Repairment of barrier dysfunction in esophagus
Patent Information
- Application Number
- EP2023841416
- Authority / Receiving Office
- EP · EP
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2022-12-16
- Filing Date
- 2023-12-06
- Publication Date
- 2025-10-22
AI Technical Summary
Current treatments for gastroesophageal reflux disease (GERD) are inadequate, particularly for proton pump inhibitor (PPI) refractory cases, and there is a need for new methods to prevent progression to esophageal cancer, as existing therapies have limitations in restoring the esophageal epithelial barrier function and are associated with severe side effects.
Expressing the Na+, K+ - ATPase β1 subunit or myotonic dystrophy kinase-related Cdc42-binding kinases α (MRCKα) in esophageal cells to enhance tight junction protein expression and restore the epithelial barrier function, using genetic constructs and vectors such as lentiviral or adenoviral vectors for gene transfer.
This approach effectively prevents dilated intercellular space formation and restores the esophageal epithelial barrier, reducing the risk of esophageal cancer and alleviating GERD symptoms without the side effects of long-term PPI use.
Smart Images

Figure 1.1
Abstract
Description
UR 6-23001 / FR Ref.: 161118.04201 Repairment of Barrier Dysfunction in Esophagus CROSS REFERENCE TO RELATED APPLICATION This application claims priority to U.S. Provisional Application No. 63 / 387,771 filed on December 16, 2022. The content of the application is incorporated herein by reference in its entirety. GOVERNMENT INTERESTS This invention was made with government support under DK120680 awarded by the National Institutes of Health. The government has certain rights in the invention. REFERENCE TO AN ELECTRONIC SEQUENCE LISTING The present application is being filed along with a Sequence Listing in electronic format. The Sequence Listing is provided as a file entitled 161118_04201_SeqList.xml, created on December 5, 2023, which is 15,100 bytes in size. The information in the electronic format of the Sequence Listing is incorporated herein by reference in its entirety. FIELD OF THE INVENTION This disclosure relates to repairment or improvement of epithelial barrier function in esophagus. BACKGROUND OF THE INVENTION Epithelial and endothelial barriers are essential to life. While the endothelium lines the vasculature and ensures tissue supply with nutrients and oxygen, the epithelium forms the barrier between tissues and the outer environment thus protecting organs from invading harmful agents. Both barriers also play a critical role in the innate immune response to injury and infection. Accordingly, dysfunction in epithelial or endothelial barrier underlies various diseases. For example, breakdown of epithelial barrier function is seen in the esophagus in gastroesophageal reflux disease (GERD) and this breakdown plays a role in progression to esophageal cancer following GERD. Almost one third of adults in the US experience symptoms of GERD. This disease is characterized by a broad spectrum of typical symptoms, such as heartburn and acid regurgitation, and extra-esophageal manifestations, such as asthma, chronic cough and laryngitis1-3. Obesity has been considered to be a key risk factor of GERD. The rising ratesUR 6-23001 / FR Ref.: 161118.04201 of obesity (35.5% for men and 35.8% for women 2005-2009)4are associated with early onset of GERD, as an independent factor (approximately 50% in morbid obesity)5. In addition, those with chronic GERD have a 13-20% life-time risk of progression to Barrett’s esophagus (BE) with a resulting 11 to 40-fold increased risk for development of esophageal adenocarcinoma (EAC)6-10. Although proton pump inhibitors (PPIs) are currently the most effective treatment for GERD and its complications11, up to 45% of patients with GERD remain symptomatic on standard therapy and the incidence of EAC has also increased 600- 700% in the US and other Western Countries over the last 20-30 years12. In addition, long term use of PPIs can cause severe side effects including chronic kidney disease and myocardial infarction13,14. There is an urgent need to develop new methods to treat GERD and in particular PPI refractory GERD, which could decrease occurrence of BE and EAC. SUMMARY OF INVENTION This disclosure addresses the need mentioned above in a number of aspects. In one aspect, the disclosure provides a method of treating a gastroesophageal reflux disease (GERD) in a subject in need thereof. The method comprises expressing a Na+, K+ - ATPase (NKA) β1 subunit or a myotonic dystrophy kinase-related Cdc42-binding kinases α (MRCKα) or both in one or more cells in the esophagus of the subject. Examples of the cells can be transitional basal cells, and suprabasal epithelial cells. In another aspect, the disclosure provides a method of reducing the risk of developing esophageal cancer in a subject in need thereof. The method comprises expressing a NKAβ1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject. In yet another aspect, the disclosure provides a method of increasing expression of a tight junction protein in the esophagus of a subject in need thereof. The method comprises expressing a NKAβ1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject. In some embodiments, the expressing step comprises administering to the subject a genetic construct comprising a nucleic acid sequence encoding the NKAβ1 subunit or the MRCKα or both. In one embodiment, the genetic construct further comprises a regulatory sequence that is operatively linked to the nucleic acid sequence. In one embodiment, the regulatory sequence comprises a promoter or an enhancer. In one embodiment, the promoter is one selected from the group consisting of a CMV promoter, a ubiquitin (Ubc) promoter, a CAG promoter, an EF1a promoter, a SV40 early promoter, and a PGK promoter. In one embodiment, the promoter is an inducible promoter. In one embodiment, the inducibleUR 6-23001 / FR Ref.: 161118.04201 promoter is a tetracycline (doxycycline)-controlled inducible protomer or a tamoxifen- inducible promoter. In one embodiment, the promoter or enhancer is selective or specific for an esophagus cell. In one embodiment, the genetic construct is administered by electroporation or in a liposome. In one embodiment, the genetic construct is administered in an expression vector. In one embodiment, the expression vector is a viral vector, plasmid vector, or bacterial vector. Examples of the viral vector include one selected from the group consisting of a lentiviral vector, an adenoviral vector, an adeno-associated viral vector, and a vaccinia vector. In one embodiment, the subject is mammal. In one embodiment, the subject is a human. The details of one or more embodiments of the disclosure are set forth in the description below. Other features, objectives, and advantages of the disclosure will be apparent from the description and from the claims. BRIEF DESCRIPTION OF THE DRAWINGS FIG. 1 is a set of photographs showing that gene transfer of the Na+,K+-ATPase β1 subunit (“β1”) to the rat esophagus upregulated tight junction proteins. GFP- β1 plasmid or no DNA control was electroporated into the distal esophagus and analyzed 3 days later. n=3 for each condition. FIG.2 is a set of photographs showing that dilated intercellular space (DIS) formation was unaffected by electroporation in the rabbit GERD model. Total cardiomyectomy was carried out with or without simultaneous electroporation of pUbC-GFP and evaluated by TEM at 12 weeks. Yellow arrows show uniform tight junctions and barriers between cells in naive animals. Red arrows show extensive DIS formation (white are between cells due to lack of junctional complexes between cells) in experimental animals. FIG. 3 is a set of photographs showing gene transfer of the β 1 subunit of the Na,K- ATPase prevented formation of DIS in the rabbit GERD model. Total cardiomyectomy was carried out with simultaneous electroporation of pUbC-GFP or pUbC- β 1 and evaluated by TEM at 12 weeks. Naïve animals (no cardiomyectomy) are also shown for comparison. DIS is indicated by the “bubbly” looking white area between cells which is present in animals receiving the GFP plasmid but lacking in those receiving the β1 plasmid. DETAILED DESCRIPTION OF THE INVENTION This disclosure is based, at least in part, on unexpected discoveries that a signaling pathway having the NKA and MRCKα regulates tight junctions in the esophagus and that a gene transfer of at least the NKA β1 subunit can repair barrier breakdown seen in theUR 6-23001 / FR Ref.: 161118.04201 esophagus with GERD. Accordingly, NKA β1, MRCKα, or other components of the signaling pathway can be used as therapeutic for treating GERD, including refractory GERD, and for preventing related disorders or conditions such as BE and cancer, including EAC. Esophageal Epithelium Barrier Functions and GERD Gastroesophageal reflux disease (GERD) is a chronic disorder caused by prolonged exposure of the distal esophagus to gastric or gastroduodenal content. The barrier function of the esophageal epithelium is a major defense against gastroesophageal reflux disease. Dilated intercellular space (DIS) is a special pathological feature of the esophageal squamous epithelium in individuals with GERD, especially in the early stages, that is associated with increased space between cells and decreased barrier function of the epithelium15. In reflux disease, gastro-duodenal contents, the most important of which are stomach acid and bile acids, regurgitate into the distal esophagus and cause DIS formation and loss of barrier function through epithelial injury and disruption of tight and adherent junctions in the human esophagus as well as in animal models of the disease16-18. Indeed, several major tight junction proteins, including claudin-1 and -4 are significantly decreased in GERD patients while the leak protein claudin-2 is increased in GERD patients19,20. One consequence of the reduced barrier function and increased intercellular space in the esophageal squamous epithelium is that bile acids and other reflux constituents continually bathe the cells and decrease the intercellular pH, resulting in cell injury, inflammation, and in turn, tissue repair. Basal progenitor cells underly the squamous epithelium and the adjacent metaplastic and transitional epithelium, and it is believed that these cells, in response to continual exposure to bile acids and reflux constituents, generate BE and lead to EAC. It was recently identified by fate mapping in mouse models a distinct p63+ KRT5+ KRT7+ basal progenitor cell that is the origin for the metaplastic multi-layered epithelium and BE21. Further, chronic mucosal inflammation, largely mediated by T-cells, is associated with GERD functional and structural abnormalities, although the level of contribution to disease progression remains unclear22. The prevailing paradigm is that if the barrier function of this tissue can be restored, cell injury, inflammation, and repair can be avoided, thus abrogating the metaplasia of columnar epithelium that develops as a replacement for damaged squamous epithelium that ultimately progresses to BE and EAC22,23. Tight junctions are composed of a large family of proteins, including transmembrane proteins (occludin, claudins, and JAM), scaffolding proteins (zo-1, zo-2, zo-3, Cingulin, etc.),UR 6-23001 / FR Ref.: 161118.04201 and signaling proteins (Rho family GTPase, kinases, phosphatases). Studies were carried out to examine signaling pathways that regulate esophageal epithelial tight junctions. It was demonstrated that over or forced expression of the NKA β1 subunit resulted in complete prevention of DIS formation. The barrier-enhancing effect of the Na+, K+-ATPase is specific to the β1 subunit and appears to be independent on the ion-transport activity. Targeting this pathway provides a new therapeutic strategy to treat GERD. The Na+, K+-ATPase is a heterodimer of the catalytic α subunit and the noncatalytic β subunit, which facilitates the maturation and membrane targeting of the α subunit. Using loss-of-function, chemical inhibition, and gain-of-function experiments, it was revealed that a novel molecular pathway by which the NKA β1 subunit binds and activates MRCKα, thereby phosphorylates non-muscle myosin II and increase tight junction expression. See, e.g., WO2020150300, the content of which is incorporated in its entirety. MRCKα is a Serine / Threonine protein kinase. List below are the cDNA sequence of human MRCKα (also known as CDC42BPA) open reading frame (ORF; SEQ ID NO: 1) and amino acid sequence (SEQ ID NO: 2): SEQ ID NO: 1 atgtctggagaagtgcgtttgaggcagttggagcagtttattttggacgggcccgctcagaccaatgggcagtgcttcagtgt ggagacattactggatatactcatctgcctttatgatgaatgcaataattctccattgagaagagagaagaacattctcgaat acctagaatgggctaaaccatttacttctaaagtgaaacaaatgcgattacatagagaagactttgaaatattaaaggtgatt ggtcgaggagcttttggggaggttgctgtagtaaaactaaaaaatgcagataaagtgtttgccatgaaaatattgaataaatg ggaaatgctgaaaagagctgagacagcatgttttcgtgaagaaagggatgtattagtgaatggagacaataaatggattacaa ccttgcactatgctttccaggatgacaataacttatacctggttatggattattatgttggtggggatttgcttactctactc agcaaatttgaagatagattgcctgaagatatggctagattttacttggctgagatggtgatagcaattgactcagttcatca gctacattatgtacacagagacattaaacctgacaatatactgatggatatgaatggacatattcggttagcagattttggtt cttgtctgaagctgatggaagatggaacggttcagtcctcagtggctgtaggaactccagattatatctctcctgaaatcctt caagccatggaagatggaaaagggagatatggacctgaatgtgactggtggtctttgggggtctgtatgtatgaaatgcttta cggagaaacaccattttatgcagaatcgctggtggagacatacggaaaaatcatgaaccacaaagagaggtttcagtttccag cccaagtgactgatgtgtctgaaaatgctaaggatcttattcgaaggctcatttgtagcagagaacatcgacttggtcaaaat ggaatagaagactttaagaaacacccatttttcagtggaattgattgggataatattcggaactgtgaagcaccttatattcc agaagttagtagcccaacagatacatcgaattttgatgtagatgatgattgtttaaaaaattctgaaacgatgcccccaccaa cacatactgcattttctggccaccatctgccatttgttggttttacatatactagtagctgtgtactttctgatcggagctgt ttaagagttacggctggtcccacctcactggatcttgatgttaatgttcagaggactctagacaacaacttagcaactgaagc ttatgaaagaagaattaagcgccttgagcaagaaaaacttgaactcagtagaaaacttcaagagtcaacacagactgtccaag ctctgcagtattcaactgttgatggtccactaacagcaagcaaagatttagaaataaaaaacttaaaagaagaaattgaaaaa ctaagaaaacaagtaacagaatcaagtcatttggaacagcaacttgaagaagctaatgctgtgaggcaagaactagatgatgc ttttagacaaatcaaggcttatgaaaaacaaatcaaaacgttacaacaagaaagagaagatctaaataaggaactagtccagg ctagtgagcgattaaaaaaccaatccaaagagctgaaagacgcacactgtcagaggaaactggccatgcaggaattcatggag atcaatgagcggctaacagaattgcacacccaaaaacagaaacttgctcgccatgtccgagataaggaagaagaggtggacct ggtgatgcaaaaagttgaaagcttaaggcaagaactgcgcagaacagaaagagccaaaaaagagctggaagttcatacagaag ctctagctgctgaagcatctaaagacaggaagctacgtgaacagagtgagcactattctaagcaactggaaaatgaattggag ggactgaagcaaaaacaaattagttactcaccaggagtatgcagcatagaacatcagcaagagataaccaaactaaagactga tttggaaaagaaaagtatcttttatgaagaagaattatctaaaagagaaggaatacatgcaaatgaaataaaaaatcttaaga