceous earth across the surface of the leaves. Two minutes after inoculation, the diatomaceous earth was rinsed off the leaves with water. 3 days after TMV inoculation, the leaves were scored based on the number of TMV lesions observed. The leaf was also scored for signs of the hypersensitive response, including yellowing and wilting of the affected leaves.
[0149] Effectiveness described in Table 6 refers to the % decline in TMV lesions on treated vs UTC plants. A reduction of TMV on covered leaves indicates a systemic immune response in the plant while reduction on uncovered leaves indicates a local response. Asterisks indicate that the P-value derived from a T-test was < 0.05. Table 6: Summary of TMV Resistance Peptide SEQ ID NO: Concentration (ug / ml) Effectiveness Uncovered (%) Effectiveness Covered (%) P581068*50P5-210202590*P5-311205570*P5-4122097*98*P5-51392084*97*P5-6140206236P5-713207191*P5-8142099*99*P5-21332094*81*P5-2230208262P5-25522091*93*P5-46582085*74*P5-47452087*78* Example 4 - Induction of Nematode Resistance in Soy Plants
[0150] The effectiveness of peptide treatment in suppressing the growth of soybean cyst nematodes (SCN) was assessed in soy. Soy was planted in a 1:1 sand / Turface mixture in a greenhouse (temperature held at 28°C), with 10 plants per treatment group. 14 days after planting, plants were sprayed with a 2.0 µg / ml solution of peptide or a control solution without peptide. 4,000 freshly harvested SCN eggs were added to the plants 48 hours after peptide application. 30 days after pathogen introduction, the plants were harvested and the cysts were collected and counted using an elutriator.
[0151] In two separate trials, application of P5 (SEQ ID NO: 8) at 2.0 ug / ml caused a significant reduction in SCN populations. In trial #1, the control population contained an average of 133.5 cysts per plant compared with an average of 69.7 cysts per plant for the P5 treatment group (P = 0.004). In trial #2, the control population contained an average of 104.9 cysts per plant compared with an average of 54.5 cysts per plant for the P5 treatment group (P = 0.019). These results suggest that the peptides of the current invention strongly activate soy plant defenses against nematode infiltration.
[0152] Additional experiments will be performed to examine the effectiveness of peptide treatment in suppressing the growth of soybean cyst nematodes using one or more of the other peptides in Tables 1 and 2, including, without limitation, P5-21 and P5-25. See Example 8 below.Example 5 - Drought Resistance in Corn
[0153] The effectiveness of peptide treatment in reducing drought stress was assessed in corn and soy. 3.5 inch pots were filled with Sunshine #1 soil (SunGro Horticulture), fertilized with a 20-10-20 mixture. The soil was soaked and drained overnight. Seeds (either corn or soy, manually inspected to ensure uniform seed size) were planted at a depth of 1 inch for germination. Plants were grown in a greenhouse under 16 hour light days at >70°F and 8 hour dark nights at >65°F. Prior to drought conditions, the plants were well-watered.
[0154] When the plants reached the V1 stage, plants were culled to achieve a uniform height (abnormally large and small plants were removed). Plants were then randomly assigned to control (spray without peptide) or treatment (spray with peptide) groups and heights were measured. Peptide was made up in a solution of 0.2 ug / ml or 2ug / ml in distilled water + 0.01% Tween-20, and applied as a fine mist from a spray bottle until the solution drips from the leaves. After the peptide solutions were dried, the plants were again randomized in a randomized complete block design. Drought stress was initiated after the peptide treatment. This was caused by maintaining the water level at 25-50% of the maximum capacity for water (capacity was decided as the weight of the pot filled with saturated soil minus the weight of the filled pot prior to adding water).
[0155] The drought test phase ended after 2-3 weeks. At that time, the plant height was again measured and the growth rate was calculated as the difference between this and the previously-recorded height. The above-ground part portions of the plants were harvested and weighed. The above-ground portion was also dried in an oven at 70°C for 72 hours and a dry weight was obtained. All calculations were compared with matched untreated control plants.
