PROCEDURES FOR THE DIAGNOSIS AND TREATMENT OF LUNG CANCER
Patent Information
- Application Number
- DE602018089437
- Authority / Receiving Office
- DE · DE
- Patent Type
- Patents
- Current Assignee / Owner
- Filing Date
- 2018-08-20
- Publication Date
- 2026-02-25
- Estimated Expiration
- 2038-08-20
Description
FIELD AND BACKGROUND OF THE INVENTION
[0001] The present invention relates to methods of diagnosing lung cancer.
[0002] Lung cancer is the third most common cancer diagnosed, but has a higher mortality rate than breast, prostate, and colon cancer combined. Furthermore, since more than half of patients are diagnosed with locally advanced or metastatic disease, and despite advances in treatment, the long-term survival from lung cancer currently remains low. Therefore, significant efforts are being made to make screening and early diagnosis of lung cancer possible, in order to allow early treatment and to improve survival [Smith, R. A. et al. Cancer screening in the United States, 2011. CA. Cancer J. Clin. 61, 8-30 (2011); Moyer, V. A. Screening for Lung Cancer: U.S. Preventive Services Task Force Recommendation Statement. Ann. Intern. Med. 160, 330-338 (2014)]. The current recommended method for lung cancer screening and early diagnosis by the US Preventive Services Task Force (USPSTF), is chest low dose computed tomography (LDCT) in a high-risk population. This recommendation was based on The National Lung Screening Trial (NLST), which demonstrated that scanning with LDCT led to a 20 % reduction in mortality rate in this high-risk population. However, LDCT screening has many limitations, including radiation exposure, high false positive rates and over diagnosis. In addition, the target population of the USPSTF's recommendation represents only about 11 % of the 94 million former and current smokers in the U.S. These recommendations also do not take into consideration other high-risk populations, such as patients with chronic obstructive pulmonary disease (COPD), of which about 2.2 % develop lung cancer per year. Indeed, there is an urgent need for other non-invasive methods or biomarkers with high accuracy, which might promote an earlier detection of lung cancer, resulting in more efficacious therapeutic interventions and higher likelihood of cure.
[0003] Liquid biopsy is a new strategy for the noninvasive detection of cancer using body fluids, mainly blood samples. Several studies include a quantitative analysis to investigate the role of circulating cell-free tumor DNA or non-coding RNA in lung cancer diagnosis. Some methods utilize machine learning to assist the diagnostic process, training a classifier on the covariates obtained from liquid biopsy. Many challenges remain in this approach, including low frequency of secreted tumor components in the blood, their short half-life, cell / DNA fragmentation, high variation in tumor cell mutation, and the incapability to determine tumor origin. Importantly, current methods detect malignancies mostly in advanced stages, in which treatment is less effective.
[0004] The Warburg effect is the observation that most cancer cells predominantly produce energy by a high rate of glycolysis followed by lactic acid production in the cytosol, rather than by a comparatively low rate of glycolysis followed by oxidation of pyruvate in mitochondria like most normal cells [Kim JW, Dang CV (2006). "Cancer's molecular sweet tooth and the Warburg effect". Cancer Res. 66 (18): 8927-30]. In the 1920s, Otto Warburg found that cancer cells, in contrast to normal differentiated cells, primarily rely on aerobic glycolysis rather than on mitochondrial oxidative phosphorylation to generate ATP as the fuel for energy needed for cellular processes. This historical phenomenon was termed "the Warburg effect". Otto Warburg postulated that this change in metabolism is the fundamental cause of cancer [Warburg O (1956). "On the origin of cancer cells", Science 123 (3191): 309-14], a claim now known as the Warburg hypothesis. About 50 years later the Warburg effect was also observed in activated lymphocytes in vitro see e.g., Maclver et al. 2008 J. Leukocyte Biology 84:1-9; and DeBerardinis Cell Metabolism 7:11-20. The Warburg effect was found also in the immune system where activated T cells rapidly hyperinduce glycolysis, for example by over-expression of glucose transporters (GLUT).
[0005] The Warburg effect has important medical applications, as high aerobic glycolysis by malignant tumors is utilized clinically to diagnose and monitor treatment responses of cancers by imaging uptake of 2- 18< F-2-deoxyglucose (FDG) (a radioactive modified hexokinase substrate) with positron emission tomography (PET). See also WO2007 / 102146. However, these methods are cumbersome and expensive by requiring high-tech facilities or in-situ tissue biopsies.
[0006] WO2012 / 137207 (see also US 2013 / 224,789 A1) teaches a method of measuring a metabolic activity (MA) of a cell. The method comprises independently measuring in an extracellular environment of the cell, a time-dependent acidification profiles due to secretion of: (i) non-volatile soluble metabolic products; (ii) non-volatile soluble metabolic products and volatile soluble metabolic products; or (iii) volatile soluble metabolic products; wherein at least one of the time dependent acidification profiles is indicative of the metabolic activity of the cell. Also provided are clinical methods which make use of the assay in the diagnosis of cancer.SUMMARY OF THE INVENTION
[0007] According to an aspect of some embodiments of the present invention there is provided an in vitro method of diagnosing lung cancer in a subject-in-need thereof, the method comprising: (a) in vitro contacting a biological sample of the subject which comprises peripheral blood mononuclear cells (PBMCs) with stimulants comprising NY-ESO-1, Her-2 / Neu, ConA, PHA, MAGE-A3 and glucose, wherein said stimulants are in separate wells comprising aliquots of said biological sample; and (b) measuring metabolic activity of the PBMCs having been contacted according to (a), wherein a statistically significant change in the metabolic activity of the PBMCs as compared to a control sample is indicative of lung cancer.
[0008] According to some embodiments of the invention, measuring metabolic activity is by measuring extracellular acidification of the PBMCs.
[0009] According to some embodiments of the invention, measuring the extracellular acidification is in an extracellular defined solution having a calibrated buffered capacity of the PBMCs.
[0010] According to some embodiments of the invention, measuring the metabolic activity is in a time-dependent manner as a function of a concentration of the stimulant so as to generate an acidification profile.
[0011] According to some embodiments of the invention, the acidification profile is due to secretion of: (i) non-volatile soluble metabolic products and volatile soluble metabolic products; (ii) non-volatile soluble metabolic products; or (iii) volatile soluble metabolic products.
[0012] According to some embodiments of the invention, measuring the acidification profile of (ii) is effected in an air-exposed chamber, and measuring acidification profile of (i) is effected in an air-sealed chamber, and measuring the acidification profile of (iii) is by subtracting an acidification profile of (ii) from an acidification profile of (i).
[0013] According to some embodiments of the invention, measuring the extracellular acidification of the PBMCs is with a non-toxic, membrane-impermeant pH probe.
[0014] According to some embodiments of the invention, measuring the metabolic activity is at 37°C.
[0015] According to some embodiments of the invention, the subject is at risk of lung cancer.
[0016] Unless otherwise defined, all technical and / or scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of embodiments of the invention, exemplary methods and / or materials are described below. In case of conflict, the patent specification, including definitions, will prevail. In addition, the materials, methods, and examples are illustrative only and are not intended to be necessarily limiting.BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
[0017] Some embodiments of the invention are herein described, by way of example only, with reference to the accompanying drawings. With specific reference now to the drawings in detail, it is stressed that the particulars shown are by way of example and for purposes of illustrative discussion of embodiments of the invention. In this regard, the description taken with the drawings makes apparent to those skilled in the art how embodiments of the invention may be practiced.