aagaactgcatgattcagaaggtcagcaacttgctctcaacaaagaaattatgattttaaaagacaaattggaaaaaaccaga agagaaagtcaaagtgaaagggaggaatttgaaagtgagttcaaacaacaatatgaacgagaaaaagtgttgttaactgaaga aaataaaaagctgacgagtgaacttgataagcttactactttgtatgagaacttaagtatacacaaccagcagttagaagaag aggttaaagatctagcagacaagaaagaatcagttgcacattgggaagcccaaatcacagaaataattcagtgggtcagcgat gaaaaggatgcacgagggtatcttcaggccttagcttctaaaatgactgaagaattggaggcattaagaaattccagcttggg tacacgagcaacagatatgccctggaaaatgcgtcgttttgcgaaactggatatgtcagctagactggagttgcagtcggctc tggatgcagaaataagagccaaacaggccatccaagaagagttgaataaagttaaagcatctaatatcataacagaatgtaaa ctaaaagattcagagaagaagaacttggaactactctcagaaatcgaacagctgataaaggacactgaagagcttagatctgaUR 6-23001 / FR Ref.: 161118.04201 aaaggctagcaaaggcagacgtactgtagactccactccactttcagttcacacaccaaccttaaggaaaaaaggatgtcctg gttcaactggctttccacctaagcgcaagactcaccagttttttgtaaaatcttttactactcctaccaagtgtcatcagtgt acctccttgatggtgggtttaataagacagggctgttcatgtgaagtgtgtggattctcatgccatataacttgtgtaaacaa agctccaaccacttgtccagttcctcctgaacagacaaaaggtcccctgggtatagatcctcagaaaggaataggaacagcat atgaaggtcatgtcaggattcctaagccagctggagtgaagaaagggtggcagagagcactggctatagtgtgtgacttcaaa ctctttctgtacgatattgctgaaggaaaagcatctcagcccagtgttgtcattagtcaagtgattgacatgagggatgaaga attttctgtgagttcagtcttggcttctgatgttatccatgcaagtcggaaagatataccctgtatatttagggtcacagctt cccagctctcagcatctaataacaaatgttcaatcctgatgctagcagacactgagaatgagaagaataagtgggtgggagtg ctgagtgaattgcacaagattttgaagaaaaacaaattcagagaccgctcagtctatgttcccaaagaggcttatgacagcac tctacccctcattaaaacaacccaggcagccgcaatcatagatcatgaaagaattgctttgggaaacgaagaagggttatttg ttgtacatgtcaccaaagatgaaattattagagttggtgacaataagaagattcatcagattgaactcattccaaatgatcag cttgttgctgtgatctcaggacgaaatcgtcatgtacgactttttcctatgtcagcattggatgggcgagagaccgattttta caagctgtcagaaactaaagggtgtcaaaccgtaacttctggaaaggtgcgccatggagctctcacatgcctgtgtgtggcta tgaaaaggcaggtcctctgttatgaactatttcagagcaagacccgtcacagaaaatttaaagaaattcaagtcccatataat gtccagtggatggcaatcttcagtgaacaactctgtgtgggattccagtcaggatttctaagataccccttgaatggagaagg aaatccatacagtatgctccattcaaatgaccatacactatcatttattgcacatcaaccaatggatgctatctgcgcagttg agatctccagtaaagaatatctgctgtgttttaacagcattgggatatacactgactgccagggccgaagatctagacaacag gaattgatgtggccagcaaatccttcctcttgttgttacaatgcaccatatctctcggtgtacagtgaaaatgcagttgatat ctttgatgtgaactccatggaatggattcagactcttcctctcaaaaaggttcgacccttaaacaatgaaggatcattaaatc ttttagggttggagaccattagattaatatatttcaaaaataagatggcagaaggggacgaactggtagtacctgaaacatca gataatagtcggaaacaaatggttagaaacattaacaataagcggcgttattccttcagagtcccagaagaggaaaggatgca gcagaggagggaaatgctacgagatccagaaatgagaaataaattaatttctaatccaactaattttaatcacatagcacaca tgggtcctggagatggaatacagatcctgaaagatctgcccatgaaccctcggcctcaggaaagtcggacagtattcagtggc tcagtcagtattccatctatcaccaaatcccgccctgagccaggccgctccatgagtgctagcagtggcttgtcagcaaggtc atccgcacagaatggcagcgcattaaagagggaattctctggaggaagctacagtgccaagcggcagcccatgccctccccgt cagagggctctttgtcctctggaggcatggaccaaggaagtgatgccccagcgagggactttgacggagaggactctgactct ccgaggcattccacagcttccaacagttccaacctaagcagccccccaagcccagtttcaccccgaaaaaccaagagcctctc cctggagagcactgaccgcgggagctgggacccgtga SEQ ID NO: 2 (1732 aa) MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQMRLHRE DFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTLHYAFQDDNNL YLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLK LMEDGTVQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIPEVSSPTDTSNFDVDD DCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTAGPTSLDLDVNVQRTLDNNLATEAYERRIKR LEQEKLELSRKLQESTQTVQALQYSTVDGPLTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDD AFRQIKAYEKQIKTLQQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV RDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSP GVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRES QSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEII QWVSDEKDARGYLQALASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL NKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFERSPSCTP ASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSC HITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQ PSVVISQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELH KILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIP NDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVAMKRQVLCYELFQSKTRH RKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLL CFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNL LGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPT NFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREF SGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLEST DRGSWDP List below are the amino acid sequence of human NKA β1 and an exemplary nucleic acid sequence encoding human NKA β1.UR 6-23001 / FR Ref.: 161118.04201 SEQ ID NO: 3 (303 aa) MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPP GLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCR FKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVG NVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIE VKS SEQ ID NO: 4 (NCBI Reference Sequence: NM_001677.4; coding sequence underlined: SEQ ID NO: 5) 1 actccgagag ccgcagcggc agcggcgcgt cctgcctgca gagagccagg ccggagaagc 61 cgagcggcgc agaggacgcc agggcgcgcg ccgcagccac ccaccctccg gaccgcggca 121 gctgctgacc cgccatcgcc atggcccgcg ggaaagccaa ggaggagggc agctggaaga 181 aattcatctg gaactcagag aagaaggagt ttctgggcag gaccggtggc agttggttta 241 agatccttct attctacgta atattttatg gctgcctggc tggcatcttc atcggaacca 301 tccaagtgat gctgctcacc atcagtgaat ttaagcccac atatcaggac cgagtggccc 361 cgccaggatt aacacagatt cctcagatcc agaagactga aatttccttt cgtcctaatg 421 atcccaagag ctatgaggca tatgtactga acatagttag gttcctggaa aagtacaaag 481 attcagccca gagggatgac atgatttttg aagattgtgg cgatgtgccc agtgaaccga 541 aagaacgagg agactttaat catgaacgag gagagcgaaa ggtctgcaga ttcaagcttg 601 aatggctggg aaattgctct ggattaaatg atgaaactta tggctacaaa gagggcaaac 661 cgtgcattat tataaagctc aaccgagttc taggcttcaa acctaagcct cccaagaatg 721 agtccttgga gacttaccca gtgatgaagt ataacccaaa tgtccttccc gttcagtgca 781 ctggcaagcg agatgaagat aaggataaag ttggaaatgt ggagtatttt ggactgggca 841 actcccctgg ttttcctctg cagtattatc cgtactatgg caaactcctg cagcccaaat 901 acctgcagcc cctgctggcc gtacagttca ccaatcttac catggacact gaaattcgca 961 tagagtgtaa ggcgtacggt gagaacattg ggtacagtga gaaagaccgt tttcagggac 1021 gttttgatgt aaaaattgaa gttaagagct gatcacaagc acaaatcttt cccactagcc 1081 atttaataag ttaaaaaaag atacaaaaac aaaaacctac tagtcttgaa caaactgtca 1141 tacgtatggg acctacactt aatctatatg ctttacacta gctttctgca tttaataggt 1201 tagaatgtaa attaaagtgt agcaatagca acaaaatatt tattctactg taaatgacaa 1261 aagaaaaaga aaaattgagc cttgggacgt gcccattttt actgtaaatt atgattccgt 1321 aactgacttg tagtaagcag tgtttctggc ccctaagtat tgctgccttg tgtattttat 1381 ttagtgtaca gtactacagg tgcatactct ggtcattttt caagccatgt tttattgtat 1441 ctgttttcta ctttatgtga gcaaggtttg ctgtccaagg tgtaaatatt caacgggaat 1501 aaaactggca tggtaatttt tttttttttt ttttttttgt tttttggctc tttcaaaggt 1561 aatggcccat cgatgagcat ttttaacata ctccatagtc ttttcctgtg gtgttaggtc 1621 tttattttta tttttttcct gggggctggg gtgggggttt gtcatggggg aactgccctt 1681 taaattttaa gtgacactac agaaaaacac aaaaaggtga tgggttgtgt tatgcttgta 1741 ttgaatgctg tcttgacatc tcttgccttg tcctccggta tgttctaaag ctgtgtctga 1801 gatctggatc tgcccatcac tttggctagt gacagggcta attaatttgc tttatacatt 1861 ttcttttact ttcctttttt cctttctgga ggcatcacat gctggtgctg tgtctttatg 1921 aatgttttaa ccattttcat ggtggaagaa ttttatattt atgcagttgt acaattttat 1981 ttttttctgc aagaaaaagt gtaatgtatg aaataaacca aagtcacttg tttgaaaata 2041 aatctttatt ttgaacttta taaaaagcaa tgcagtaccc catagactgg tgttaaatgt 2101 tgtctacagt gcaaaatcca tgttctaaca tatgtaataa ttgccaggag tacagtgctc 2161 ttgttgatct tgtattcagt caggttaaaa caacggacaa taaaagaatg aacaca Repairment or Improvement of Barrier Dysfunction in Esophagus The Na+, K+-ATPase is well-known for its transport activity – moving Na+out of the cell and importing K+. The results herein have identified new functions of this enzyme. The data disclosed herein indicated a non-transport role of the NKA β1 subunit in the regulation of tight junctions in esophagus. This disclosure has enhanced the understanding of the Na+, K+-ATPase and MRCKα and is valuable in advancing related therapies to human clinicalUR 6-23001 / FR Ref.: 161118.04201 trials. Accordingly, this disclosure provides agents and methods for improving or repairing integrity or function of an esophageal epithelial barrier. The methods in general may comprise increasing a level of the NKA β1 subunit or the MRCKα in one or more cells in the epithelial or endothelial barrier. In certain aspect, the disclosure provides compositions and method for treating or preventing related diseases. The present disclosure provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with integrity or function of an epithelial or endothelial barrier in esophagus. Another aspect of the disclosure pertains to methods of modulating NKA β1 and / or MRCKα expression or activity for therapeutic purposes. Accordingly, in an exemplary embodiment, the modulatory method of the disclosure involves contacting a cell with an active agent or compound that modulates one or more of the activities of NKA β1 and / or MRCKα activity associated with the cell. An active compound that modulates NKA β1 and / or MRCKα activity can be an agent as described herein. In some embodiments, the active agent can be NKA β1 or MRCKα protein or polypeptide, or a nucleic acid molecule encoding NKA β1 or MRCKα. In some embodiments, the active agent can be a nucleic acid or a protein, a naturally-occurring target molecule of an MRCKα protein (e.g., an MRCKα ligand or substrate). In some embodiments, the active agent can be agonist of MRCKα or NKA β1, a peptidomimetic of an MRCKα or NKA β1 agonist, or other small molecule. In one embodiment, the active compound stimulates one or more NKA β1 and / or MRCKα activities. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the active compound) or, alternatively, in vivo (e.g., by administering the active compound to a subject). As such, the present disclosure provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant or insufficient expression or activity of an NKA β1 or MRCKα protein or nucleic acid molecule such as a GERD. In one embodiment, the method involves administering an active compound, or combination of active compounds that modulates (e.g., upregulates) NKA β1 and / or MRCKα expression or activity. In another embodiment, the method involves administering a chimeric NKA β1 and / or MRCKα protein or nucleic acid molecule as therapy to compensate for reduced, aberrant, or unwanted NKA β1 and / or MRCKα expression or activity. The present disclosure also provides for replacement of NKA β1 and / or MRCKα, whether by gene transfer to express the normal allele or protein replacement with purified NKA β1 and / or MRCKα or recombinant NKA β1 and / or MRCKα or NKA β1 and / orUR 6-23001 / FR Ref.: 161118.04201 MRCKα analogues, are beneficial for the treatment of, e.g., GERD. The active agent, e.g., the NKA β1 and / or MRCKα gene or protein, may be administered by any suitable ways known in the art. Polypeptides In some embodiments, the present disclosure provides a method of introducing NKA β1 and / or MRCKα polypeptides into the cells. In one embodiment, the NKA β1 is a human NKA β1. In one embodiment, the human NKA β1 has the amino acid sequence set out in SEQ ID NO: 3. The term "NKA β1" also includes variants of the protein of SEQ ID NO: 3, in which one or more amino acid residues have been changed, deleted, or inserted, and which has comparable biological activity as the not modified protein, such as those reported herein. These variants may have the same activity as SEQ ID NO: 3. Examples of such variants include XP_004027909.1, NP_001092025.1. CAG28544.1. XP_030679871.1, AAC50132.1, and NP_001182459.1. In one embodiment, the MRCKα is a human MRCKα. In one embodiment, the human MRCKα has the amino acid sequence set out in SEQ ID NO: 2. The term "MRCKα" also denotes variants of the protein of SEQ ID NO: 2, in which one or more amino acid residues have been changed, deleted, or inserted, and which has comparable biological activity as the not modified protein, such as those reported herein. A number of splice variants of MRCKα are known in the art and result in slightly different translated proteins. Some of them may have difference in about 50 of their amino acid residues but the remainder are the same while some other variants produce slightly smaller proteins. These variants may have the same activity as SEQ ID NO: 2. Examples of such variants include NM_001366011.1, NM_001366019.1, NM_003607.3, NM_001366010.1, XM_017002581.2, and XM_011544307.3. The specific activity of MRCKα can be determined by various assays known in the art or described herein. Amino acid sequence variants of NKA β1 or MRCKα can be prepared by introducing appropriate modifications into the nucleotide sequence encoding the NKA β1 or MRCKα, or by peptide synthesis. Such modifications include, for example, deletions from, and / or insertions into, and / or substitutions of residues within the amino acid sequences of the NKA β1 or MRCKα. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses comparable biological activity to the human NKA β1 or MRCKα.UR 6-23001 / FR Ref.: 161118.04201 As used herein, the term "conservative sequence modifications" refers to amino acid modifications that do not significantly affect or alter the activity of the NKA β1 or MRCKα. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. Amino acid substitutions can be made, in some cases, by selecting substitutions that do not differ significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, (b) the charge or hydrophobicity of the molecule at the target sit; or (c) the bulk of the side chain. For example, naturally occurring residues can be divided into groups based on side-chain properties; (1) hydrophobic amino acids (norleucine, methionine, alanine, valine, leucine, and isoleucine); (2) neutral hydrophilic amino acids (cysteine, serine, threonine, asparagine, and glutamine,); (3) acidic amino acids (aspartic acid and glutamic acid); (4) basic amino acids (histidine, lysine, and arginine); (5) amino acids that influence chain orientation (glycine and proline); and (6) aromatic amino acids (tryptophan, tyrosine, and phenylalanine). Substitutions made within these groups can be considered conservative substitutions. Examples of substitutions include, without limitation, substitution of valine for alanine, lysine for arginine, glutamine for asparagine, glutamic acid for aspartic acid, serine for cysteine, asparagine for glutamine, aspartic acid for glutamic acid, proline for glycine, arginine for histidine, leucine for isoleucine, isoleucine for leucine, arginine for lysine, leucine for methionine, leucine for phenylalanine, glycine for proline, threonine for serine, serine for threonine, tyrosine for tryptophan, phenylalanine for tyrosine, and / or leucine for valine. Exemplary substitutions are shown in the table below. Amino acid substitutions may be introduced into human NKA β1 or MRCKα and the products screened for retention of the biological activity of human NKA β1 or MRCKα.UR 6-23001 / FR Ref.: 161118.04201As used herein, "functional equivalent" of a polypeptide (e.g., NKA β1 or MRCKα) refers to a nucleic acid molecule that encodes a polypeptide that has a NKA β1 or MRCKα activity or a polypeptide that has a NKA β1 or MRCKα activity. The functional equivalent may displays 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, 100% or more activity compared to a parent sequence (e.g., SEQ ID NO: 2 or 3). Functional equivalents may be artificial or naturally-occurring. For example, naturally-occurring variants of the sequence in a population fall within the scope of functional equivalent. NKA β1 or MRCKα sequences derived from other species also fall within the scope of the term "functional equivalent", e.g., a murine NKA β1 or MRCKα sequence. In a particular embodiment, the functional equivalent is a nucleic acid with a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% identity to the parent sequence. In a further embodiment, the functional equivalent is a polypeptide with an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% identity to a parent sequence. In the case of functional equivalents, sequence identity should be calculated along the entire length of the nucleic acid. Functional equivalents may contain one or more, e.g. 2, 3, 4, 5, 10, 15, 20, 30 or more, nucleotide insertions, deletions and / or substitutions when compared to a parent sequence. The term "functional equivalent" also encompasses nucleic acid sequences that encode a NKA β1 or MRCKα polypeptide with at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% sequence identity to the parent amino acid sequence, but that show little homology to the parent nucleic acid sequence because of the degeneracy of the genetic code. As used herein, the term "active fragment" refers to a nucleic acid molecule that encodes a polypeptide that has an activity of a parent polypeptide (e.g., MRCKα kinase activity) or polypeptide that has the activity, but which is a fragment of the nucleic acid as set forth in the parent polynucleotide sequence or the amino acid sequence as set forth in theUR 6-23001 / FR Ref.: 161118.04201 parent polypeptide sequence. An active fragment may be of any size provided that the activity is retained or it has the active domain. A fragment will have at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 100% identity to the parent sequence along the length of the alignment between the shorter fragment and longer parent sequence. Fusion proteins including these fragments can be comprised in the nucleic acid vectors needed to carry out the methods. For example, an additional 5, 10, 20, 30, 40, 50 or even 100 amino acid residues from the polypeptide sequence, or from a homologous sequence, may be included at either or both the C terminal and / or N terminus without prejudicing the ability of the polypeptide fragment to fold correctly and exhibit biological activity. Sequence identity may be calculated by any one of the various methods in the art, including for example BLAST (Altschul S F, Gish W, Miller W, Myers E W, Lipman D J (1990). "Basic local alignment search tool". J Mol Biol 215 (3): 403-410) and PASTA (Lipman, D J; Pearson, W R (1985). "Rapid and sensitive protein similarity searches". Science 227 (4693): 1435-41; http: / / fasta.bioch.virginia.edu / fasta www2 / fasta list2.shtml) and variations on these alignment programs. The polypeptides described in this application can be prepared by conventional methods known in the art. Polypeptide Delivery A NKA β1 or MRCKα polypeptide described herein can be delivered into cells of interest via protein transfection or transduction. The polypeptide can be obtained as a recombinant polypeptide. For example, to prepare a recombinant polypeptide, a nucleic acid encoding it can be linked to another nucleic acid encoding a fusion partner, e.g., glutathione- s-transferase (GST), 6x-His epitope tag, or M13 Gene 3 protein. The resultant fusion nucleic acid expresses in suitable host cells a fusion protein that can be isolated by methods known in the art. The isolated fusion protein can be further treated, e.g., by enzymatic digestion, to remove the fusion partner and obtain the recombinant polypeptide of this disclosure. Alternatively, the peptides / polypeptides / proteins of the disclosure can be chemically synthesized (see e.g., Creighton, “Proteins: Structures and Molecular Principles,” W.H. Freeman & Co., NY, 1983). For additional guidance, skilled artisans may consult Ausubel et al. (Current Protocols in Molecular Biology and Short Protocols in Molecular Biology, 3rd Ed. 2002 & 2002), Sambrook et al. (Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, NY, 2012), and chemical synthesis Gait, M.J. Ed. (Oligonucleotide Synthesis, IRL Press, Oxford, 1984).UR 6-23001 / FR Ref.: 161118.04201 The NKA β1 or MRCKα polypeptide can be associated with, e.g., conjugated or fused to, one or more of an amino acid sequence comprising a cell-penetrating peptide (CPP) sequence, and the like. In this manner, a composition of this disclosure as discussed below can include a transport enhancer. The NKA β1 or MRCKα polypeptide may be delivered by itself or as a fusion with one or more of a CPP and / or other domains. See, e.g., Tachikawa et al. PNAS (2004) vol.101, no.42:15225-15230, US 20090156503. A cell-penetrating peptide (CPP) generally consists of less than 30 amino acids and has a net positive charge. CPPs internalize in living animal cells in vitro and in vivo in an endocytotic or receptor / energy- independent manner. There are several classes of CPPs with various origins, from totally protein-derived CPPs via chimeric CPPs to completely synthetic CPPs. Examples of CPPs are known in the art. See, e.g., U.S. Application Nos.20090099066 and 20100279918. It is known that CPPs can deliver an exogenous protein to various cells. Various other cell-penetrating molecules are known in the art and can be used in this disclosure. In some embodiments, a cell-penetrating molecule may comprise a phosphorothioate nucleic acid. It is known in the art that phosphorothioate nucleic acids can enhance the intracellular delivery of both proteins and nucleic acids. See, e.g., US20190365905, WO2019014648, US 20190119259, US 20180243436, US 20180230237, US 20180008667, US 20160317671, and Herrmann et al, JCI Insight.2019. The term “phosphorothioate nucleic acid” refers to a nucleic acid in which one or more internucleotide linkages are through a phosphorothioate moiety (thiophosphate). The phosphorothioate moiety may be a monothiophosphate (—P(O)3(S)3−—) or a dithiophosphate (—P(O)2(S)23−—). In some embodiments, the phosphorothioate nucleic acid can be a monothiophosphate nucleic acid. In some embodiments, one or more of the nucleosides of a phosphorothioate nucleic acid can be linked through a phosphorothioate moiety (e.g., monothiophosphate), and the remaining nucleosides can be linked through a phosphodiester moiety (—P(O)43−—). In some embodiments, one or more of the nucleosides of a phosphorothioate nucleic acid can be linked through a phosphorothioate moiety (e.g., monothiophosphate), and the remaining nucleosides can be linked through a methylphosphonate linkage. In some embodiments, all the nucleosides of a phosphorothioate nucleic acid can be linked through a phosphorothioate moiety (e.g., a monothiophosphate). Phosphorothioate oligonucleotides (phosphorothioate nucleic acids) are typically from about 5, 6, 7, 8, 9, 10, 12, 15, 20, 25, 30, 40, 50 or more nucleotides in length, up to about 100 nucleotides in length. Phosphorothioate nucleic acids may also be longer in lengths, e.g.,UR 6-23001 / FR Ref.: 161118.04201 200, 300, 500, 1000, 2000, 3000, 5000, 7000, 10,000, etc. As described above, in certain embodiments, the phosphorothioate nucleic acids herein contain one or more phosphodiester bonds. In other embodiments, the phosphorothioate nucleic acids can include alternate backbones (e.g., mimics or analogs of phosphodiesters as known in the art, such as boranophosphate, methylphosphonate, phosphoramidate, or O-methylphosphoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press). The phosphorothioate nucleic acids may also include one or more nucleic acid analog monomers known in the art, such as peptide nucleic acid monomer or polymer, locked nucleic acid monomer or polymer, morpholino monomer or polymer, glycol nucleic acid monomer or polymer, or threose nucleic acid monomer or polymer. Other analog nucleic acids include those with positive backbones; non-ionic backbones, and non-ribose backbones, including those described in U.S. Pat. Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC Symposium Series 580, Carbohydrate Modifications in Antisense Research, Sanghui & Cook, eds. Both naturally occurring NKA β1 or MRCKα proteins, as well as recombinant NKA β1 or MRCKα, can be used in the methods and applications disclosed herein. The term “NKA β1” or “MRCKα” also covers chemically modified NKA β1 or MRCKα. Examples of chemically modified NKA β1 or MRCKα include NKA β1 or MRCKα subjected to a conformational change, addition or deletion of one or more post-translation modifications and NKA β1 or MRCKα to which a compound such as a phosphorothioate nucleic acids or a polyethylene glycol has been bound. Once purified and tested by standard methods or according to the method described in the examples below, NKA β1 or MRCKα can be included in a pharmaceutical composition. Recombinant NKA β1 or MRCKα protein may be prepared via expression in eukaryotic cells, for example in CHO cells, BHK cells, or HeLa cells by recombinant DNA technology or by endogenous gene activation, i.e., the NKA β1 or MRCKα protein is expressed by endogenous gene activation, see, for example, U.S. Pat. No. 5,733,761, U.S. Pat. No. 5,641,670, U.S. Pat. No. 5,733,746, WO 93 / 09222, WO 94 / 12650, WO 95 / 31560, WO 90 / 11354, WO 91 / 06667, and WO 91 / 09955. These documents are incorporated herein by reference. Nucleic Acids and Gene Therapy As summarized above, one aspect of this disclosure includes a method of improving integrity or function of an esophageal epithelial barrier, comprising increasing a level ofUR 6-23001 / FR Ref.: 161118.04201 NKA β1 and / or MRCKα in one or more cells in the epithelial barrier. Other aspects of the disclosure include methods of treating a disease or condition associated with compromised function of an esophageal epithelial barrier comprising increasing a level of NKA β1 and / or MRCKα in one or more cells in the epithelial or endothelial barrier of a subject in need thereof. In one embodiment, methods are provided for supplying NKA β1 and / or MRCKα function to cells of the esophagus, such as basal cells, epithelial cells, and endothelial cells, by gene therapy. The NKA β1 and / or MRCKα genes, a modified NKA β1 and / or MRCKα gene, or a part of the gene may be introduced into the cell in a vector such that the gene remains extrachromosomal or may be integrated into the subjects chromosomal DNA for expression. These methods provide for administering to a subject in need of such treatment a therapeutically effective amount of an NKA β1 and / or MRCKα gene, or pharmaceutically acceptable composition thereof, for overexpressing the NKA β1 and / or MRCKα gene. The MRCKα or NKA β1 gene or a part of the gene may or may not be integrated (covalently linked) to chromosomal DNA making up the genome of the subject's target cells. The genes may be introduced into the cell such that the gene remains extrachromosomal. In such a situation, the gene will be expressed by the cell from the extrachromosomal location. The cells may also be transformed where the exogenous DNA has become integrated into the chromosome so that it is inherited by daughter cells through chromosome replication. The gene may be introduced into an appropriate vector for extrachromosomal maintenance or for integration into the host. Vectors for introduction of genes both for recombination and for extrachromosomal maintenance are known in the art, and any suitable vector may be used. Methods for introducing DNA into cells such as electroporation, calcium phosphate co- precipitation, lipid / liposome-based methods, and viral transduction are known in the art, and the choice of method is within the competence of those in the art. The gene of the present disclosure as described herein is a polynucleotide or nucleic acid which may be in the form of RNA or in the form of DNA, which DNA includes cDNA, genomic DNA, and synthetic DNA. The DNA may be double-stranded or single-stranded, and if single stranded may be the coding strand or non-coding (anti-sense) strand. The coding sequence of MRCKα polynucleotide which encodes the mature polypeptide identified by SEQ ID NO: 2 may be identical or different from SEQ ID NO: 1. Similarly, the coding sequence of NKA β1 polynucleotide which encodes the mature polypeptide identified by SEQ ID NO: 3 may be identical or different from SEQ ID NO: 4 or 5. However, as a resultUR 6-23001 / FR Ref.: 161118.04201 of the redundancy or degeneracy of the genetic code, said coding sequence encodes the same mature polypeptide. The polynucleotide or nucleic acid which encodes for the mature MRCKα or NKA β1 polypeptide may include: only the coding sequence for the mature polypeptide; the coding sequence for the mature polypeptide and additional coding sequence; the coding sequence for the mature polypeptide (and optionally additional coding sequence) and non-coding sequence, such as introns or non-coding sequence 5' and / or 3' of the coding sequence for the mature polypeptide. The polynucleotide or nucleic acid compositions or molecules of this disclosure can include RNA, cDNA, genomic DNA, synthetic forms, and mixed polymers, both sense and antisense strands, and may be chemically or biochemically modified or may contain non- natural or derivatized nucleotide bases, as will be readily appreciated by those skilled in the art. Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.), charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, etc.), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, etc.). Also included are synthetic molecules that mimic polynucleotides in their ability to bind to a designated sequence via hydrogen bonding and other chemical interactions. Such molecules are known in the art and include, for example, those in which peptide linkages substitute for phosphate linkages in the backbone of the molecule. In vivo expression of NKA β1 and / or MRCKα transgenes can be carried out by injection of transgenes directly into a specific tissue, such as direct injection of naked DNA or of DNA-cationic liposome complexes, or to ex vivo transfection of host cells, with subsequent reinfusion. Multiple approaches for introducing functional new genetic material into cells, both in vitro and in vivo are known. These approaches include integration of the gene to be expressed into modified retroviruses; integration into non-virus vectors; or delivery of a transgene linked to a heterologous promoter-enhancer element via liposomes; coupled to ligand-specification-based transport systems or the use of naked DNA expression vectors. Direct injection of transgenes into tissue produces localized expression PCT / US90 / 01515 (Felgner et al.) is directed to methods for delivering a gene coding for a pharmaceutical or immunogenic polypeptide to the interior of a cell of a vertebrate in vivo. While most geneUR 6-23001 / FR Ref.: 161118.04201 therapy strategies have relied on transgene insertion into retroviral or DNA virus vectors, lipid carriers, may be used to transfect the esophagus cells of the host. The polynucleotides or nucleic acids described above may be produced by replication in a suitable host cell. Natural or synthetic polynucleotide fragments coding for a desired fragment can be incorporated into recombinant polynucleotide constructs, usually DNA constructs, capable of introduction into and replication in a prokaryotic or eukaryotic cell. Usually the polynucleotide constructs can be suitable for replication in a unicellular host, such as yeast or bacteria, but may also be intended for introduction to (with and without integration within the genome) cultured mammalian or plant or other eukaryotic cell lines. The polynucleotides or nucleic acids may also be produced by chemical synthesis and may be performed on commercial, automated oligonucleotide synthesizers. A double- stranded fragment may be obtained from the single-stranded product of chemical synthesis either by synthesizing the complementary strand and annealing the strands together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence. Polynucleotide or nucleic acid constructs prepared for introduction into a prokaryotic or eukaryotic host may comprise a replication system recognized by the host, including the intended polynucleotide fragment encoding the desired polypeptide, and will preferably also include transcription and translational initiation regulatory sequences operably linked to the polypeptide encoding segment. Expression vectors may include, for example, an origin of replication or autonomously replicating sequence (ARS) and expression control sequences, a promoter, an enhancer and necessary processing information sites, such as ribosome-binding sites, RNA splice sites, polyadenylation sites, transcriptional terminator sequences, and mRNA stabilizing sequences. Such vectors may be prepared by means of standard recombinant techniques well known in the art. An appropriate promoter and other necessary vector sequences can be selected so as to be functional in the host, and may include, when appropriate, those naturally associated with NKA β1 and / or MRCKα genes. Many useful vectors are known in the art and may be obtained from such vendors as STRATAGENE, NEW ENGLAND BIOLABS, PROMEGA BIOTECH, and others. Promoters such as the trp, lac and phage promoters, tRNA promoters and glycolytic enzyme promoters may be used in prokaryotic hosts. Useful yeast promoters include promoter regions for metallothionein, 3-phosphoglycerate kinase or other glycolytic enzymes such as enolase or glyceraldehyde-3-phosphate dehydrogenase, enzymes responsible for maltose and galactose utilization, and others. Appropriate non-nativeUR 6-23001 / FR Ref.: 161118.04201 mammalian promoters might include the early and late promoters from SV40 or promoters derived from murine Moloney leukemia virus, mouse tumor virus, avian sarcoma viruses, adenovirus II, bovine papilloma virus or polyoma. In addition, the construct may be joined to an amplifiable gene so that multiple copies of the gene may be made. In one embodiment, the nucleic acid construct can include at least one promoter selected from the group consisting of RNA polymerase III, RNA polymerase II, CMV promoter and enhancer, SV40 promoter, an HBV promoter, an HCV promoter, an HSV promoter, an HPV promoter, an EBV promoter, an HTLV promoter, an HIV promoter, and cdc25C promoter, a cyclin a promoter, a cdc2 promoter, a bmyb promoter, a DHFR promoter and an E2F-1 promoter. In some embodiments, one can use an Ubiquitin C promoter for long-term expression. According to one embodiment of the present disclosure, a method is provided of supplying MRCKα or NKA β1 function to cells of the esophagus, such as basal cells and epithelial cells, by MRCKα or NKA β1 gene therapy. The MRCKα or NKA β1 gene, a modified MRCKα or NKA β1 gene, or a part of the gene may be introduced into the cell in a vector such that the gene remains extrachromosomal. In such a situation, the gene will be expressed by the cell from the extrachromosomal location. In accordance with the present disclosure, there is provided a method of treating or preventing an esophagus disease or condition (such as GERD, BE, and EAC) comprising the administration to a patient in need of such treatment a therapeutically effective amount of a nucleic acid encoding NKA β1 and / or MRCKα, or pharmaceutically acceptable composition thereof. Aspects of the methods include administering to the subject a first nucleic acid alone or in a vector including a coding sequence for NKA β1 subunit and / or a second nucleic alone or in a vector encoding an MRCKα polypeptide. In some cases, the first nucleic acid may include both coding sequences. Gene therapy methods that utilize the nucleic acid are also provided. Embodiments of the disclosure include compositions, e.g., nucleic acid alone or in vectors and kits, etc., that find use in the methods. The methods may lead to increase the expression of NKA β1 and / or MRCKα gene when administered to subjects (e.g., mammals). Administration of the vectors to the subject may ameliorate one or more symptoms or markers of the disease or condition. Vectors As disclosed herein, one aspect of the disclosure is a nucleic acid in a vector. Application of the subject vector to a subject, e.g., using any convenient method such as aUR 6-23001 / FR Ref.: 161118.04201 gene therapy method, may result in expression of one or more coding sequences of interest in cells of the subject, to produce a biologically active product that may modulate a biological activity of the cell. In some cases, the vector is a nucleic acid vector comprising a coding sequence for NKA β1. In some cases, the nucleic acid vector comprises a coding sequence for one or more NKA β1 and / or MRCKα. In some instances, the vector comprises a coding sequence for NKA β1 and / or MRCKα suitable for use in gene therapy. Gene therapy vectors of interest include any kind of particle that comprises a polynucleotide fragment encoding the NKA β1 and / or MRCKα protein, operably linked to a regulatory element such as a promoter, which allows the expression of a functional NKA β1 and / or MRCKα protein demonstrating its activity in the targeted cells. In some cases, NKA β1 is encoded by the nucleic acid sequence as set forth in SEQ ID NO: 4 or 5, or is an active fragment or functional equivalent of NKA β1. In some cases, MRCKα is encoded by the nucleic acid sequence as set forth in SEQ ID NO: 1 or is an active fragment or functional equivalent of MRCKα. In some instances, the vector include a regulatory sequence which is a constitutive promoter such as the cytomegalovirus (CMV) promoter. The NKA β1 and / or MRCKα sequence used in the gene therapy vector may be derived from the same species as the subject. Any convenient NKA β1 and / or MRCKα sequences, or fragments or functional equivalents thereof, may be utilized in the subject vectors, including sequences from any convenient animal, such as a primate, ungulate, cat, dog, or other domestic pet or domesticated mammal, rabbit, pig, horse, sheep, cow, or a human. For example, gene therapy in humans may be carried out using the human NKA β1 and / or MRCKα sequence. Accordingly, nucleic acid molecules encoding NKA β1 and / or MRCKα and their analogs can be used for (i) improving integrity or function of an epithelial or endothelial barrier or (ii) treatment of disorders related to barrier dysfunction. Examples of the analogs can include NKA β1 / or MRCKα isoforms, mimetics, fragments, hybrid proteins, fusion proteins oligomers and multimers of the above, homologues of the above, regardless of the method of synthesis or manufacture thereof including but not limited to, recombinant vector expression whether produced from cDNA or genomic DNA, synthetic, transgenic, and gene activated methods.UR 6-23001 / FR Ref.: 161118.04201 Viral Vectors Any convenient viruses may be utilized in delivering the vector of interest to the subject. Viruses of interest include, but are not limited to a retrovirus, an adenovirus, an adeno-associated virus (AAV), a herpes simplex virus and a lentivirus. Viral gene therapy vectors are well known in the art, see e.g., Heilbronn & Weger (2010) Handb Exp Pharmacal. 197:143-70. Vectors of interest include integrative and non-integrative vectors such as those based on retroviruses, adenoviruses (AdV), adeno-associated viruses (AAV), lentiviruses, pox viruses, alphaviruses, and herpes viruses. In some cases, non-integrative viral vectors, such as AAV, may be utilized. In one aspect, non-integrative vectors do not cause any permanent genetic modification. The vectors may be targeted to adult tissues to avoid having the subjects under the effect of constitutive expression from early stages of development. In some instances, non-integrative vectors effectively incorporate a safety mechanism to avoid over-proliferation of NKA β1 and / or MRCKα expressing cells. The cells may lose the vector (and, as a consequence, the protein expression) if they start proliferating quickly. Non-integrative vectors of interest include those based on adenoviruses (AdV) such as gutless adenoviruses, adeno-associated viruses (AAV), integrase deficient lentiviruses, pox viruses, alphaviruses, and herpes viruses. In certain embodiments, the non-integrative vector used is an adeno-associated virus-based non-integrative vector, similar to natural adeno- associated virus particles. Examples of adeno-associated virus-based non integrative vectors include vectors based on any AAV serotype, i.e., AAVI, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAVIO, AAVII and pseudotyped AAV. Vectors of interest include those capable of transducing a broad range of tissues at high efficiency, with poor immunogenicity and an excellent safety profile. In some cases, the vectors transduce post- mitotic cells and can sustain long-term gene expression (up to several years) both in small and large animal models of the related disorders. Introduction of Nucleic Acids to Cells Exogenous genetic material (e.g., a nucleic acid or a vector encoding one or more therapeutic proteins) can be introduced into a target cells of interest in vivo by genetic transfer methods, such as transfection or transduction, to provide a genetically modified cell. Various expression vectors (i.e., vehicles for facilitating delivery of exogenous genetic material into a target cell) are known to one of ordinary skill in the art. As used herein, "exogenous genetic material" refers to a nucleic acid or an oligonucleotide, either natural orUR 6-23001 / FR Ref.: 161118.04201 synthetic, that is not naturally found in the cells; or if it is naturally found in the cells, it is not transcribed or expressed at biologically significant levels by the cells. Thus, "exogenous genetic material" includes, for example, a non-naturally occurring nucleic acid that can be transcribed into a RNA. As used herein, "transfection of cells" refers to the acquisition by a cell of a protein or new genetic material by incorporation of added protein or nucleic acid (DNA, RNA, or a hybrid thereof). Thus, transfection refers to the introducing of protein or nucleic acid into a cell using physical or chemical methods. Several transfection techniques are known to those of ordinary skill in the art including: calcium phosphate nucleic acid co-precipitation, strontium phosphate nucleic acid co-precipitation, DEAE-dextran, electroporation, cationic liposome-mediated transfection, and tungsten particle-facilitated microparticle bombardment. In contrast, "transduction of cells" refers to the process of transferring nucleic acid into a cell using a DNA or RNA virus. A RNA virus (i.e., a retrovirus) for transferring a nucleic acid into a cell is referred to herein as a transducing chimeric retrovirus. Exogenous genetic material contained within the retrovirus is incorporated into the genome of the transduced cell. A cell that has been transduced with a chimeric DNA virus (e.g., an adenovirus carrying a cDNA encoding a therapeutic agent), will not have the exogenous genetic material incorporated into its genome but will be capable of expressing the exogenous genetic material that is retained extrachromosomally within the cell. Typically, the exogenous genetic material includes a heterologous gene (coding for a therapeutic RNA or protein) together with a promoter to control transcription of the new gene. The promoter characteristically has a specific nucleotide sequence necessary to initiate transcription. Optionally, the exogenous genetic material further includes additional sequences (i.e., enhancers) required to obtain the desired gene transcription activity. For the purpose of this discussion, an "enhancer" is simply any non-translated DNA sequence that works contiguous with the coding sequence (in cis) to change the basal transcription level dictated by the promoter. The exogenous genetic material may introduced into the cell genome immediately downstream from the promoter so that the promoter and coding sequence are operatively linked so as to permit transcription of the coding sequence. A retroviral expression vector may include an exogenous promoter element to control transcription of the inserted exogenous gene. Such exogenous promoters include both constitutive and inducible promoters. Naturally-occurring constitutive promoters control the expression of essential cell functions. As a result, a gene under the control of a constitutive promoter is expressed underUR 6-23001 / FR Ref.: 161118.04201 all conditions of cell growth. Exemplary constitutive promoters include the promoters for the following genes that encode certain constitutive or "housekeeping" functions: hypoxanthine phosphoribosyl transferase (HPRT), dihydrofolate reductase (DHFR), adenosine deaminase, phosphoglycerol kinase (PGK), pyruvate kinase, phosphoglycerol mutase, the actin promoter, ubiquitin, elongation factor-1 and other constitutive promoters known to those of