[0156] The drought testing procedure was carried out in corn using a treatment of P5 (SEQ ID NO: 8). Treatment with 2.0 ug / ml of peptide caused a 3.09% increase in the growth rate, a 10.04% increase in the dry weight (P < 0.05), and a 4.01% increase in fresh weight.
[0157] As shown in Table 7, additional peptides caused a drought resistance phenotype. Table 7: Summary of Drought Resistance Peptide SEQ ID NO: Concentration (ug / ml) Dry Weight Increase (%) Fresh Weight Increase (%) P5-46582.03.719.05**P5-765340.25.33*2.00P5-35712.0-6.57*-6.05**: P<0.1, **: P<0.05
[0158] Experimental results for P5-21 and P5-25 were not statistically significant. One notable result is P5-35. Although this result is a negative phenotype under treatment, this shows that the peptide has some bioactivity. It has been shown previously with other harpin proteins that over-application can result in a negative response. Future experiments could show that lower concentration application of this peptide can cause a positive biological response. See Example 10 below.Example 6 - Root Knot Nematode (RKN) Resistance in Tomato
[0159] 'Rutgers' tomato seedlings were transplanted into pasteurized sandy soil in 5 inch clay pots. The plants were spray-treated with a peptide solution until the leaves were saturated immediately after transplanting. 2 days after transplant, the plants were inoculated with root knot nematode (Meloidogyne incognita) eggs (5000 eggs per pot). Plants were maintained in a greenhouse for about 60 days post-inoculation, corresponding to 2 life cycles for the nematode. Two additional spray applications were made 21 and 42 days after transplanting.
[0160] For these trials, controls treatments included a commercial standard (Vydate) positive control; an untreated, RKN-inoculated control; and an untreated uninoculated control. At the end of each trial, the following measures were taken: root gall rating classification (based on % of roots with galling, 1 - minimal: <5% roots with galls, 2 - slight:5-25% roots with galls, 3 - moderate: 26-50% roots with galls, 4 - heavy: over 50% of roots with galls) and counting of the number of RKN eggs per gram of root.
[0161] For spray-treatment with P5 at 46.7 ug / ml, a significant reduction in root galling was observed (4 in untreated plants vs 2-3 in treated plants). Likewise, a reduction in egg counts was observed: an average of 165,600 for untreated plants vs 52,000 for treated plants, a 69% decrease, p=0.02.Example 7 - Drought Resistance in Soy
[0162] The effectiveness of peptide treatment in reducing drought stress was assessed in soy. 3.5 inch pots were filled with Sunshine #1 soil (SunGro Horticulture), fertilized with a 20-10-20 mixture. The soil was soaked and drained overnight. Seeds (soy, manually inspected to ensure uniform seed size) were planted at a depth of half inch for germination. Plants were grown in a greenhouse under 16 hour light days at >70°F and 8 hour dark nights at >65°F. Prior to drought conditions, the plants were well-watered.
[0163] When the plants reached the growth stage when first trifoliate expanded, plants were culled to achieve a uniform height (abnormally large and small plants were removed). Plants were then randomly assigned to control (spray without peptide) or treatment (spray with peptide) groups and heights were measured. Peptide was made up in a solution of 0.2 ug / ml or 2ug / ml in distilled water + 0.04% Tween-20, and applied as a fine mist from a spray bottle until the solution drips from the leaves. After the peptide solutions were dried, the plants were again randomized in a randomized complete block design. Cyclic drought stress was initiated after the peptide treatment. Plants were subjected to at least three drought cycles of drought stress (3-5 days of withholding water and 1 day irrigated with saturating amount of water) before harvesting.
[0164] The drought test phase ended after 2-3 weeks. At that time, the plant height was again measured and the growth rate was calculated as the difference between this and the previously-recorded height. The above-ground part portions of the plants were harvested and weighed to obtain fresh weight. The above-ground portion was also dried in an oven at 70°C for 72 hours to obtain dry weight. All calculations were compared with matched untreated control plants.