[0018] In the drawings: Figure 1 is an illustration showing an embodiment of the metabolic activity profile (MAP) test process. Figure 2 is a graphic presentation of the distribution of lung cancer stages in the studied cohort. Stage 0 refers to adenocarcinoma in-situ [Weissferdt, A. & Moran, C. A. Reclassification of early stage pulmonary adenocarcinoma and its consequences. J. Thorac. Dis. 6, S581-8 (2014); Goldstraw, P. et al. Non-small-cell lung cancer. Lancet 378, 1727-1740 (2011)]; the 'Other' group includes lung cancer types in which stages are not used. Figure 3 is a pie graph showing the frequency of various histological types of lung cancer in the studied cohort. Figure 4 is a graph showing Calculation or reaction rates. PBMCs were mixed with D-Glucose as a stimulant in several increasing concentrations, and the change in acidity was measured as a function of time. The concentration of H +< in nM units was derived using the formula: 10 9-pH< . Figures 5A-B are graphic presentations showing the behavior of average lung cancer (n=100, red) and healthy (n=100, green) subjects, when observing the reaction rate (r) as a function of stimulant concentration index (C). The specific stimulant is written in the title of each graph, with the plate state in parentheses. Standard error of the mean is shown for each data point. Figure 5A: examples of differences that were found between the two populations; Figure 5B: examples where no significant difference was found. Figure 6 is a bar graph of prediction scores, showing a separation between populations of healthy and lung cancer subjects. For these results, the prediction model was trained and validated on the entire data set. Figure 7 is a graph showing a ROC curve of the 20-fold cross-validation. Figure 8 is a bar graph showing discovery rates of the diagnostic model, broken down into lung cancer stages. P-value of the Fisher exact test is shown. Figure 9 is a bar graph showing the accuracy of the model, broken down into medical condition groups. P-values of the Fisher exact test are shown. Figure 10 is a bar graph showing the accuracy of the model, broken down according to subjects' smoking habits. The smokers group also includes former smokers, who have at least one pack-year in their history, but have not smoked in the past 30 days. P-values of the Fisher exact test are shown. DESCRIPTION
[0019] The present invention relates to methods of diagnosing lung cancer. The invention is defined in the claims. The invention is not necessarily limited in its application to the details set forth in the following description or exemplified by the Examples. The invention is capable of being practiced or carried out in various ways. Furthermore, it is to be understood that some parts of the description below do not fall under the scope of the claimed invention.
[0020] The present inventors devised a strategy for the diagnosis of lung cancer using a non-invasive blood test. Thus, described herein is a method for the diagnosis of lung cancer by analyzing the metabolic activity of PBMCs in subjects suspected of having cancer. The assay employs in vitro stimulation of PBMCs with lung cancer cell antigens / mitogens and analyzing extracellular acidification profiles as a measure for their metabolic activity. This assay not only allows early detection of cancer, but provides a clinically valuable discrimination between patients with lung cancer versus other diseases that increase immune system activity.
[0021] 'Liquid ImmunoBiopsy' refers to a novel functional test that measures the relative acidification levels of the PBMCs extracellular environment, revealing the metabolic activity profiles (MAPs) of the immune system cells as an indicator of disease status. Since the immune system is extremely sensitive, it is inherently suited for early cancer detection.
[0022] It is suggested that the resulting detected differences between lung cancer and healthy samples can ultimately be attributed to the differences in PBMC subpopulations and prevalence. In the present assay, the raw MAP test data are firstly analyzed in order to extract meaningful classifier features, which are then used as input parameters for a machine learning diagnostic prediction model. The results provided herewith in the Examples section which follows, present 20-fold cross-validation (CV) results of the diagnostic model, with an AUC of 0.91, displaying high sensitivity and specificity of 91 and 80% respectively. Further and more stringent examinations, using both 10- and 5-fold CV procedures, reveal a slight to no decrease in AUC, which indicates robustness of the presented diagnostic model.
[0023] The model demonstrates a statistically uniform sensitivity across different cancer stages, indicating that early detection is possible using the present teachings. This is of great diagnostic importance, since lung cancer survival is largely and directly dependent on the stage of diagnosis. Moreover, the presence of COPD comorbidity in the tested subjects was shown not to affect the diagnostic results, in either sensitivity or specificity, indicating that the model's results are not influenced by these pathological conditions. COPD increases five-fold the risk for lung carcinogenesis, thus, being able to detect lung cancer in this high-risk population can have a major impact on patient survival.
[0024] Results of the assay can be corroborated by the detection of nodules in the lung. It could also potentially be used in high-risk individuals, such as COPD patients. It is suggested that the present approach can be used as a diagnostic tool, in which a negative result will lead to surveillance imaging and the avoidance of unnecessary invasive procedures, while a positive result could lead to an early, life-saving intervention. It is also suggested that the assay may contribute to monitoring immuno-responsiveness to immunotherapy procedures, because the MAPs should reflect the expected enhanced immune response.
[0025] Thus, according to an aspect of the invention there is provided an in vitro method of diagnosing lung cancer in a subject-in-need thereof, the method comprising: (a) in vitro contacting a biological sample of the subject which comprises peripheral blood mononuclear cells (PBMCs) with stimulants comprising NY-ESO-1, Her-2 / Neu, ConA, PHA, MAGE-A3 and glucose, wherein said stimulants are in separate wells comprising aliquots of said biological sample; and (b) measuring metabolic activity (MA) of the PBMCs having been contacted according to (a), wherein a statistically significant change in the metabolic activity of the PBMCs as compared to a control sample is indicative of lung cancer.
[0026] Any of the methods described herein can be used in a diagnostic kit aimed for executing the method.
[0027] As used herein "diagnosing" or "diagnosis" refers to determining presence or absence of a pathology (i.e., lung cancer), classifying a pathology or a symptom, determining a severity of the pathology i.e., staging, monitoring pathology progression, forecasting an outcome of a pathology and / or prospects of recovery and screening of a subject for a specific disease.
[0028] As used herein, the term "lung cancer" refers to any cancerous growth in the lung. The lung cancer may be small cell lung cancer (SCLC), or non-small cell lung cancer (NSCLC), characterized by the cell size when viewed under the microscope. Primary NSCLC comprises mostly adenocarcinoma (including bronchoalveolar cell carcinoma), squamous cell carcinoma and large cell carcinoma. As used herein, the term lung cancer also includes lung cancers of rare cell types, such as carcinoid tumors and lymphoma. A lung cancer patient may be a patient diagnosed with lung cancer on the basis of imaging, biopsy, staging, etc.
[0029] In particular, the lung cancer may be NSCLC.
[0030] Lung cancer staging is an assessment of the degree of spread of the cancer from its original source. It is one of the factors affecting the prognosis and potential treatment of lung cancer.