skill in the art. In addition, many viral promoters function constitutively in eucaryotic cells. These include the early and late promoters of SV40; the long terminal repeats (LTRs) of Moloney Leukemia Virus and other retroviruses; and the thymidine kinase promoter of Herpes Simplex Virus, among many others. Accordingly, any of the above-referenced constitutive promoters can be used to control transcription of a heterologous gene insert. Genes that are under the control of inducible promoters are expressed only or to a greater degree, in the presence of an inducing agent, (e.g., transcription under control of the metallothionein promoter is greatly increased in presence of certain metal ions). Inducible promoters include responsive elements (REs) which stimulate transcription when their inducing factors are bound. For example, there are REs for serum factors, steroid hormones, retinoic acid and cyclic AMP. Promoters containing a particular RE can be chosen in order to obtain an inducible response and in some cases, the RE itself may be attached to a different promoter, thereby conferring inducibility to the recombinant gene. Thus, by selecting the appropriate promoter (constitutive versus inducible; strong versus weak), it is possible to control both the existence and level of expression of a therapeutic agent in the genetically modified cell. If the gene encoding the therapeutic agent is under the control of an inducible promoter, delivery of the therapeutic agent in situ is triggered by exposing the genetically modified cell in situ to conditions for permitting transcription of the therapeutic agent, e.g., by injection of specific inducers of the inducible promoters which control transcription of the agent. For example, in situ expression by genetically modified cells of a therapeutic agent encoded by a gene under the control of the metallothionein promoter, is enhanced by contacting the genetically modified cells with a solution containing the appropriate (i.e., inducing) metal ions in situ. Accordingly, the amount of therapeutic agent that is delivered in situ is regulated by controlling such factors as: (1) the nature of the promoter used to direct transcription of the inserted gene, (i.e., whether the promoter is constitutive or inducible, strong or weak); (2) the number of copies of the exogenous gene that are inserted into the cell; (3) the number of transduced / transfected cells that are administered (e.g., implanted) to the patient; (4) the size of the implant (e.g., graft or encapsulated expression system); (5) the number of implants; (6)UR 6-23001 / FR Ref.: 161118.04201 the length of time the transduced / transfected cells or implants are left in place; and (7) the production rate of the therapeutic agent by the genetically modified cell. Selection and optimization of these factors for delivery of a therapeutically effective dose of a particular therapeutic agent is deemed to be within the scope of one of ordinary skill in the art without undue experimentation, taking into account the above-disclosed factors and the clinical profile of the patient. In addition to at least one promoter and at least one heterologous nucleic acid encoding the therapeutic agent, the expression vector may include a selection gene, for example, a neomycin resistance gene, for facilitating selection of cells that have been transfected or transduced with the expression vector. Alternatively, the cells are transfected with two or more expression vectors, at least one vector containing the gene(s) encoding the therapeutic agent(s), the other vector containing a selection gene. The selection of a suitable promoter, enhancer, selection gene, and / or signal sequence is deemed to be within the scope of one of ordinary skill in the art without undue experimentation. An expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means. Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and / or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2012, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362. Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).UR 6-23001 / FR Ref.: 161118.04201 Addition of DNA binding proteins such as Transcription Factor A Mitochondria (TFAM) can be used to condense DNA and shield charge. Due to the small size and compact shape, the DNA:Protein (DNP) complexes can then be delivered to cells by cell penetrating peptides, PEG derivative, liposomes or electroporation. In some instances, DNA binding proteins can encode nuclear localization signals to actively transport of DNPs from the cytoplasm to the nucleus where the vectors are transcribed. In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid / DNA or lipid / expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a "collapsed" structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes. Lipids suitable for use can be obtained from commercial sources. For example, dimyristyl phosphatidylcholine ("DMPC") can be obtained from Sigma, St. Louis, MO; dicetyl phosphate ("DCP") can be obtained from K & K Laboratories (Plainview, NY); cholesterol ("Choi") can be obtained from Calbiochem-Behring; dimyristyl phosphatidylglycerol ("DMPG") and other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, AL). Stock solutions of lipids in chloroform or chloroform / methanol can be stored at about -20°C. Chloroform is used as the only solvent since it is more readily evaporated than methanol. "Liposome" is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and anUR 6-23001 / FR Ref.: 161118.04201 inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 Glycobiology 5: 505-10). However, compositions that have different structures in solution than the normal vesicular structure are also encompassed. For example, the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules. Also contemplated are lipofectamine-nucleic acid complexes. The nucleic acid molecules described herein can be administered via electroporation, such as by a method described in U.S. Patent No. 7,664,545, the contents of which are incorporated herein by reference. The electroporation can be by a method and / or apparatus described in U.S. Patent Nos. 6,302,874; 5,676,646; 6,241,701; 6,233,482; 6,216,034; 6,208,893; 6, 192,270; 6,181,964; 6, 150,148; 6,120,493; 6,096,020; 6,068,650; and 5,702,359, the contents of which are incorporated herein by reference in their entirety. The electroporation may be carried out via a minimally invasive device. The minimally invasive electroporation device ("MID") may be an apparatus for injecting the composition described above and associated fluid into body tissue. The device may comprise a hollow needle, DNA cassette, and fluid delivery means, wherein the device is adapted to actuate the fluid delivery means in use so as to concurrently (for example, automatically) inject DNA into body tissue during insertion of the needle into the said body tissue. This has the advantage that the ability to inject the DNA and associated fluid gradually while the needle is being inserted leads to a more even distribution of the fluid through the body tissue. The pain experienced during injection may be reduced due to the distribution of the DNA being injected over a larger area. The MID may inject the composition into tissue without the use of a needle. The MID may inject the composition as a small stream or jet with such force that the composition pierces the surface of the tissue and enters the underlying tissue and / or muscle. The force behind the small stream or jet may be provided by expansion of a compressed gas, such as carbon dioxide through a micro-orifice within a fraction of a second. Examples of minimally invasive electroporation devices, and methods of using them, are described in published U.S. Patent Application No.20080234655; U.S. Patent No.6,520,950; U.S. Patent No.7, 171,264; U.S. Patent No. 6,208,893; U.S. Patent NO. 6,009,347; U.S. Patent No. 6, 120,493; U.S. Patent No.7,245,963; U.S. Patent No.7,328,064; and U.S. Patent No.6,763,264, the contents of each of which are herein incorporated by reference. The MID may comprise an injectorUR 6-23001 / FR Ref.: 161118.04201 that creates a high-speed jet of liquid that painlessly pierces the tissue. Such needle-free injectors are commercially available. Examples of needle-free injectors that can be utilized herein include those described in U.S. Patent Nos. 3,805,783; 4,447,223; 5,505,697; and 4,342,310, the contents of each of which are herein incorporated by reference. A desired composition in a form suitable for direct or indirect electrotransport may be introduced (e.g., injected) using a needle-free injector into the tissue to be treated, usually by contacting the tissue surface with the injector so as to actuate delivery of a jet of the agent, with sufficient force to cause penetration of the composition into the tissue. For example, if the tissue to be treated is mucosa, epithelium, or muscle, the agent is projected towards the mucosal or epithelium surface with sufficient force to cause the agent to penetrate through the mucosal or epithelium layers, or into underlying tissues, basal cells, and muscle, respectively. Needle-free injectors are well suited to deliver compositions to all types of tissues, particularly to mucosal or epithelium layers. In some embodiments, a needle-free injector may be used to propel a liquid that contains the composition to the surface and into the subject's mucosal or epithelium layers. The MID may have needle electrodes that electroporate the tissue. By pulsing between multiple pairs of electrodes in a multiple electrode array, for example set up in rectangular or square patterns, provides improved results over that of pulsing between a pair of electrodes. Disclosed, for example, in U.S. Patent No. 5,702,359 entitled "Needle Electrodes for Mediated Delivery of Drugs and Genes" is an array of needles wherein a plurality of pairs of needles may be pulsed during the therapeutic treatment. In that application, which is incorporated herein by reference as though fully set forth, needles were disposed in a circular array, but have connectors and switching apparatus enabling a pulsing between opposing pairs of needle electrodes. A pair of needle electrodes for delivering recombinant expression vectors to cells may be used. Such a device and system is described in U.S. Patent No. 6,763,264, the contents of which are herein incorporated by reference. Alternatively, a single needle device may be used that allows injection of the DNA and electroporation with a single needle resembling a normal injection needle and applies pulses of lower voltage than those delivered by presently used devices, thus reducing the electrical sensation experienced by the patient. The MID may comprise one or more electrode arrays. The arrays may comprise two or more needles of the same diameter or different diameters. The needles may be evenly or unevenly spaced apart. The needles may be between 0.005 inches and 0.03 inches, between 0.01 inches and 0.025 inches; or between 0.015 inches and 0.020 inches. The needle may beUR 6-23001 / FR Ref.: 161118.04201 0.0175 inches in diameter. The needles may be 0.5 mm, 1.0 mm, 1.5 mm, 2.0 mm, 2.5 mm, 3.0 mm, 3.5 mm, 4.0 mm, or more spaced apart. The MID may consist of a pulse generator and a two or more-needle composition injectors that deliver the composition and electroporation pulses in a single step. The pulse generator may allow for flexible programming of pulse and injection parameters via a flash card operated personal computer, as well as comprehensive recording and storage of electroporation and patient data. The pulse generator may deliver a variety of volt pulses during short periods of time. For example, the pulse generator may deliver three 15 volt pulses of 100 ms in duration. An example of such a MID is the ELGEN 1000 system, described in U.S. Patent No. 7,328,064, the contents of which are herein incorporated by reference. The MID may be a CELLECTRA (INOVIO Pharmaceuticals) device and system, which is a modular electrode system, that facilitates the introduction of a macromolecule, such as a DNA, into cells of a selected tissue in a body. The modular electrode system may comprise a plurality of needle electrodes; a hypodermic needle; an electrical connector that provides a conductive link from a programmable constant-current pulse controller to the plurality of needle electrodes; and a power source. An operator can grasp the plurality of needle electrodes that are mounted on a support structure and firmly insert them into the selected tissue in a body. The macromolecules are then delivered via the hypodermic needle into the selected tissue. The programmable constant-current pulse controller is activated and constant-current electrical pulse is applied to the plurality of needle electrodes. The applied constant-current electrical pulse facilitates the introduction of the macromolecule into the cell between the plurality of electrodes. Cell death due to overheating of cells is minimized by limiting the power dissipation in the tissue by virtue of constant-current pulses. The Cellectra device and system is described in U.S. Patent No.7,245,963, the contents of which are herein incorporated by reference. The MID may be an ELGEN 1000 system (INOVIO Pharmaceuticals). The ELGEN 1000 system may comprise device that provides a hollow needle; and fluid delivery means, wherein the apparatus is adapted to actuate the fluid delivery means in use so as to concurrently (for example automatically) inject fluid, the described composition herein, into body tissue during insertion of the needle into the said body tissue. The advantage is the ability to inject the fluid gradually while the needle is being inserted leads to a more even distribution of the fluid through the body tissue. It is also believed that the pain experienced during injection is reduced due to the distribution of the volume of fluid being injected over a larger area.UR 6-23001 / FR Ref.: 161118.04201 In addition, the automatic injection of fluid facilitates automatic monitoring and registration of an actual dose of fluid injected. This data can be stored by a control unit for documentation purposes if desired. It will be appreciated that the rate of injection could be either linear or non-linear and that the injection may be carried out after the needles have been inserted through the tissue of the subject to be treated and while they are inserted further into the body tissue. The apparatus further comprises needle insertion means for guiding insertion of the needle into the body tissue. The rate of fluid injection is controlled by the rate of needle insertion. This has the advantage that both the needle insertion and injection of fluid can be controlled such that the rate of insertion can be matched to the rate of injection as