[0165] Results are shown in Table 8 below. Asterisks indicate statistical significance by P-value (*: P < 0.1 and **: P < 0.05). Table 8: Summary of Drought Resistance Peptide SEQ ID NO: Concentration (ug / ml) Dry Weight Increase (%) Fresh Weight Increase (%) P5-27532.02.044.07*P5-33442.05.02**4.10P5-755330.23.738.78**P5-755332.04.378.55** Example 8 - Comparison of Peptides with Chemical Nematode Agents in Soy
[0166] The effectiveness of peptides was tested in soy (Sheyenne variety) and compared with current anti-nematode chemicals. Briefly, soy seeds were commercially coated with peptide at rates of 10, 30, or 90 ug peptide per seed or with chemical nematicides Avicta Complete, Clariva Complete, Poncho / Votivo, or Velum total. 3 soy seeds were planted in a mixture of topsoil and sand (pasteurized) in a 10 cm diameter pot and were inoculated with 1500 eggs per pot at planting. 10 replicate pots were used per experimental condition. After plants emerged from the soil, the plants were thinned to one plant per pot. Plants were harvested about 45 days after planting. The following measures were taken: (1) Fresh shoot and root weights; (2) Root condition graded 0-10 for the presence of disease; (3) Nematode cysts per plant; (4) Nematode eggs per plant; and optionally (5) Male nematodes. The following values were calculated: eggs per gram of root, cysts per gram of root, and eggs per cyst.
[0167] P5 (SEQID: 8) did not exhibit a significant reduction in cysts or eggs, but did cause a ~30% reduction in the number of male nematodes. However, the chemical treatments caused a greater reduction in the male nematodes.
[0168] P5-21 (SEQID: 33) caused a reduction in cysts per gram root: 91% at 10ug, 80% at 30ug, and 86% at 90ug. These were numerically greater than the results for Clariva Complete (76%) and Avicta Complete (78%). The results were statistically significantly greater than those of Poncho / Votivo (58%). There was also a significant reduction in eggs per gram root: 93% for a 10ug treatment, 74% for a 30ug treatment, 92% for a 90ug treatment. These were numerically greater than those of Clariva Complete (75%) and Avicta Complete (72%) for all tested rates. The results for P5-21 at 10ug and 90 ug were statistically significantly greater than the results for Poncho / Votivo (49%).
[0169] P5-25 (SEQID: 52) also caused a strong reduction in cysts per gram of root: 92% at 10ug, 82% at 30ug, and 91% at 90ug. These were numerically greater than the results for Clariva Complete (76%) and Avicta Complete (78%). The results at 10ug and 90ug were statistically significantly greater than Poncho / Votivo (58%). Likewise, there was a significant reduction in the eggs per gram root: 94% at 10ug, 85% at 30ug, and 93% at 90ug. These results were numerically better than Clariva Complete (75%) and Avicta Complete (72%). The results were also statistically significantly greater than those of Poncho / Votivo (49%).Example 9 - Stimulation by P5 of Anti-nematode Root Secretions in Soy
[0170] Soybean seeds coated with P5 (SEQ ID NO: 8) or a mock treatment were wetted and germinated in brown paper for 48 hours. Seedlings were then placed in a beaker with 3ml distilled water per seedling for 24 hours. The liquid exudate was then collected and 1ml was added to each well of a 24-well plate. 300 soybean cyst nematode Heterodera glycines eggs were added into a plastic micro-sieve mesh and placed on each of the 24 wells. After incubating for 3 days, the number of hatched nematodes at the well bottom was counted. In the mock-treated exudate wells, counts revealed an average of 40 hatched nematodes. In the p5-treated exudate wells, an average of 30 hatched nematodes was counted. This was a statistically significant difference (P < 0.05).Example 10 - Corn Drought Performance in the Field
[0171] Peptide P5 (SEQ ID: 8) was tested for its efficacy in reducing drought stress under field conditions. Briefly, a site was chosen in Hughson, CA, where rainfall is minimal and irrigation is required for growing. Corn hybrid seeds 639STX (Heine Seed Company) were coated with P5 at 12, 35, or 105 ug peptide per seed or a mock treatment. The planting field was divided 3 row (30" spacing) x 25 foot plots. Corn was planted at a rate of 32,000 viable seeds per acre (6.5 inches between seeds on 30 inch rows. Four border rows (10 ft) were planted on all sides of the trial to mitigate environmental effects. Each treatment group was replicated 4 times and arrayed in a Randomized Complete Block design.