[0031] The evaluation of non-small-cell lung carcinoma (NSCLC) staging uses of the TNM classification. This is based on the size of the primary tumor, lymph node involvement, and distant metastasis. Table 1 - TNM classification in lung cancer T: Primary tumor N: Lymph nodes M: Metastasis Primary tumor cannot be assessedNXRegional lymph nodes cannot be assessedM XDistant metastasis cannot be assessedTXAny of:Tumor cells present in sputum or bronchial washing, but tumor not seen with imaging or bronchoscopyN0No regional lymph node metastasisMONo distant metastasisTONo evidence of primary tumorN1Metastasis to ipsilaterial peribronchial and / or hilar lymph nodesSeparate tumor nodule in the other lungTisCarcinoma in situT1Tumor size less than or equal to 3 cm across, surrounded by lung or visceral pleura, without invasion proximal to the lobar bronchusN2Metastasis to ipsilateral mediastinal and / or Subcarinal lymph nodes Metastatis toMlaAny of:Tumor with pleural nodulesT1aTumor size less than or equal to 2 cm acrossMalignant pleural or pericardial effusionT1bTumor size more than 2 cm but less than or equal to 3 cm acrossN3Any of:scalene or supraclavicular lymph nodesT2Any of:Tumor size more than 3 cm but less than or equal to 7 cm acrossMetastasis to contralateral hilar orMlbDistant metastasisInvolvement of the main bronchus at least 2 cm distal to the carinamediastinal lymph nodesInvasion of visceral pleuraAtelectasis / obstructive pneumonitis extending to the hilum but not involving the whole lungT2aTumor size more than 3 cm but less than or equal to 5 cm acrossT2bTumor size more than 5 cm but less than or equal to 7 cm acrossTumor size more than 7 cm acrossInvasion into the chest wall, diaphragm, phrenic nerve, mediastinal pleural or parietal pericardiumT3Any of:Tumor less than 2 cm distal to the carina but not involving the carinaAtelectasis / obstructive pneumonitis of the whole lungSeparate tumor nodule in the same lobeT4Any of:Invasion of the mediastinum, heart, great vessels, trachea, carina, recurrent laryngeal nerve, esophagus, or vertebraSeparate tumor nodule in a different lobe of the same lung
[0032] Using the TNM descriptors, a group is assigned, ranging from occult cancer, through stages 0, IA (one-A), IB, IIA, IIB, IIIA, IIIB and IV (four). This stage group assists with the choice of treatment and estimation of prognosis. Table 2 - Stage group according to TNM classification in lung cancer TNM Stage group T1a-T1b N0 MOIAT2a N0 MOIBT1a-T2a N1 MOIIAT2b N0 MOT2b N1 MOIIBT3 N0 MOT1a-T3 N2 M0IIIAT3 N1 MOT4 N0-N1 MON3 MOIIIBT4 N2 M0M1IV
[0033] Small-cell lung carcinoma (SCLC) has traditionally been classified as "limited stage" (confined to one-half of the chest and within the scope of a single tolerable radiotherapy field) or "extensive stage" (more widespread disease). However, the TNM classification and grouping are useful in estimating prognosis.
[0034] For both NSCLC and SCLC, the two general types of staging evaluations are clinical staging and surgical staging. Clinical staging is performed prior to definitive surgery. It is based on the results of imaging studies (such as CT scans and PET scans) and biopsy results. Surgical staging is evaluated either during or after the operation and is based on the combined results of surgical and clinical findings, including surgical sampling of thoracic lymph nodes.
[0035] Any of these methods can be used to corroborate the diagnosis according to the present teachings or as to provide a first diagnosis.
[0036] The lung cancer may be an early stage lung cancer (e.g., TNM la-2b).
[0037] As used herein, the term "subject" refers to a subject (e.g., human) being tested by the methods or kits described herein. The subject can be a subject who is at risk of having lung cancer [e.g., a genetically predisposed subject, a subject of advanced age, a subject with medical and / or family history of cancer, a subject suffering from COPD, a subject who has been exposed to smoke and / or other carcinogens, occupational hazards, environmental hazards] and / or a subject who exhibits suspicious clinical signs of lung cancer or cancer in general [e.g., persistent cough, hemoptysis, chest pain, shortness of breath, pleural effusion, wheezing, hoarseness, recurrent bronchitis or pneumonia, bone pain, paraneoplastic syndromes, unexplained pain, sweating, unexplained fever, unexplained loss of weight up to anorexia, anemia and / or general weakness]. Additionally or alternatively, the subject can be a healthy human subject undergoing a routine well-being check-up or routine screen of a random or representative population. The subject can also be a patient or subject participating in an investigation or test. The subject can be a smoker or non-smoker or former smoker (as shown in Example 5). The lung cancer may be an early stage (la-2b according to TNM Guideline) lung cancer.
[0038] The subject may not have been treated with an anti-cancer therapy at least 2-5 years prior to the measuring.
[0039] The subject may not have been treated with an anti-cancer therapy at least 2 years prior to the measuring.
[0040] The subject may not have been treated with an anti-cancer therapy at least 3 years prior to the measuring.
[0041] The subject may not have been treated with an anti-cancer therapy at least 4 years prior to the measuring.
[0042] The subject may not have been treated with an anti-cancer therapy at least 5 years prior to the measuring.
[0043] The subject may already be diagnosed with lung cancer or has such a suggested diagnosis (e.g., effected by chest radiography, CT imaging, bronchoscopy, CT-guided biopsy and / or histopathology) and the present assay is used to corroborate the diagnosis, optimize treatment or monitor treatment.
[0044] The subject may not be diagnosed with cancer (e.g., any cancer).
[0045] The subject may not have been treated with an anti-cancer therapy (dedicated therapy) at least 0.5-5 years prior to the measuring of the metabolic activity.
[0046] As used herein "metabolic activity pathway" refers to the relative contribution of mitochondrial oxidative phosphorylation, anaerobic glycolysis, aerobic glycolysis and NH 3 +< production to energy production.
[0047] The profiles may have a spike configuration or a monotonic saturated behavior.
[0048] A spikes profile typically reflects receptor mediated stimulation of metabolic activity which is expected to be more specific compared to the concentration dependent nutrient response. The latter response is generally a monotonic saturated profile.
[0049] As used herein, "cell" refers to a white blood cell, e.g., peripheral blood mononuclear cell (PBMC), selected from the group consisting of lymphocytes, (e.g., T cells, B cells, NK cells) and monocytes. Thus, the sample can comprise whole blood or depleted of some blood components such as granulocytes, platelets and / or erythrocytes, i.e., fractionated blood. For example, the sample may comprise 1000-10 7< cells (e.g., 10 4< -10 7< cells / ml e.g., 5*10 6< cells / ml e.g., 5*10 4< cells / ml.
[0050] The cells may comprise PBMCs.
[0051] For example, the cells may comprise a pure population of PBMCs e.g., > 80 % (e.g., by Ficoll).
[0052] Methods of depleting blood components e.g., red blood cells, are known in the art and include for example hemolysis, centrifugation, sedimentation, filtration or combinations thereof.
[0053] Figure 1 and the Example section below describes a specific example of such a fractionation process.
[0054] Thus, the cell may refer to an isolated population of cells which comprise a highly purified subset of specific cells i.e., homogenic cell population (e.g., > 80 % purity), e.g., T cells, or a heterogenic cell population which comprises various types of immune cells such as peripheral blood leukocytes (PBL) or peripheral blood mononuclear cells (PBMCs).
[0055] The cell may be in a pure population of cells i.e., pure population of PBMCs i.e., more than 70 % PBMCs, more than 80 % PBMCs, more than 90 % PBMCs, more than 95 % PBMCs.
[0056] As the measurement of metabolic activity is effected in real time, it is important that the cells are maintained viable.
[0057] The cells may be assayed immediately after retrieval from the subject, i.e., not more than 2-4 hours (e.g., 3 hours) following blood retrieval.
[0058] The cells may be stored prior to examination (e.g., at 4 °C or cryo-preserved). Alternatively, the cells may be stored at 18 °C. When the cells are introduced to stimulants, on plate, the plate is loaded on ice e.g 4 °C, followed by reading at it in 37 °C.
[0059] The cell may not be a cell line.
[0060] As mentioned, once the cells are at hand they are in vitro contacted with a stimulant.
[0061] As used herein "stimulant" refers to an entity that increases, decreases or changes a metabolic pathway of a cell in response thereto.
[0062] For instance, if the cell is a lymphocyte then the stimulant is an antigen that is recognized by the TCR or BCR and leads to clonal expansion or antibody production. Specific stimulants or inhibitors are listed in Tables 3 and 4 below.