desired. It also makes the apparatus easier for a user to operate. If desired means for automatically inserting the needle into body tissue could be provided. A user could choose when to commence injection of fluid. Ideally however, injection is commenced when the tip of the needle has reached muscle tissue and the apparatus may include means for sensing when the needle has been inserted to a sufficient depth for injection of the fluid to commence. This means that injection of fluid can be prompted to commence automatically when the needle has reached a desired depth (which will normally be the depth at which muscle tissue begins). The depth at which tissue begins could for example be taken to be a preset needle insertion depth such as a value of 4 mm which would be deemed sufficient for the needle to get through the epithelia layer. The sensing means may comprise an ultrasound probe. The sensing means may comprise a means for sensing a change in impedance or resistance. In this case, the means may not as such record the depth of the needle in the body tissue but will rather be adapted to sense a change in impedance or resistance as the needle moves from a different type of body tissue into another. Either of these alternatives provides a relatively accurate and simple to operate means of sensing that injection may commence. The depth of insertion of the needle can further be recorded if desired and could be used to control injection of fluid such that the volume of fluid to be injected is determined as the depth of needle insertion is being recorded. The apparatus may further comprise: a base for supporting the needle; and a housing for receiving the base therein, wherein the base is moveable relative to the housing such that the needle is retracted within the housing when the base is in a first rearward position relative to the housing and the needle extends out of the housing when the base is in a second forward position within the housing. This is advantageous for a user as the housing can be lined upUR 6-23001 / FR Ref.: 161118.04201 on the tissue of a patient, and the needles can then be inserted into the patient's tissue by moving the housing relative to the base. As stated above, it is desirable to achieve a controlled rate of fluid injection such that the fluid is evenly distributed over the length of the needle as it is inserted into the tissue. The fluid delivery means may comprise piston driving means adapted to inject fluid at a controlled rate. The piston driving means could for example be activated by a servo motor. However, the piston driving means may be actuated by the base being moved in the axial direction relative to the housing. It will be appreciated that alternative means for fluid delivery could be provided. Thus, for example, a closed container which can be squeezed for fluid delivery at a controlled or non-controlled rate could be provided in the place of a syringe and piston system. The apparatus described above could be used for any type of injection. It is however envisaged to be particularly useful in the field of electroporation and so it may further comprises means for applying a voltage to the needle. This allows the needle to be used not only for injection but also as an electrode during, electroporation. This is particularly advantageous as it means that the electric field is applied to the same area as the injected fluid. There has traditionally been a problem with electroporation in that it is very difficult to accurately align an electrode with previously injected fluid and so users have tended to inject a larger volume of fluid than is required over a larger area and to apply an electric field over a higher area to attempt to guarantee an overlap between the injected substance and the electric field. As disclosed herein, both the volume of fluid injected and the size of electric field applied may be reduced while achieving a good fit between the electric field and the fluid. Regardless of the method used to introduce exogenous nucleic acids into a host cell, in order to confirm the presence of the recombinant nucleic acid sequence in the host cell, a variety of assays may be performed. Such assays include, for example, "molecular biological" assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; "biochemical" assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or other assays known to those of skill in the art. Pharmaceutical Compositions In another aspect, the present disclosure provides pharmaceutical compositions containing a therapeutically effective amount of NKA β1 and / or MRCKα polypeptides, or nucleic acid sequences encoding NKA β1 and / or MRCKα polypeptides, and aUR 6-23001 / FR Ref.: 161118.04201 pharmaceutically acceptable carrier. Preferably, the coding nucleic acid sequences are contained within an expression vector, such as plasmid DNA or virus. The pharmaceutical composition can be adapted for administration to the esophagus or surround / adjacent areas by methods known in the art. Administration can be continuous or at distinct intervals as can be determined by a person skilled in the art. The pharmaceutical compositions can be formulated according to known methods for preparing pharmaceutically useful compositions. Furthermore, as used herein, the phrase "pharmaceutically acceptable carrier" means any of standard pharmaceutically acceptable carriers. The pharmaceutically acceptable carrier can include diluents, adjuvants, and vehicles, as well as implant carriers, and inert, non-toxic solid or liquid fillers, diluents, or encapsulating material that does not react with the active ingredients of the disclosure. Examples include, but are not limited to, phosphate buffered saline, physiological saline, water, and emulsions, such as oil / water emulsions. The carrier can be a solvent or dispersing medium containing, for example, ethanol, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. Formulations containing pharmaceutically acceptable carriers are described in a number of sources which are well known and readily available to those skilled in the art. For example, Remington's Pharmaceutical Sciences (Martin E W
[1995] Easton Pennsylavania, Mack Publishing Company, 19thed.) describes formulations that can be used in connection with the subject invention. Formulations suitable for parenteral administration include, for example, aqueous sterile injection solutions, which may contain antioxidants, buffers, bacteriostats, and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and nonaqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze dried (lyophilized) condition requiring only the condition of the sterile liquid carrier, for example, water for injections, prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powder, granules, tablets, etc. It should be understood that in addition to the ingredients particularly mentioned above, the formulations described herein can include other agents conventional in the art having regard to the type of formulation in question. The pharmaceutical compositions can be administered to a subject by any route that results in prevention or alleviation of symptoms associated with a disease or condition associated with compromised function of an epithelial or endothelial barrier. For example,UR 6-23001 / FR Ref.: 161118.04201 the polypeptides or nucleic acid molecules can be administered parenterally, intravenously (I.V.), intramuscularly (I.M.), subcutaneously (S.C.), intradermally (I.D.), orally, intranasally, etc. Examples of intranasal administration can be by means of a spray, drops, powder or gel and also described in U.S. Pat. No. 6,489,306, US20180344816, US20060078558, US20080070858, US20180298057, and US20150313924, which are incorporated herein by reference in their entireties. However, other means of drug administrations are well within the scope of the present disclosure. The NKA β1 and / or MRCKα polypeptide or encoding nucleic acid molecule can be administered and dosed in accordance with good medical practice, taking into account the clinical condition of the individual patient, the site and method of administration, scheduling of administration, patient age, sex, body weight, and other factors known to medical practitioners. The pharmaceutically "effective amount" for purposes herein is thus determined by such considerations as are known in the art. For example, an effect amount of the polypeptide or encoding nucleic acid molecule is that amount necessary to provide a therapeutically effective amount of NKA β1 and / or MRCKα, when expressed in vivo. The amount of NKA β1 and / or MRCKα or encoding nucleic acid molecule must be effective to achieve improvement including but not limited to total prevention and to improved survival rate or more rapid recovery, or improvement or elimination of symptoms associated with the related disorders and other indicators as are selected as appropriate measures by those skilled in the art. In accordance with the present disclosure, a suitable single dose size is a dose that is capable of preventing or alleviating (reducing or eliminating) a symptom in a patient when administered one or more times over a suitable time period. One of skill in the art can readily determine appropriate single dose sizes for systemic administration based on the size of a mammal and the route of administration. Therapeutic Uses Pharmaceutical compositions according to the disclosure can be generally administered systemically. Depending on the disorder to be treated, the pharmaceutical compositions described herein may be administered orally, parenterally (e.g., via intravenous, subcutaneous, intracutaneous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional or intracranial injection), topically, mucosally (e.g., rectally or vaginally), nasally, buccally, ophthalmically, via inhalation spray (e.g., delivered via nebulzation, propellant or a dry powder device) or via an implanted reservoir.UR 6-23001 / FR Ref.: 161118.04201 In one aspect, the disclosure provides a method of treating a GERD in a subject in need thereof. The method comprises expressing a NKA β1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject. In another aspect, the disclosure provides a method of reducing the risk of developing esophageal cancer in a subject in need thereof. The method comprises expressing a NKAβ1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject. In yet another aspect, the disclosure provides a method of increasing expression of a tight junction protein in the esophagus of a subject in need thereof. The method comprises expressing a NKAβ1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject. In some embodiments, the expressing step comprises administering to the subject a NKA β1 or MRCKα polypeptide or protein, or a variant thereof. In some embodiments, the expressing step comprises administering to the subject a genetic construct comprising a nucleic acid sequence encoding the NKAβ1 subunit or the MRCKα or both. In one embodiment, the genetic construct further comprises a regulatory sequence that is operatively linked to the nucleic acid sequence. In one embodiment, the regulatory sequence comprises a promoter or an enhancer. In one embodiment, the promoter is one selected from the group consisting of a CMV promoter, a Ubc promoter, a CAG promoter, an EF1a promoter, a SV40 early promoter, and a PGK promoter. In one embodiment, the promoter is an inducible promoter. In one embodiment, the inducible promoter is a tetracycline (doxycycline)-controlled inducible protomer or a tamoxifen-inducible promoter. In one embodiment, the promoter or enhancer is selective or specific for an esophagus cell. In one embodiment, the genetic construct is administered by electroporation or in a liposome. In one embodiment, the genetic construct is administered in an expression vector. In one embodiment, the expression vector is a viral vector, plasmid vector, or bacterial vector. Examples of the viral vector include one selected from the group consisting of a lentiviral vector, an adenoviral vector, an adeno-associated viral vector, and a vaccinia vector. In one embodiment, the subject is mammal.UR 6-23001 / FR Ref.: 161118.04201 In one embodiment, the subject is a human. In certain embodiments, the disclosure provides methods of treating or preventing GERD comprising administering an effective amount of a pharmaceutical composition comprising an active pharmaceutical agent disclosed herein to a subject in need thereof. In a specific embodiment, it may be desirable to administer the pharmaceutical compositions locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion, by injection, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. In some embodiments. protein or gene transfer can be achieved by direct submucosal administration or injection for delivery of the protein or viral vectors into the locoregional area of the esophagus. In one example, one can use a multiluminal spray catheter that can be passed through the accessory channel of an endoscope, and fibrin glues as a vehicle of recombinant viral evection in the manner described in Teraishi et al. A novel method for gene delivery and expression in esophageal epithelium with fibrin glues containing replication- deficient adenovirus vector. Surg Endosc 2003;17:1845-8. The content of this reference is incorporated by reference in its entirety. In that case, a fibrinogen solution and a thrombion solution containing an expression vector (such as a recombinant adenovirus vector or an AAV vector) can be endoscopically sprayed on the esophagus through the catheter attached to the dual-barrel syringe. Alternatively, instillation or injection can be used. For instance, protein or nucleic acid transfer can be achieved by using cationic liposomes. In one example, the transfer can be done by either luminal instillation into a closed segment using a double balloon catheter, or by intramural injection through a needle. See, e.g., Schmid RM et al. Liposome mediated gene transfer into the rat oesophagus. Gut 1997;41:549-56, and Tarhini AA, et al. A phase I study of concurrent chemotherapy (paclitaxel and carboplatin) and thoracic radiotherapy with swallowed manganese superoxide dismutase plasmid liposome protection in patients with locally advanced stage III non-small-cell lung cancer. Hum Gene Ther 2011;22:336-42. The contents of these references are incorporated by reference in their entireties. The liposome mediated nucleic acid transfer has already been used for the delivery of recombinant genes into cells and tissues and shown to have a number of notable advantages. Because the nucleic acid is not delivered by a viral vector it is also not propagated by the transfected cell. Medical and biological safety concerns are thereby minimized. In contrast to retroviral delivery systems that only engage dividing cells, liposome mediated nucleic acid transferUR 6-23001 / FR Ref.: 161118.04201 does not require cell replication. Moreover, because nucleic acid introduced with a liposome complex generally remains episomal, the potential risk of insertional mutagenesis is small compared with DNA of retroviral origin. The above-described therapeutic agents and compositions can be used for treating, protecting against, and / or preventing a disease or condition associated with dysfunction in epithelial or endothelial barrier in esophagus, such as GERD, BE, EAC, and esophageal squamous-cell carcinoma (SCC) in a subject in need thereof by administering one or more composition described herein to the subject. Such agents and compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular subject, and the route of administration. The composition dose can be between 1 μg to 10 mg active component / kg body weight / time, and can be 20 μg to 10 mg component / kg body weight / time. The composition can be administered every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 days. The number of composition doses for effective treatment can be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. The agent or composition can be administered prophylactically or therapeutically. In therapeutic applications, the agents or compositions are administered to a subject in need thereof in an amount sufficient to elicit a therapeutic effect. An amount adequate to accomplish this is defined as "therapeutically effective dose." Amounts effective for this use will depend on, e.g., the particular composition of the composition regimen administered, the manner of administration, the stage and severity of the disease, the general state of health of the subject, and the judgment of the prescribing physician. The agent or composition can be administered by methods well known in the art as described in Donnelly et al. (Ann. Rev. Immunol. 