[0172] Irrigation was managed in the following way: The site was initially irrigated to assure a good plant stand and early growth. Two drought periods were initiated. The first started at the V-3 plant growth stage and ended when leaf curling was visible in the plants. The second drought period started at tassel emergence and ended at the end of pollen shed. During both drought periods, the plants were monitored to avoid reaching a permanent wilting point.
[0173] Treatment with P5 resulted in an increase of 20.2 bushels per acre (Bu / Ac) for 12ug / seed treatment, an increase of 11.4 Bu / Ac for 35 ug / seed treatment, and an increase of 19.7 Bu / Ac for a 105 ug / seed treatment rate. These results compared with an average yield of 123.6 Bu / Ac for untreated control. The growers also observed an increase in metrics associated with the size of the corn ear. The number of rows per corn ear increased from 12.3 (UTC) to 12.7 for 12 ug / seed, remained unchanged for 35ug / seed, and increased to 13.1 for 105 ug / seed. The mass of the corn ears also increased from 90.1 grams per ear (UTC) to 104.8g for 12ug / seed, 98.4g for 35ug / seed, and 104.5g for 105ug / seed. The number of kernels per row was 25.9 for UTC. This increased to 28.6 for 12ug / seed, decreased slightly to 25.3 for 35 ug / seed, and increased to 28.9 for 105 ug / seed. These results indicate a potent effect on water conservation in corn.
Claims
1. An isolated peptide that is 12 to 50 amino acids in length, the peptide comprising the amino acid sequence of (i) L-X-X-L-L-L-X-(F / L)-(I / L)-X-X-X-L (SEQ ID NO: 2) wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 3 is optional and, when present, is Gln (Q); and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate; or (ii) wherein X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 5 is optional and, when present, is Gln (Q), and each X at positions 9, 12, 13, and 14 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate; or (iii) wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 3 is optional and, when present, is Gln (Q), and each X at positions 7, 10, 11, and 12 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate; or (iv) wherein X at position 4 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 5 is optional and, when present, is Gln (Q), and each X at positions 9, 12, 13, and 14 is independently selected from Met (M), Ala (A), Glu (E), and γ-glutamate; wherein the peptide induces an active plant response when applied to plant tissue, and optionally induces a hypersensitive response.
2. The isolated peptide according to claim 1, wherein the peptide is free of cysteine and methionine.
3. The isolated peptide according to claim 1 further comprising a hydrophilic amino acid sequence at either the N-terminal or C-terminal end thereof.
4. The isolated peptide according to claim 1, wherein the peptide comprises the amino acid sequence of SEQ ID NO: 4 wherein X at position 2 is selected from Glu (E), γ-glutamate, Asp (D), and isoD; X at position 3 is optional and, when present, is Q; and each X at positions 7, 10, 11, and 12 is independently selected from M, A, E, and γ-glutamate.
5. The isolated peptide according to claim 1, wherein the isolated peptide has the amino acid sequence of SEQ ID NO: 3 or 5 and X at position 5 is present, and is Q.
6. The isolated peptide according to claim 1, wherein the isolated peptide has the amino acid sequence of SEQ ID NO: 3 or 5 and X at position 4 is selected from the group consisting of D and E.