[0063] It will be appreciated that one or more stimulant (e.g., 2, 3, 4) at the same or different concentrations can be used for a single sample or for a single aliquot of a sample for determining the metabolic activity and optionally determining the profiles as described herein. For example, different Her2 peptides or different stimulants all together e.g., PMA and Her2 peptides can be used. Table 3 - list of stimulants including general stimulants of the immune system, specific stimulants to cancer and lung cancer and nutrients such as glucose and L-glutamine. The suffix 'aa' signifies a range of amino acid positions. Items marked with * are proteins in which only a partial sequence e.g., of -20 amino acids can be used.Stimulant Exemplary Concentration range Phytohaemagglutinin (PHA) e.g., Sigma L41440 - 100 µg / mlConcanavalin A (CON A) e.g., - Sigma C04120-100 µg / miPhorbol Myristate Acetate (PMA) e.g., Sigma P15850-10 ng / mlLipopolysaccharide (LPS) e.g., Sigma L65290-10 ng / mlRapamycin e.g., - Sigma R87810-50 mMD-Glucose e.g., Sigma G87690-10 mML-glutamine e.g., biological industries 03-020-1C0-10 mMMyelin-Basic-Protein (NMP) *0 - 100 µg / mlExemplary sequences:1: HGRTQDENPVVHFFKNIVTPRTPPPS / SEQ ID NO: 12: ENPVVHFFKNIVTPRTPPPSQ / SEQ ID NO: 23: TENPVVHFFKNIVTPRTPPPSQGKGRG / SEQ ID NO: 34: VHFFKNIVTPRTP / SEQ ID NO: 45: DENPVVHFFKNIVTPRTPPPSQGKGR / SEQ ID NO: 5Carcinoembryonic antigen (CEA)* e.g., Ea, Eb0 - 100 µg / mlExemplary sequences:Carcinoembryonic antigen CEA (Ea)1: PPDSSYLSGANLNLSCHSASN / SEQ ID NO: 62: YLSGANLNL / SEQ ID NO: 73: IISPPDSSYLSGANLNLSCH / SEQ ID NO: 84: TPIISPPDSSYLSGANLNLSCHSASNPSP / SEQ ID NO: 95: PPDSSYSLGANLNLSCHSASN / SEQ ID NO: 106: YSLGANLNL / SEQ ID NO: 117: IISPPDSSYSLGANLNLSCH / SEQ ID NO: 128: TPIISPPDSSYSLGANLNLSCHSASNPSP / SEQ ID NO: 13Carcinoembryonic antigen CEA (Eb)1: IAKITPNNNGTYACFVSNLATGRNNSIVK / SEQ ID NO: 142: PNNNGTYACFVSNLATGRNNS / SEQ ID NO: 153: ITPNNNGTYACFVSNLATGR / SEQ ID NO: 164: TYACFVSNL / SEQ ID NO: 17Mucin 1 (MUC-1)*0 - 100 µg / mlExemplary sequences MUC-1 Ub:1: PDTRPAPGSTAPPAHGVTSA / SEQ ID NO: 182: APPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGST / SEQ ID NO: 193: GVTSAPDTRP APGSTAPPAHGVTSAPDTRPISEQ ID NO: 20New York esophageal squamous cell carcinoma 1 (NY-ESO-1)*0-100 µg / mlExemplary sequences:1: RCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL / SEQ ID NO: 222: SRLLEFYLAMPFATPMEAELARRSLA / SEQ ID NO: 233: GPESRLLEFYLAMPFATPMEAELARRSLAQDA / SEQ ID NO: 244: LLEFYLAMPFATPMEAELAR / SEQ ID NO: 25Melanoma-associated antigen A3 (MAGE-A3)*0-100 µg / mlExemplary sequences (ML):1: GSDPACYEFLWGPRALVET / SEQ ID NO: 262: FLWGPRALV / SEQ ID NO: 273: EFLWGPRALVETSYVKV / SEQ ID NO: 284: VPGSDPACYEFLWGPRALVETSYVKVLHH / SEQ ID NO: 29Cytokeratin 190-1 µg / mlCYFRA 21-1* e.g., BA1016S (AcrisAntibody)Gastrin-releasing peptide (GRP)0 - 100 µg / mlExemplary sequences (GRa):1: RAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKS / SEQ ID NO: 302: LAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGK / SEQ ID NO: 313: VPLPAGGGTVLTKMYPRGNHWAVGHLM / SEQ ID NO: 324:VLCLAPRGRAVPLPAGGGTVLTKMYFRGNHWAVGHLMGKKSTGESSS / SEQ ID NO: 33Exemplary sequences (GRb):1: MYPRGNHWAVGHLM / SEQ ID NO: 342: PAGGGTVLTKMYPRGNHWAVGHLMGKK / SEQ ID NO: 353: RGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGES / SEQ ID NO: 364: GGTVLTKMYPRGNHWAVGHLMGKKSTGES / SEQ ID NO: 37Her2 / neu*0 - 100 µg / mlExemplary sequences (Ha):1: Palmitoyl -KTTKS / SEQ ID NO: 38Exemplary sequences (Hb):1: KFPDEEGACQPCPINCTHSCVDLD / SEQ ID NO: 392: GACQPCPINCTHSCVDLDDKGC / SEQ ID NO: 403: IWKFPDEEGACQPCPINCTHSCVDLDDKGC / SEQ ID NO: 414: CQPCPINCTH / SEQ ID NO: 42 Table 4 StimulantsPro-surfactant protein B (Pro-SFTPB)Diacetylspermine (DAS)G antigen (GAGE, CTA4)Exemplary sequences:1: MSWRGRSTYYWPRPRRYVQPPEMIGPM / SEQ ID NO: 432: STYYWPRPRRYVQPP / SEQ ID NO: 443: GRSTYYWPRPRRYVQPPEMI / SEQ ID NO: 454: YYWPRPRRY / SEQ ID NO: 465: YRPRPRRY / SEQ ID NO: 47HuDExemplary Sequences:1: LVRDKITGQSLGYGFVNYIDPKDAEKAIN / SEQ ID NO: 482: GQSLGYGFVNYIDPKD / SEQ ID NO: 493: LGYGFVNYI / SEQ ID NO: 504: DKITGQSLGYGFVNYIDPKDAEK / SEQ ID NO: 51A Kinase Anchor Protein (AKAP4,CTA99)Pituitary Tumor-Transforming 1 (PTTG1, Securin)Annexin I14-3-3ζ & 14-3-3σ
[0064] MHC-restricted peptide antigens from the above mentioned polypeptides are provided herein below.
[0065] The stimulant may be diluted at various concentrations or a single concentration may be used.
[0066] Measuring the metabolic activity can be carried out throughout the contact with the stimulant.
[0067] For example, measuring can be done as soon as the stimulant is added and for at least 120-180 min. For example, measuring can be carried out for 1-2 hours (e.g., 1.5 h) following addition of the stimulant to the cells.
[0068] Measuring the metabolic activity of the cells may be by measuring extracellular acidification of the cells (e.g., PBMCs).
[0069] Measuring the extracellular acidification may be carried out in an extracellular defined solution having a calibrated buffered capacity of the PBMCs.
[0070] Measuring the metabolic activity may be carried out in a time-dependent manner as a function of a concentration of the stimulant so as to generate an acidification profile, which represents the relative acidification rate.
[0071] The acidification profile is due to secretion of: (i) non-volatile soluble metabolic products and volatile soluble metabolic products; (ii) non-volatile soluble metabolic products; or (iii) volatile soluble metabolic products.
[0072] Measuring the acidification profile of the products of (ii) is carried out in an air-exposed chamber, and measuring acidification profile of the products of (i) is carried out in an air-sealed chamber, and measuring acidification profile of the products of (iii) is by subtracting an acidification profile of the products of (ii) from an acidification profile of the products of (i).
[0073] Thus, in order to achieve a sensitive measure, a non-toxic, membrane-impermeant pH indicator / probe is used that can sense minor pH changes at about physiologic pH (~7.4).
[0074] Examples include, but are not limited to, a ratiometric pH probe, a CO 2 probe, an NH 3 probe, a lactate probe and a combination thereof. For example, the ratiometric technique may be required for high sensitivity at pH buffered conditions.
[0075] Examples of specific probes which can be used according to the present teachings include, but are not limited to, 8-Hydroxypyrene-1,3,6-trisulfonic acid (HPTS), CFDA and carboxy fluorescein. Such probes are commercially available such as from Molecular Probes.
[0076] For example, measuring the acidification may be carried out using the ratiometric pH probe 8-Hydroxypyrene-1,3,6-trisulfonic acid (HPTS).
[0077] HPTS, which has a pKa of ~7.3 in aqueous buffers, may be used. HPTS exhibits a pH-dependent absorption shift, allowing ratio-metric pH measurements as a function of the ratio between the fluorescence intensities at 513nm that are measured sequentially under excitation at 455 nm and 403 nm.
[0078] Extracellular monitoring may be facilitated by attachment of ratiometric molecular optical probes to nanoparticles to avoid intracellular effects.
[0079] Any of the above acidification profiles can be used as an indicator of the metabolic activity of the cell. Alternatively, only one of the measured profiles is indicative of the metabolic activity of the cell.
[0080] A calibration curve is typically generated with known pH values (containing the same amount of probe).
[0081] The calibration curve is constructed for the same measures e.g., 'open' and / or 'closed' states (as described herein), allowing pH measurement as a function of the ratio between the two excitation wavelengths.
[0082] One measure i.e., in a sealed (closed) or open chamber may be sufficient to determine the metabolic activity relative to a control sample (under the same conditions).
[0083] Two measures i.e., in a sealed (closed) and open chambers may be sufficient to determine the metabolic activity relative to a control sample (under the same conditions).
[0084] All measures i.e., in a sealed (closed) and open chambers as well as the subtraction are necessary to determine the metabolic activity relative to a control sample (under the same conditions).
[0085] As used herein, "independently measuring" refers to separate measuring of items (i), (ii) and possibly (iii). Although it will be appreciated that (iii) is the result of subtracting (ii) from (i). These separate measurements can be performed in parallel, simultaneously, on identical yet separate cell samples, or sequentially on a single cell sample (as described in the Examples section which follows).
[0086] Thus, measuring extracellular acidification profile is performed by the calibrated curve of acidification.
[0087] Measurement of metabolic activity is performed by calculating the accumulated acidification in relation to the fluorescently measured pH changes in the extracellular environment of the cells (e.g., nM / min of H+ concentration) in "open" and "close" state. It will be appreciated that this measurement is performed only in the extracellular environment of the cell and not intracellularly. Extracellular pH measurement is advantageous since in the extracellular environment there is a persistent acidic accumulation versus a relatively small average changes in the transient intracellular responses due to homeostatic physiological regulation; there is no physiological interference of the extracellular probe with intracellular processes; there is a comparative high signal to noise ratio of the extracellular ratiometric fluorescent probe; simplicity of fluorescent medium (calibrated buffer capacity) preparation versus cellular manipulations; there is no background fluorescence in contrast to significant leakage of intracellular probes; kinetic measurements are made with no need for permeabilization procedures, thereby allowing the analysis of live cells in real-time; there are minimal problems associated with quenching and oxidation effects; and finally simultaneous high throughput kinetic measurements are enabled without the above hurdles.
[0088] The MA test may be performed in a defined solution (all components are known) having a calibrated buffered capacity.
[0089] It will be appreciated that the buffer capacity should ensure minor changes in the physiological pH.
[0090] The buffer may be a phosphate buffer (e.g., phosphate buffer saline 1-10 mM or 10 mM phosphate buffer). It will be appreciated that low buffer concentration is required for acidification measurements at low cell concentration. For example, 10 mM phosphate buffer saline is used for 5x10 6< cells / ml (e.g., purified PBMCs).
[0091] Measuring the acidification profiles may be performed at a constant temperature, e.g., 20-40 °C or specifically, at optimal growth temperature, say 37 °C for PBMCs.
[0092] As mentioned, all measures are made with respect to control sample(s). For instance, as for the test assay just without the stimulant (representing basal state); alternatively or additionally without the cells; and / or without the cells and the stimulant).
[0093] It will be appreciated that each assay can employ one stimulant or more in the same chamber / well or in separate chambers / wells.
[0094] Thus, a single blood sample can be subjected to a panel of stimulants (e.g., 2-25, 2-20, 2-10, 2-5, 2-4).
[0095] The stimulant may be selected from the group consisting of NY-ESO-1, Her-2a, ConA, PHA, MAGE-A3 and glucose.
[0096] Measuring may be performed in an air-exposed chamber when the stimulant is NY-ESO-1.
[0097] Measuring may be performed in an air-exposed chamber when the stimulant is Her-2a.
[0098] Measuring may be performed in an air-exposed chamber when the stimulant is ConA.
[0099] Measuring may be performed in an air-sealed chamber when the stimulant is PHA.
[0100] Measuring may be performed in an air-sealed chamber when the stimulant is MAGE-A3.
[0101] Measuring may be performed in an air-sealed chamber when the stimulant is glucose.
[0102] As described hereinabove, the extracellular acidification profiles are indicative of the identity of the various metabolic products secreted by the cell.
[0103] A lung tumor uses preferentially aerobic glycolysis which is characterized mainly by the secretion of Lactate (non-volatile) to the medium. In contrast, a differentiated tissue employs oxidative phosphorylation or anaerobic glycolysis and therefore secretes CO 2 (volatile) or lactate, dependent on the availability of oxygen, respectively.
[0104] A time dependent acidification profile due to secretion of non-volatile soluble metabolic products mainly lactate is performed in an air-exposed chamber. Under such conditions ("open"), there is gas ventilation of CO 2 and NH 3 , so that only lactate acid production (including other non-volatile organic acids) contributes to the equivalent acidic accumulation in each well.
[0105] Time dependent acidification profile due to secretion of non-volatile soluble metabolic products and volatile soluble metabolic products is performed in an air-sealed chamber. In the hermetically sealed state ("close"), CO 2 and NH 3 react at equilibrium with water to form carbonic acid and basic ammonium ions. In this state, however, the NH 4 +< basic cation titrates the acidity level produced by both the lactic and carbonic acid anions around pH 7.
[0106] The acidification kinetics may be measured in 20-100 minutes e.g., 50 minutes per mode sequence of air "open" and "closed" states of the multi well plate.
[0107] By the appropriate rates (V), of acidification (+) and basic titration (-), the total measured rates of acidification in the open state (Vopen) and the closed state (Vclosed) are described by the coupled equations: Vopen = V lactic acid . Vclose = V lactic acid + V carbonic acid − V ammonium base .
[0108] Using this configuration, the time-dependent acidification profile due to secretion of volatile soluble metabolic products can be calculated by the subtraction of the profiles of (ii) - (i).
[0109] High throughput screening can be performed using a multi well plate, a multi well plate reader (for detecting the fluorescent signal, e.g., available from TECAN), a CCD camera applying image analysis or fiber optics matrices.
[0110] Once acidification profiles are obtained (e.g., with or without stimulant / inhibitor), the profile(s) are recorded. A statistically significant shift (i.e., a change) in the metabolic activity between the cells of the subject and those of the control (e.g., as described above), under identical conditions, is indicative of lung cancer.
[0111] Raw data is subject to machine learning which may employ classifiers, such as decision tree models, logistic models and / or support vector machines (SVM), which classify the results and assist in the design of the product used in diagnosis. Bagging can be employed by training an ensemble of such classifiers on random subsets of the cohort, followed by aggregating their individual predictions using hard voting. A specific example is described in the Examples section under "Data Analysis".