7. The isolated peptide according to claim 1, wherein the isolated peptide has the amino acid sequence of SEQ ID NO: 3 or 5 and X at position 9 is selected from the group consisting of A, M, and E or each X at positions 12, 13, and 14 is selected independently from the group consisting of A, M, and E.
8. The isolated peptide according to claim 1, wherein the isolated peptide has the amino acid sequence of SEQ ID NO: 3 or 5 and X at position 10 is F or L, or X at position 11 is I or L.
9. The isolated peptide according to claim 1, wherein the peptide comprises the amino acid sequence of SEQ ID NOS: 8-14, 20, 29, 30, 33, 34, 42-45, 50, 52-58, 75, 78-80, 139, 140, 518, 524, 531-538, or 540.
10. The isolated peptide according to claim 1, wherein the isolated peptide has an average Kyte-Doolittle hydropathy index of less than 0.7.
11. The isolated peptide according to claim 1, wherein the isolated peptide, when dissolved in water or aqueous solution at 50°C for 7 days, has a stability of at least 66%.
12. The isolated peptide according to claim 1, wherein the isolated peptide has a solubility of at least 5.0 mg / ml water or aqueous solution.
13. The isolated peptide according to claim 1, wherein the peptide induces an active plant response, but does not induce a hypersensitive response, when applied to plant tissue, and wherein the peptide comprises the amino acid sequence of one of SEQ ID NOS: 13, 52, 53, and 140.
14. The isolated peptide according to claim 1, wherein the peptide induces a hypersensitive response when applied to plant tissue, and wherein the peptide comprises the amino acid sequence of one of SEQ ID NOS: 8-12, 14, 20, 29, 30, 33, 34, 42-45, 50, 54-58, 75, 78-80, 139, 518, 524, 531-538, and 540.
15. The isolated peptide according to claim 1, wherein X at position 3 of SEQ ID NO: 2 or 4 is present, and is Q, wherein X at position 2 of SEQ ID NO: 2 or 4 is selected from the group consisting of D and isoD, wherein X at position 7 of SEQ ID NO: 2 or 4 is selected from the group consisting of A, M, or E, or wherein each X at positions 10, 11, and 12 of SEQ ID NO: 2 or 4 is selected independently from the group consisting of M, A, and E.
16. The isolated peptide according to one of claims 1 to 15, wherein the peptide is at least 90% pure.
17. The isolated peptide according to one of claims 1 to 15, wherein the peptide is a fusion polypeptide comprising a second amino acid sequence coupled via peptide bond to the amino acid sequence, wherein the second amino acid sequence optionally includes a purification tag or an N-terminal or C-terminal hydrophilic amino acid sequence, or the fusion polypeptide optionally comprises a first amino acid sequence for said peptide linked to a second amino acid sequence for said peptide.
18. The isolated peptide according to claim 17, wherein the second amino acid sequence comprises a purification tag that further includes a cleavable linker sequence between the purification tag and the amino acid sequence.
19. A fusion polypeptide comprising a plurality of amino acid sequences linked together in series, each of the plurality of amino acid sequences comprising the peptide according to one of claims 1 to 15.
20. A composition comprising one or more peptides according to one of claims 1 to 18 or a fusion polypeptide according to claim 19, and a carrier.
21. The composition according to claim 20 further comprising an additive selected from the group consisting of fertilizer, herbicide, insecticide, fungicide, nematicide, a bactericidal agent, a biological inoculant, a plant regulator, and mixtures thereof.
22. The composition according to claim 20, wherein the carrier is an aqueous carrier that optionally further comprises one or more of a biocidal agent, a protease inhibitor, a non-ionic surfactant, or a combination thereof, or the carrier is a solid carrier in particulate form, preferably a dry powder.