[0112] The resultant acidification profiles are recorded and stored in a database such as on a computer readable medium so as to enable data manipulation and construction of computational models. As used herein, "computer readable medium" refers to any medium which can be read and accessed directly by a computer. Such media include, but are not limited to, magnetic storage media, such as floppy discs, hard disc storage medium, and magnetic tape; optical storage media such as optical discs or CD-ROM; electrical storage media such as RAM and ROM; and hybrids of these categories such as magnetic / optical storage media. Selection and use of appropriate storage media is well within the capabilities of one of ordinary skill in the art.
[0113] As used herein, "recorded" refers to a process of storing information on computer readable medium.
[0114] The diagnostic method / kit described herein provide an acceptable level of clinical or diagnostic accuracy. Using such statistics, an "acceptable degree of diagnostic accuracy", is herein defined as a test or assay (such as the test described herein for determining the clinically significant change / shift in metabolic activity, which thereby indicates lung cancer) in which the AUC (area under the ROC curve for the test or assay) is at least 0.6, desirably at least 0.65, more desirably at least 0.8, preferably at least 0.85, more preferably at least 0.9, and most preferably at least 0.95.
[0115] By a "very high degree of diagnostic accuracy", it is meant a test or assay in which the AUC (area under the ROC curve for the test or assay) is at least 0.75, 0.80, desirably at least 0.85, more desirably at least 0.875, preferably at least 0.90, more preferably at least 0.925, and most preferably at least 0.95.
[0116] Alternatively, the methods predict the presence of a lung cancer or response to therapy with at least 75% sensitivity, more preferably 80%, 85%, 90%, 95%, 97%, 98%, 99% or greater sensitivity.
[0117] Alternatively, the methods predict the presence of lung cancer or response to therapy with at least 75% specificity, more preferably 80%, 85%, 90%, 95%, 97%, 98%, 99% or greater specificity.
[0118] The robustness and accurateness of the present methodology suggests its use in numerous clinical applications.
[0119] Thus, there is described a method of treating lung cancer, the method comprising: (a) diagnosing a subject as having lung cancer as described herein; (b) treating or selecting treatment for said subject with an anti-lung cancer treatment.
[0120] The method may further comprise corroborating the diagnostic results as described herein using Gold standard methods, when needed.
[0121] Treatment of lung cancer typically depends on the stage and type of the disease. The skilled artisan will readily know the treatment options that may be available. Following is a non-restrictive list: Surgery with removal of the entire lobe in which the tumor is located, is the primary treatment for patients with early-stage cancer who are in good general health. The goal of surgery is to totally eliminate all the tumor cells and thereby provide a cure.
[0122] Radiation therapy, or radiotherapy, delivers high-energy x-rays that can destroy rapidly dividing cancer cells. It has many uses in lung cancer: As primary treatment; Before surgery to shrink the tumor; After surgery to eliminate any cancer cells that remain in the treated area; To treat lung cancer that has spread to the brain or other areas of the body; Lobectomy - removal of an entire lobe of the lung - is an accepted procedure for removing lung cancer when the lungs are functioning well.
[0123] In brachytherapy, radiation is delivered directly to the site of disease. This is usually achieved either through a surgical procedure where after resection of the primary tumor radioactive seeds are sutured to the edge of the surgical resection.
[0124] Chemotherapy involves drugs that are toxic to cancer cells. The drugs are usually given by direct injection into a vein or through a catheter placed in a large vein. Often given after surgery to sterilize microscopic disease, chemotherapy also may slow tumor growth and relieve symptoms in patients who cannot have surgery. Newer biologic agents, which may have fewer side effects than traditional chemotherapy and in some instances may be just as effective, are being used. This treatment is used in all stages of lung cancer and can prolong life even in elderly persons as long as they are in good general health. Some chemotherapy drugs increase damage done to tumors by the radiation treatment of cancer cells. Others keep the tumor cells at a stage where they are most susceptible to radiation treatment, or impair the ability of cancer cells to repair themselves after a course of radiation therapy.
[0125] Radiation therapy is the delivery of focused high-energy x-rays (photons), gamma rays or atomic particles. It affects cells that are rapidly dividing-such as cancer cells-much more than those that are not.
[0126] Immunotherapy uses drugs that boost the patient's immune system to help control cancer. Some studies, but not all, have shown better survival rates when these drugs are given after surgery. Examples of immunotherapy include, but are not limited to, monoclonal antibodies, immune checkpoints inhibitors, cancer vaccines and non-specific immunotherapy.
[0127] Gene therapy may kill cancer cells or slow their growth when healthy genes are delivered directly into a lung tumor.
[0128] Angiogenesis inhibitors are agents that prevent new blood vessels from forming in growing cancers and may actually turn off the tumor's blood supply. This remains an experimental approach but is promising in part because it seems to cause very few side effects.
[0129] Genetic testing is being evaluated in order to select patients for appropriate treatment (e.g., mutations in EGFR).
[0130] Stereotactic Body Radiation Therapy (SBRT) can control early-stage tumors at a rate that is comparable to that achieved by surgery.
[0131] In particular, the treatment is by immunotherapy, which may be specifically suited for the method of monitoring described herein as these drugs work on the immune system which the present teachings analyze.
[0132] Accordingly, there is described a method of monitoring treatment, the method comprising: (a) treating a subject having lung cancer with an anti-lung cancer treatment; (b) measuring metabolic activity in PBMCs of the subject by: (i) in vitro contacting said PBMCs with a stimulant selected from the group consisting of the stimulants listed in Tables 3 and 4; and (ii) measuring metabolic activity of said PBMCs having been contacted according to (b), wherein a shift in the metabolic activity of the PBMCs towards that of a normal healthy cell sample examined under identical conditions is indicative of an efficacious treatment of the disease. For example, it is suggested that in the metastatic phase the MA profile might regress close to the normal profile.
[0133] Any of the methods of treating / monitoring treatment or determining treatment (personalized therapy) can be performed as used herein for the diagnosis in terms of determining the metabolic activity of the PBMCs.
[0134] The present teachings further refer to a kit which comprises the stimulants as described herein (e.g., at least 1, at least 2, at least 3 at least 4, at least 5, at least 6, at least 7, at least 8, of the stimulants listed in Table 3 or 4). The kit may further comprise a probe as described herein, a plate (suitable for reading in a fluorescent detector), a buffer for the PBMCs and / or instructions for use.
[0135] The pack kit may be packed, for example, by a metal or plastic foil, such as a blister pack. The pack may be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary use. Such notice, for example, may be of labeling approved by the U.S. Food and Drug Administration for diagnostic kits.
[0136] As used herein the term "about" refers to ± 10 %.
[0137] The terms "comprises", "comprising", "includes", "including", "having" and their conjugates mean "including but not limited to".
[0138] The term "consisting of" means "including and limited to".
[0139] The term "consisting essentially of" means that the composition, method or structure may include additional ingredients, steps and / or parts, but only if the additional ingredients, steps and / or parts do not materially alter the basic and novel characteristics of the claimed composition, method or structure.
[0140] As used herein, the singular form "a", "an" and "the" include plural references unless the context clearly dictates otherwise. For example, the term "a compound" or "at least one compound" may include a plurality of compounds, including mixtures thereof.
[0141] Throughout this application, various embodiments of this invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0142] Whenever a numerical range is indicated herein, it is meant to include any cited numeral (fractional or integral) within the indicated range. The phrases "ranging / ranges between" a first indicate number and a second indicate number and "ranging / ranges from" a first indicate number "to" a second indicate number are used herein interchangeably and are meant to include the first and second indicated numbers and all the fractional and integral numerals therebetween.
[0143] As used herein the term "method" refers to manners, means, techniques and procedures for accomplishing a given task including, but not limited to, those manners, means, techniques and procedures either known to, or readily developed from known manners, means, techniques and procedures by practitioners of the chemical, pharmacological, biological, biochemical and medical arts.