23. A method of imparting disease resistance to plants, enhancing plant growth, or increasing a plant's tolerance to biotic or abiotic stress, comprising: applying an effective amount of an isolated peptide according to one of claims 1 to 18, a fusion polypeptide according to claim 19, or a composition according to one of claims 20 to 22 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to impart disease resistance, enhance plant growth, or increase tolerance to biotic or abiotic stress, wherein the biotic stress is selected from the group consisting of insects, arachnids, nematodes, weeds, and combinations thereof, or wherein the abiotic stress is selected from the group consisting of salt stress, water stress, ozone stress, heavy metal stress, cold stress, heat stress, nutritional stress, and combinations thereof.
24. The method according to claim 23, wherein the method is a method of imparting disease resistance to plants and the disease is a viral disease, a bacterial disease, or a fungal disease.
25. The method according to claim 23, wherein the method is a method of enhancing plant growth and the enhanced growth comprises improved plant vigor, increased plant weight, increased biomass, increased number of flowers per plant, higher grain and / or fruit yield, more tillers or side shoots, larger leaves, increased shoot growth, increased protein content, increased oil content, increased starch content, increased pigment content, increased chlorophyll content, and combinations thereof.
26. The method according to claim 23, wherein said applying is carried out with a plant.
27. The method according to claim 23, wherein said applying is carried out with a plant seed, said method further comprising planting the seed treated with the peptide or composition in natural or artificial soil, and propagating a plant from the seed planted in the soil.
28. The method according to claim 23, wherein said applying is carried out at the locus where the plant is growing or is expected to grow.
29. The method according to claim 23, wherein the plant is selected from agricultural, silvicultural, ornamental and horticultural plants each in its natural or genetically modified form.
30. The method according to claim 23, wherein the plant to be treated is selected from the group consisting of alfalfa, apple, apricot, asparagus, avocados, bananas, barley, beans, beech (Fagus spec.), begonia, birch, blackberry, blueberry, cabbage, camphor, canola, carrot, castor oil plant, cherry, cinnamon, citrus, cocoa bean, coffee, corn, cotton, cucumber, cucurbit, eucalyptus, fir, flax, fodder beet, fuchsia, garlic, geranium, grapes, ground nut, hemp, hop, juneberry, juncea (Brassica juncea), jute, lentil, lettuce, linseed, melon, mustard, oak, oats, oil palm, oil-seed rape, olive, onion, paprika, pea, peach, pear, pelargonium, peppers, petunia, pine (Pinus spec.), poplar (Populus spec.), pome fruit, potato, rape, raspberry, rice, rubber tree, rye, sorghum, soybean, spinach, spruce, squash, strawberry, sugar beet, sugar cane, sunflower, tea, teak, tobacco, tomato, triticale, turf, watermelon, wheat and willow (Salix spec.).
31. A method of modulating plant biochemical signaling comprising: applying an effective amount of an isolated peptide according to one of claims 1 to 18, a fusion polypeptide according to claim 19, or a composition according to one of claims 20 to 22 to a plant or plant seed or the locus where the plant is growing or is expected to grow, wherein said applying is effective to modulate plant biochemical signaling.
32. A DNA construct comprising a first nucleic acid molecule encoding a peptide according to one of claims 1 to 18 or a fusion polypeptide according to claim 19, and a promoter-effective nucleic acid molecule operably coupled to the first nucleic acid molecule.
33. A recombinant expression vector or a recombinant host cell comprising the DNA construct according to claim 32.
34. The recombinant host cell according to claim 33, wherein the recombinant host cell is (i) a plant protoplast, (ii) a bacterium, wherein the bacterium is optionally a member of the genera selected from the group consisting of Pseudomonas, Sphingomonas, Bacillus, Streptomyces, Rhizobium, Frankia, and Azospirillum, or (iii) a fungus, wherein the fungus is optionally a member of the genera selected from the group consisting of Rhodotorula, Aspergillus, and Trichoderma.
35. A transgenic plant or transgenic plant seed comprising a recombinant host cell according to claim 33 or the DNA construct according to claim 32.