[0144] As used herein, the term "treating" includes abrogating, substantially inhibiting, slowing or reversing the progression of a condition, substantially ameliorating clinical or aesthetical symptoms of a condition or substantially preventing the appearance of clinical or aesthetical symptoms of a condition.
[0145] Various embodiments and aspects of the present invention as claimed in the claims section below find experimental support in the following examples.EXAMPLES
[0146] Reference is now made to the following examples, which together with the above descriptions illustrate some embodiments of the invention in a non limiting fashion.
[0147] Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, "Molecular Cloning: A laboratory Manual" Sambrook et al., (1989); "Current Protocols in Molecular Biology" Volumes I-III Ausubel, R. M., ed. (1994); Ausubel et al., "Current Protocols in Molecular Biology", John Wiley and Sons, Baltimore, Maryland (1989); Perbal, "A Practical Guide to Molecular Cloning", John Wiley & Sons, New York (1988); Watson et al., "Recombinant DNA", Scientific American Books, New York; Birren et al. (eds) "Genome Analysis: A Laboratory Manual Series", Vols. 1-4, Cold Spring Harbor Laboratory Press, New York (1998); methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057; "Cell Biology: A Laboratory Handbook", Volumes I-III Cellis, J. E., ed. (1994); "Current Protocols in Immunology" Volumes I-III Coligan J. E., ed. (1994); Stites et al. (eds), "Basic and Clinical Immunology" (8th Edition), Appleton & Lange, Norwalk, CT (1994); Mishell and Shiigi (eds), "Selected Methods in Cellular Immunology", W. H. Freeman and Co., New York (1980); available immunoassays are extensively described in the patent and scientific literature, see, for example, U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; 4,098,876; 4,879,219; 5,011,771 and 5,281,521; "Oligonucleotide Synthesis" Gait, M. J., ed. (1984); "Nucleic Acid Hybridization" Hames, B. D., and Higgins S. J., eds. (1985); "Transcription and Translation" Hames, B. D., and Higgins S. J., Eds. (1984); "Animal Cell Culture" Freshney, R. I., ed. (1986); "Immobilized Cells and Enzymes" IRL Press, (1986); "A Practical Guide to Molecular Cloning" Perbal, B., (1984) and "Methods in Enzymology" Vol. 1-317, Academic Press; "PCR Protocols: A Guide To Methods And Applications", Academic Press, San Diego, CA (1990); Marshak et al., "Strategies for Protein Purification and Characterization - A Laboratory Course Manual" CSHL Press (1996). Other general references are provided throughout this document. The procedures therein are believed to be well known in the art and are provided for the convenience of the reader.Study Design, Demographics and Protocol
[0148] Subjects were enrolled between June 2014 and December 2016 in three medical centers: Carmel Medical Center (Haifa), Rambam Medical Center (Haifa) and Sourasky Medical Center (Tel Aviv). In all cases, the study received Helsinki approval from the institutional Review Board (approval numbers: 0105-13-CMC, 0274-15-RMB and 0009-13-TLV respectively). Subjects read and signed a dedicated consent form. Inclusion criteria included 18 ≤ age ≤ 90 years, no pregnancy and no treatment for lung cancer prior to blood withdrawal. Exclusion criteria included treatment for any type of malignancy in the prior 5 years, clinically determined active infection or inflammation, treatment with medication that can affect the immune system, lactation or ongoing fertility treatment, or any of the following conditions: HIV positive, hepatitis B / C, autoimmune disease, hypersensitivity and / or allergy that cannot be avoided. Lung cancer and healthy (non-lung-cancer) subjects were enrolled in parallel, the reference standard for lung cancer being biopsy or surgery. Once the number of lung cancer subjects reached 100, they were matched with healthy subjects via an automated process to obtain a balanced 1:1 cohort, with an optimal matching of age, gender and COPD distributions, resulting in a total sample size of 200, as described in Table .Collection and Separation of PBMCs
[0149] Blood samples were collected in 9 ml Vacutubes with EDTA (Greiner Bio-One 455036). For a high viability rate of the blood cells, the samples were transported in thermo-stated containers set to 18 °C until PBMCs separation. PBMCs were isolated by Lymphoprep ™< kit, according to manufacturer's instructions (Axis-Shield).MAP Test Preparation and Measurement
[0150] Each well in a black non-binding, low-volume 384 multi-well plate (Greiner Bio-One) was loaded with 10 µ1 of the PBMCs solution and 10 µ1 of 10 mM phosphate buffered saline (PBS) containing 8-Hydroxypyrene-1,3,6-trisulfonic acid (HPTS, Sigma-Aldrich Ltd.), and including one of 14 stimulating reagents (stimulants) in increasing concentrations. The final concentration of the HPTS probe in each well was 0.5 µM, and the final concentration of the PBMCs was 5.10 6< cells / ml in 10mM PBS. Buffer capacity was specifically matched to allow for pH changes to occur as a result of PBMC metabolic activity. Each well was seeded with 5.10 6< cells / ml, in order to reflect the average PBMC concentration in adult peripheral blood. The samples were loaded in triplicates, first PBMC samples, followed by stimulants, to obtain a final volume of 20 µl in each well. Furthermore, each test included two controls: one containing only the fluorescent HPTS probe, without cells and without stimulants; the other containing the HPTS probe with cells but without stimulants, which represents the 'basal state'. The acidification process was monitored for approximately 1.5 hours at 37°C by a commercial fluorescence scanner (TECAN Infinite M200). First, the scanner monitored the acidification process without a plate seal ('open' state), and then the multi-well plate was sealed hermetically (Thermal Seal RT ™< , Excel Scientific, Inc.) to avoid ventilation of CO 2 and NH 3 for the second phase of the test ('closed' state). Analysis of the profiles was done sequentially. Both states enable the measurement of real-time accumulation of 'soluble' versus 'volatile' metabolic products. The fluorescence intensities were measured at 513 nm under sequential excitation at wavelengths of 455nm and 403nm. See a graphical illustration of the process in Figure 1. The PBMCs do not include granulocytes.Measurement of pH Using HPTS Fluorescent Probe
[0151] The fluorescent probe HPTS is a non-toxic, membrane-impermeant pH indicator, with a pKa of ~7.3 in aqueous buffers. HPTS exhibits a pH-dependent absorption shift, allowing ratio-metric pH measurements as a function of the ratio between the fluorescence intensities measured at a wavelength of 513nm, under excitation at wavelengths of 455 nm and 403 nm sequentially. The calibration curve used in the MAP test comprised PBS solutions containing 0.5 µM HPTS and titrated with an acid or base to obtain several pH levels, as measured by a pH-glass electrode. The pH measurements and the fluorescence measurements of the titrated samples were carried out at 37 °C. A calibration curve was constructed for both 'open' and 'closed' plate states, allowing pH measurement as a function of the ratio between the two above-mentioned excitation wavelengths.Type and Preparation of Stimulants
[0152] In each test, the metabolic activity profiles of PBMCs were monitored in the basal state (in the absence of stimulant reagents), and under the influence of either a stimulant, a nutrient or an inhibitor (all referred to as 'stimulants') as detailed in Table 3 above. Each stimulant was diluted in buffer working solution to obtain several different concentrations. The selection of stimulants was made by their relation to the immune system, lung cancer or cancers in general.Data Analysis
[0153] All demographic and clinical information, as well as the raw MAP test data, were stored in a secure and dedicated PostgreSQL database. Data analysis was performed using Python.
[0154] At the end of the biological analysis, each subject was assigned a data-sheet containing raw fluorescent readings of plate wells as a function of time for both 'open' and 'closed' plate states. The fluorescent readings were transformed into pH values using a calibration curve.
[0155] Machine learning was preformed using decision trees, implemented by the scikit-learn Python library. For cross-validation, a stratified k-fold was used. Bagging was executed by training an ensemble of trees on random subsets of the cohort, followed by aggregating their individual predictions using hard voting.
[0156] Confidence intervals (CI) were calculated using the normal approximation for the binomial confidence interval. Significance of differences between sub-populations were estimated using the Fisher exact test.EXAMPLE I Study Design and Demographics
[0157] A cohort of 200 subjects was compiled by age- and sex-matching 100 lung cancer subjects with 100 healthy subjects (Table 5, below). The healthy group included both healthy individuals and those diagnosed with COPD, while the lung cancer group included both lung cancer patients and individuals with both lung cancer and COPD. The prevalence of COPD in both groups was similar by design (17 % and 21 %, respectively), to ensure that the test has no bias towards this condition. As part of the study design, subjects with different stages of lung cancer were included, with emphasis on early stages (Figure 2). Various histological types of lung cancer were included as well (Figure 3). Table 5: Breakdown of the resulting cohort. Mean ages are shown with standard deviation and range. The ratio of males to females in each group is presented, as well as the percentage of individuals with COPD.Count Age M / F COPD Mean Std. Min. Max. Lung cancer 10065.810.2348857 / 4321%Healthy 10062.28.2418357 / 4317%All 20064.09.43488114 / 8619% EXAMPLE 2 Diagnostic Prediction Model Construction
[0158] Machine learning methods were utilized to distinguish between lung cancer and healthy subjects. Before this could be done, meaningful features needed to be extracted from the raw data of the MAP test. The data comprise fluorescent reads, representing the acidification levels of the extracellular environment while exposed to varying concentrations of stimulants. It was hypothesized that the presence of cancer, associated with changes in the physiological function of the immune system, will be reflected in different metabolic activity profiles of the tested PBMC samples. Thus, the change in acidity as a function of time, defined as the reaction rate (r), was calculated for the different stimulants and concentrations (Figure 4). The value of r was then observed as a function of stimulant concentration (C). In many concentrations, a clear-cut difference could be observed between the average values of lung cancer samples and the average of healthy samples (Figures 5A-B).
[0159] Several mathematical models were used to describe the relationship between C and r, using a small number of coefficients. Some of the models also take into consideration the interdependence of different stimulants. To enhance the difference between the two populations with each stimulant, decision tree classifiers were trained to predict the clinical status of subjects ("lung cancer" or "healthy"). The best mathematical model and best classifier parameters were selected for each stimulant, maximizing accuracy, and the final prediction model comprised an ensemble of decision trees, taking into consideration predictions from multiple stimulants. This was coupled with bootstrap aggregation ("bagging") to obtain robust results.EXAMPLE 3 Diagnostic Prediction of Lung Cancer and Healthy Subjects
[0160] The constructed model produced an almost complete separation between the populations of lung cancer and healthy subjects (Figure 6), with an apparent performance sensitivity of 100 % and specificity of 98 %. As a next step, cross-validation (CV) was utilized to test the predictive capability of the model. Specifically, a stratified 20-fold CV analysis was used, in which 10 samples (1 / 20 of the cohort) are left out for validation, and the rest are used as a training set for the prediction model. The process is repeated iteratively, with a different set of 10 samples each time, until every subject in the cohort is given a prediction. The resulting prediction is a score between -10 (strong healthy) and 10 (strong lung cancer). A receiver operating characteristic (ROC) curve can then be plotted (Figure 7), and a positivity cut-off (or discrimination threshold) can be set to determine sensitivity and specificity. The obtained area under the curve (AUC) was 0.91, with a sensitivity of 91 % and specificity of 80 % (95 % confidence intervals are [87.7 %, 94.3 %] and [75.3 %, 84.7 %], respectively) with the cut-off value set to -0.3 (Table 6, below). Further testing the predictive capabilities of the model, 10-fold and 5-fold CV analyses were performed as well (leaving out 20 and 40 samples respectively each time), resulting in AUCs of 0.91 and 0.86 respectively. Table 6: Performance measures for the 20-fold cross-validation analysis, with the positivity cut-off value set to -0.3.Result95% Confidence intervalSensitivity91.0%87.7%, 94.3%Specificity80.0%75.3%, 84.7%Positive predictive value (PPV)82.0%77.5%, 86.5%Negative predictive value (NPV)89.9%86.4%, 93.4%Accuracy85.5%81.4%, 89.6%Fl score86.3%82.3%, 90.3%
[0161] The prediction model seems to be equally strong in predicting late and early stages of lung cancer. When defining stages 1-2 as early and stages 3-4 as late, there is no observable difference in sensitivity between the two groups (p=1.00). This can be visualized by breaking down the results of the positive group into stages (Figure 8).EXAMPLE 4 Identifying Lung Cancer over Other Lung Chronic Diseases
[0162] One important addressed challenge is the ability of embodiments of the map test as described herein to distinguish not only between healthy and lung cancer subjects, but also between those patients with cancer versus other diseases that increase immune system activity. To this end, subjects diagnosed with COPD were included in both the normal and the lung cancer groups in approximately the same ratio. It was observed that the percentage of correct predictions is similar between subjects with and without COPD, in both the healthy group (p=0.74) and the lung cancer group (p=1.00) (Figure 9). These results suggest that the MAP test's ability to identify lung cancer is not affected by the presence of chronic lung comorbidities.EXAMPLE 5 Comparison between smoking and non-smoking subpopulations
[0163] Since smoking habits have a major influence on the development of lung cancer, it is important to verify the integrity of the prediction model in regard to this variable. The percentage of correct predictions was compared between subjects labeled as smokers (either former or current) and non-smokers. As shown in Figure 10, there was no significant difference in success rates in both the control group (p=0.32) and the lung cancer group (p=0.68) (Figure 10). These results suggest that the MAP test's ability to identify lung cancer is not affected by the smoking habits of tested subjects.
Claims
1. An in vitro method of diagnosing lung cancer in a subject-in-need thereof, the method comprising: (a) in vitro contacting a biological sample of the subject which comprises peripheral mononuclear cells (PBMCs) with stimulants comprising NY-ESO-1, Her-2 / Neu, ConA, PHA, MAGE-A3 and glucose, wherein said stimulants are in separate wells comprising aliquots of said biological sample; and (b) measuring metabolic activity of said PMBCs having been contacted according to (a), wherein a statistically significant change in said metabolic activity of said PBMCs as compared to a control sample is indicative of lung cancer.
2. The in vitro method of claim 1, wherein said measuring metabolic activity is by measuring extracellular acidification of said PBMCs.
3. The in vitro method of claim 2 , wherein said measuring said extracellular acidification is in an extracellular defined solution having a calibrated buffered capacity of said PBMCs.
4. The in vitro method of claim 3, wherein said measuring said metabolic activity is in a time-dependent manner as a function of a concentration of said stimulant so as to generate an acidification profile.
5. The in vitro method of claim 4, wherein acidification profile is due to secretion of: (i) non-volatile soluble metabolic products and volatile soluble metabolic products; (ii) non-volatile soluble metabolic products; or (iii) volatile soluble metabolic products.
6. The in vitro method of claim 5, wherein said measuring said acidification profile of said (ii) is effected in an air-exposed chamber, and wherein measuring acidification profile of said (i) is effected in an air-sealed chamber, and wherein measuring acidification profile of said (iii) is by subtracting an acidification profile of said (ii) from an acidification profile of said (i).
7. The in vitro method of any one of claims 2-6, wherein said measuring said extracellular acidification of said PBMCs is with a non-toxic, membrane-impermeant pH probe.
8. The in vitro method of any one of claims 2-7, wherein said measuring said metabolic activity is at 37°C.
9. The in vitro method of claim 1, wherein said subject is at risk of lung cancer.