15:617-648 (1997)), U.S. Pat. No. 5,580,859, U.S. Pat. No.5,703,055, and U.S. Pat. No.5,679,647, the contents of all of which are incorporated herein by reference in their entirety. The nucleic acid (DNA or RNA) of the composition can be complexed to particles or beads that can be administered to an individual, for example. One skilled in the art would know that the choice of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, depends, for example, on the route of administration of the expression vector. The composition can be delivered via a variety of routes. The composition can be incorporated into liposomes, microspheres or other polymer matrices (U.S. Pat. No.5,703,055; Gregoriadis, Liposome Technology, Vols. Ito III (2nd ed.UR 6-23001 / FR Ref.: 161118.04201 1993), the contents of which are incorporated herein by reference in their entirety). Liposomes can consist of phospholipids or other lipids, and can be nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer. The polypeptide or nucleic acid molecule encoding the polypeptide may be administered by different routes including orally, parenterally, sublingually, transdermally, rectally, transmucosally, topically, via inhalation, via buccal administration, intrapleurally, intravenous, intraarterial, intraperitoneal, subcutaneous, intramuscular, intranasal, intrathecal, and intraarticular or combinations thereof. For veterinary use, the composition may be administered as a suitably acceptable formulation in accordance with normal veterinary practice. The veterinarian can readily determine the dosing regimen and route of administration that is most appropriate for a particular animal. The composition may be administered by traditional syringes, needleless injection devices, microprojectile bombardment gene guns, or other physical methods such as electroporation, hydrodynamic method, or ultrasound. The polypeptide or nucleic acid molecule encoding the polypeptide may be delivered to the mammal by several well-known technologies including DNA injection with and without in vivo electroporation, liposome mediated, nanoparticle facilitated, recombinant vectors such as recombinant adenovirus, recombinant adenovirus associated virus and recombinant vaccinia. The polypeptide or nucleic acid molecule encoding the polypeptide may be delivered via DNA injection and along with in vivo electroporation. Electroporation Administration of the composition via electroporation may be accomplished using electroporation devices that can be configured to deliver to a desired tissue of a mammal a pulse of energy effective to cause reversible pores to form in cell membranes, and preferable the pulse of energy is a constant current similar to a preset current input by a user. The electroporation device may comprise an electroporation component and an electrode assembly or handle assembly. The electroporation component may include and incorporate one or more of the various elements of the electroporation devices, including: controller, current waveform generator, impedance tester, waveform logger, input element, status reporting element, communication port, memory component, power source, and power switch. The electroporation may be accomplished using an in vivo electroporation device, for example CELLECTRA EP system or ELGEN electroporator to facilitate transfection of cells by the plasmid.UR 6-23001 / FR Ref.: 161118.04201 The electroporation component may function as one element of the electroporation devices, and the other elements are separate elements (or components) in communication with the electroporation component. The electroporation component may function as more than one element of the electroporation devices, which may be in communication with still other elements of the electroporation devices separate from the electroporation component. The elements of the electroporation devices existing as parts of one electromechanical or mechanical device may not limited as the elements can function as one device or as separate elements in communication with one another. The electroporation component may be capable of delivering the pulse of energy that produces the constant current in the desired tissue, and includes a feedback mechanism. The electrode assembly may include an electrode array having a plurality of electrodes in a spatial arrangement, wherein the electrode assembly receives the pulse of energy from the electroporation component and delivers same to the desired tissue through the electrodes. At least one of the plurality of electrodes is neutral during delivery of the pulse of energy and measures impedance in the desired tissue and communicates the impedance to the electroporation component. The feedback mechanism may receive the measured impedance and can adjust the pulse of energy delivered by the electroporation component to maintain the constant current. A plurality of electrodes may deliver the pulse of energy in a decentralized pattern. The plurality of electrodes may deliver the pulse of energy in the decentralized pattern through the control of the electrodes under a programmed sequence, and the programmed sequence is input by a user to the electroporation component. The programmed sequence may comprise a plurality of pulses delivered in sequence, wherein each pulse of the plurality of pulses is delivered by at least two active electrodes with one neutral electrode that measures impedance, and wherein a subsequent pulse of the plurality of pulses is delivered by a different one of at least two active electrodes with one neutral electrode that measures impedance. The feedback mechanism may be performed by either hardware or software. The feedback mechanism may be performed by an analog closed-loop circuit. The feedback occurs every 50 μβ, 20 μβ, 10 or 1 μβ, but is preferably a real-time feedback or instantaneous (i.e., substantially instantaneous as determined by available techniques for determining response time). The neutral electrode may measure the impedance in the desired tissue and communicates the impedance to the feedback mechanism, and the feedback mechanism responds to the impedance and adjusts the pulse of energy to maintain the constant current atUR 6-23001 / FR Ref.: 161118.04201 a value similar to the preset current. The feedback mechanism may maintain the constant current continuously and instantaneously during the delivery of the pulse of energy. Examples of electroporation devices and electroporation methods that may facilitate delivery of the compositions described herein, include those described in US7245963 and US2005 / 0052630, the contents of which are hereby incorporated by reference in their entirety. Other electroporation devices and electroporation methods known in the art can also be used for facilitating delivery of the compositions. See, e.g., US9452285, US7245963, US5273525, US6110161, US6958060, US6939862, US6697669, US 7328064 and US 2005 / 0052630 Kits The disclosure also provides kits, where the kits include one or more components employed in methods, e.g., vectors, as described herein. In some embodiments, the subject kit includes a vector (as described herein), and one or more components selected from a promoter, a virus, a cell, and a buffer. Any of the components described herein may be provided in the kits, e.g., cells, constructs (e.g., vectors) encoding for NKA β1 and / or MRCKα, components suitable for use in expression systems (e.g., cells, cloning vectors, multiple cloning sites (MSC), bi-directional promoters, an internal ribosome entry site (IRES), etc.), etc. A variety of components suitable for use in making and using constructs, cloning vectors and expression systems may find use in the subject kits. Kits may also include tubes, buffers, etc., and instructions for use. The various reagent components of the kits may be present in separate containers, or some or all of them may be pre-combined into a reagent mixture in a single container, as desired. In addition to the above components, the kits may further include instructions for practicing the subject methods. These instructions may be present in the kits in a variety of forms, one or more of which may be present in the kit. One form in which these instructions may be present is as printed information on a suitable medium or substrate, e.g., a piece or pieces of paper on which the information is printed, in the packaging of the kit, in a package insert, etc. Yet another form of these instructions is a computer readable medium, e.g., diskette, compact disk (CD), hard drive etc., on which the information has been recorded. Yet another form of these instructions that may be present is a website address which may be used via the internet to access the information at a removed site.UR 6-23001 / FR Ref.: 161118.04201 Aspects of the disclosure include providing a virus particle that includes a nucleic acid vector, e.g., as described above. Any convenient virus particles may be utilized, and include viral vector particles described above. Aspects of the disclosure include providing a cell that includes a nucleic acid vector. The cell that is provided with the vector of interest may vary depending on the specific application being performed. Target cells of interest include eukaryotic cells, e.g., animal cells, where specific types of animal cells include, but are not limited to: insect, worm or mammalian cells. Various mammalian cells may be used, including, by way of example, equine, bovine, ovine, canine, feline, murine, non-human primate and human cells. Among the various species, various types of cells may be used, such as epithelial, endothelial, pulmonary, hematopoietic, neural, glial, mesenchymal, cutaneous, mucosal, stromal, muscle (including smooth muscle cells), spleen, reticulo-endothelial, hepatic, kidney, gastrointestinal, fibroblast, and other cell types. Definitions The term "gene therapy", as used herein, refers to the transfer of genetic material (e.g., DNA or RNA) of interest into a host to treat or prevent a genetic or acquired disease or condition phenotype. The genetic material of interest encodes a product (e.g., a protein, polypeptide, peptide, or functional RNA) whose production in vivo is desired. For example, the genetic material of interest can encode a hormone, receptor, enzyme, polypeptide or peptide of therapeutic value. Two basic approaches to gene therapy have evolved: (1) ex vivo and (2) in vivo gene therapy. In ex vivo gene therapy, cells are removed from a patient and, while being cultured, are treated in vitro. Generally, a functional replacement gene is introduced into the cell via an appropriate gene delivery vehicle / method (transfection, transduction, homologous recombination, etc.) and an expression system as needed and then the modified cells are expanded in culture and returned to the host / patient. These genetically reimplanted cells have been shown to produce the transfected gene product in situ. In in vivo gene therapy, target cells are not removed from the subject, rather the gene to be transferred is introduced into the cells of the recipient organism in situ, that is within the recipient. Alternatively, if the host gene is defective, the gene is repaired in situ. These genetically altered cells have been shown to produce the transfected gene product in situ. The terms “peptide,” “polypeptide,” and “protein” are used herein interchangeably to describe the arrangement of amino acid residues in a polymer. A peptide, polypeptide, or protein can be composed of the standard 20 naturally occurring amino acid, in addition to rareUR 6-23001 / FR Ref.: 161118.04201 amino acids and synthetic amino acid analogs. They can be any chain of amino acids, regardless of length or post-translational modification (for example, glycosylation or phosphorylation). A “recombinant” peptide, polypeptide, or protein refers to a peptide, polypeptide, or protein produced by recombinant DNA techniques; i.e., produced from cells transformed by an exogenous DNA construct encoding the desired peptide. A “synthetic” peptide, polypeptide, or protein refers to a peptide, polypeptide, or protein prepared by chemical synthesis. The term “recombinant” when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Within the scope of this disclosure are fusion proteins containing one or more of the afore-mentioned sequences and a heterologous sequence. A heterologous polypeptide, nucleic acid, or gene is one that originates from a foreign species, or, if from the same species, is substantially modified from its original form. Two fused domains or sequences are heterologous to each other if they are not adjacent to each other in a naturally occurring protein or nucleic acid. A conservative modification or functional equivalent of a peptide, polypeptide, or protein disclosed in this disclosure refers to a polypeptide derivative of the peptide, polypeptide, or protein, e.g., a protein having one or more point mutations, insertions, deletions, truncations, a fusion protein, or a combination thereof. It retains substantially the activity to of the parent peptide, polypeptide, or protein (such as those disclosed in this disclosure). In general, a conservative modification or functional equivalent is at least 60% (e.g., any number between 60% and 100%, inclusive, e.g., 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, and 99%) identical to a parent (e.g., SEQ ID NO: 2 or 3). A nucleic acid or polynucleotide refers to a DNA molecule (e.g., a cDNA or genomic DNA), an RNA molecule (e.g., an mRNA), or a DNA or RNA analog. A DNA or RNA analog can be synthesized from nucleotide analogs. The nucleic acid molecule can be single- stranded or double-stranded, but preferably is double-stranded DNA. An "isolated nucleic acid" refers to a nucleic acid the structure of which is not identical to that of any naturally occurring nucleic acid or to that of any fragment of a naturally occurring genomic nucleic acid. The term therefore covers, for example, (a) a DNA which has the sequence of part of a naturally occurring genomic DNA molecule but is not flanked by both of the coding sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of aUR 6-23001 / FR Ref.: 161118.04201 prokaryote or eukaryote in a manner such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion protein. The nucleic acid described above can be used to express the proteins described herein. For this purpose, one can operatively linked the nucleic acid to suitable regulatory sequences to generate an expression vector. A vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. The vector can be capable of autonomous replication or integrate into a host DNA. Examples of the vector include a plasmid, cosmid, or viral vector. The vector includes a nucleic acid in a form suitable for expression of the nucleic acid in a host cell. Preferably the vector includes one or more regulatory sequences operatively linked to the nucleic acid sequence to be expressed. A "regulatory sequence" includes promoters, enhancers, and other expression control elements (e.g., polyadenylation signals). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence, as well as tissue-specific regulatory and / or inducible sequences. The design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein or RNA desired, and the like. The expression vector can be introduced into host cells to produce a polypeptide described herein. A promoter is defined as a DNA sequence that directs RNA polymerase to bind to DNA and initiate RNA synthesis. A strong promoter is one which causes mRNAs to be initiated at high frequency. The term "operably-linked" or “operably-linked” is used herein to refer to an arrangement of flanking sequences wherein the flanking sequences so described are configured or assembled so as to perform their usual function. Thus, a flanking sequence operably-linked to a coding sequence may be capable of effecting the replication, transcription and / or translation of the coding sequence. For example, a coding sequence is operably-linked to a promoter when the promoter is capable of directing transcription of that coding sequence. A flanking sequence need not be contiguous with the coding sequence, so long as it functions correctly. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence, and the promoter sequence can still be considered "operably-linked" to the coding sequence. Each nucleotide sequence coding for a polypeptide will typically have its own operably-linked promoter sequence.UR 6-23001 / FR Ref.: 161118.04201 "Expression cassette" as used herein means a nucleic acid sequence capable of directing expression of a particular nucleotide sequence in an appropriate host cell, which may include a promoter operably linked to the nucleotide sequence of interest that may be operably linked to termination signals. The coding region usually codes for a functional RNA of interest. The expression cassette including the nucleotide sequence of interest may be chimeric. The expression cassette may also be one that is naturally occurring but has been obtained in a recombinant form useful for heterologous expression. The expression of the nucleotide sequence in the expression cassette may be under the control of a constitutive promoter or of a regulatable promoter that initiates transcription only when the host cell is exposed to some particular stimulus. In the case of a multicellular organism, the promoter can also be specific to a particular tissue or organ or stage of development. Such expression cassettes can include a transcriptional initiation region linked to a nucleotide sequence of interest. Such an expression cassette is provided with a plurality of restriction sites for insertion of the gene of interest to be under the transcriptional regulation of the regulatory regions. The expression cassette may additionally contain selectable marker genes. “Coding sequence" refers to a DNA or RNA sequence that codes for a specific amino acid sequence. It may constitute an "uninterrupted coding sequence", i.e., lacking an intron, such as in a cDNA, or it may include one or more introns bounded by appropriate splice junctions. As used herein, the percent homology between two amino acid sequences is equivalent to the percent identity between the two sequences. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions / total # of positions x 100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below. The percent identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol.48:444-453 (1970)) algorithm which has been incorporated into the GAP programUR 6-23001 / FR Ref.: 161118.04201 in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. As used herein, “treating” or “treatment” refers to administration of a compound or agent to a subject who has a disorder or is at risk of developing the disorder with the purpose to cure, alleviate, relieve, remedy, delay the onset of, prevent, or ameliorate the disorder, the symptom of the disorder, the disease state secondary to the disorder, or the predisposition toward the disorder. The terms "prevent," "preventing," "prevention," "prophylactic treatment" and the like refer to reducing the probability of developing a disorder or condition in a subject, who does not have, but is at risk of or susceptible to developing a disorder or condition. An effective amount refers to the amount of an active compound / agent that is required to confer a therapeutic effect on a treated subject. Effective doses will vary, as recognized by those skilled in the art, depending on the types of conditions treated, route of administration, excipient usage, and the possibility of co-usage with other therapeutic treatment. The term “pharmaceutical composition” refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo. A “pharmaceutically acceptable carrier,” after administered to or upon a subject, does not cause undesirable physiological effects. The carrier in the pharmaceutical composition must be “acceptable” also in the sense that it is compatible with the active ingredient and can be capable of stabilizing it. One or more solubilizing agents can be utilized as pharmaceutical carriers for delivery of an active compound. Examples of a pharmaceutically acceptable carrier include, but are not limited to, biocompatible vehicles, adjuvants, additives, and diluents to achieve a composition usable as a dosage form. Examples of other carriers include colloidal silicon oxide, magnesium stearate, cellulose, and sodium lauryl sulfate. A “subject” refers to a human and a non-human animal. Examples of a non-human animal include all vertebrates, e.g., mammals, such as non-human mammals, non-human primates (particularly higher primates), dog, rodent (e.g., mouse or rat), guinea pig, cat, and rabbit, and non-mammals, such as birds, amphibians, reptiles, etc. In one embodiment, the subject is a human. In another embodiment, the subject is an experimental, non-human animal or animal suitable as a disease model. As disclosed herein, a number of ranges of values are provided. It is understood that each intervening value, to the tenth of the unit of the lower limit, unless the context clearlyUR 6-23001 / FR Ref.: 161118.04201 dictates otherwise, between the upper and lower limits of that range is also specifically disclosed. Each smaller range between any stated value or intervening value in a stated range and any other stated or intervening value in that stated range is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included or excluded in the range, and each range where either, neither, or both limits are included in the smaller ranges is also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included. The term “about” generally refers to plus or minus 10% of the indicated number. For example, “about 10%” may indicate a range of 9% to 11%, and “about 1” may mean from 0.9-1.1. Other meanings of “about” may be apparent from the context, such as rounding off, so, for example “about 1” may also mean from 0.5 to 1.4. As used herein, “electroporation,” “electroporating” and other versions of the word likewise have the meaning generally ascribed to them by those skilled in the art. That is, in brief, electroporation refer to the process of subjecting a living cell to an electric field such that, when the voltage across the plasma membrane of the cell exceeds its dielectric strength, the membrane is disrupted and pores form in it through which substances, in particular polar substances that normally are unable to traverse the membrane, can pass and enter the cytoplasm of the cell. If the strength of the electric field coupled with the time of exposure is properly selected, the pores reseal after the cell is removed from the electric field. EXAMPLES Example 1 To determine whether NKA β1 overexpression in the esophagus can upregulate tight junctions and barrier function, the distal esophagus of rats was electroporated with either saline (no DNA) or plasmid expressing a GFP- NKA β1 (GFP-ß1) fusion, and animals were harvested 3 days later for analysis (Fig. 1). When no DNA was transferred, endogenous expressions of occludin, ZO-1 (both weak), and NKA ß1 (ß1) were seen. However, in all 3 rats electroporated with the NKA β1 plasmid, β1 and GFP-β1 were overexpressed (the GFP- β1 fusion protein had been found to be unstable, hence overexpression increases levels of both the intact fusion and the cleaved β1), as was occludin, while ZO-1 was markedly upregulated in 2 of the 3 treated rats (Fig. 1). These results indicate that overexpression of the NKA β1 subunit in the living esophagus upregulated junctional complex proteins.UR 6-23001 / FR Ref.: 161118.04201 Example 2 Since the best animal model of GERD and the subsequent induction of DIS is in rabbits, a surgical-based electroporation procedure was optimized for the esophagus in the rabbit using an elongated trough that has wires running parallel to the esophagus that is approximately 1 cm in length. The negative and positive wires exited at opposite ends of the trough, making it rather easy to fit sections on the esophagus into it without having the wires get in the way. DNA suspended in buffered saline was added to the trough once the esophagus section was placed into it and the electric field was then applied. High level gene expression (based on luciferase expression) and widespread distribution of expression (GFP immunohistochemistry) was found. To examine effects of NKA β1 overexpression on GERD, a well-described rabbit GERD model was used. In this model, a total cardiomyectomy of the distal esophagus (a 360-degree removal of the muscle surrounding ~1cm of the distal esophagus at the junction to the stomach) carried out to induce DIS and GERD. All rabbits that received surgery survived and recovered without major pain. When harvested at 12 weeks post-surgery and evaluated for DIS, animals that received total cardiomyectomy alone or with electroporation of a GFP-expressing plasmid (no β1 therapeutic gene) were found to have developed DIS as evaluated by electron microscopy (Fig.2). These results demonstrate that (1) this model can be used to induce DIS and test therapeutics, and (2) gene transfer procedure by itself did not alter the progression of the disease. Example 3 Plasmids expressing either GFP or the NKA β1 subunit from the long acting UbC promoter were delivered to animals that underwent total cardiomyectomy at the same time as electroporation. These animals were euthanized 12 weeks after injury and esophagus tissues were examined. The results are shown in FIG.3. As shown in FIG.3, gene transfer of a plasmid expressing the NKA β1 subunit from the long acting UbC promoter at the time of total cardiomyectomy resulted in complete prevention of DIS formation (white area between cells). In contrast, gene transfer of a GFP plasmid at the time of total cardiomyectomy had no effect on the development of severe DIS. These results demonstrate that gene transfer of the NKA β1 subunit can prevent breakdown of junctional complexes between cells in the esophagus that are the result of GERD. These results also suggest that transfer the NKA β1 subunit to the esophagus after injury can reverseUR 6-23001 / FR Ref.: 161118.04201 barrier disruption. Accordingly, expression NKA β1 represents a treatment for refractory GERD and can prevent progression to cancer. References 1. Katz, P.O., L.B. Gerson, and M.F. Vela. (2013) Guidelines for the diagnosis and management of gastroesophageal reflux disease. Am J Gastroenterol 108: 308‐28; quiz 329. 2. De Giorgi, F., M. Palmiero, I. Esposito, F. Mosca, and R. Cuomo. (2006) Pathophysiology of gastro‐oesophageal reflux disease. Acta Otorhinolaryngol Ital 26: 241‐6. 3. Galmiche, J.P. and S. Bruley des Varannes. (1994) Symptoms and disease severity in gastro‐oesophageal reflux disease. Scand J Gastroenterol Suppl 201: 62‐8. 4. Flegal, K.M., M.D. Carroll, B.K. Kit, and C.L. Ogden. (2012) Prevalence of obesity and trends in the distribution of body mass index among US adults, 1999‐2010. JAMA 307: 491‐7. 5. Doulami, G., S. Triantafyllou, M. Natoudi, K. Albanopoulos, E. Leandros, G. Zografos, and D. Theodorou. (2015) GERD‐Related Questionnaires and Obese Population: Can They Really Reflect the Severity of the Disease and the Impact of GERD on Quality of Patients' Life? Obes Surg 25: 1882‐5. 6. Whiteman, D.C., S. Sadeghi, N. Pandeya, B.M. Smithers, D.C. Gotley, C.J. Bain, P.M. Webb, A.C. Green, and S. Australian Cancer. (2008) Combined effects of obesity, acid reflux and smoking on the risk of adenocarcinomas of the oesophagus. Gut 57: 173‐80. 7. Hvid‐Jensen, F., L. Pedersen, A.M. Drewes, H.T. Sorensen, and P. Funch‐Jensen. (2011) Incidence of adenocarcinoma among patients with Barrett's esophagus. N Engl J Med 365: 1375‐83. 8. Bhat, S., H.G. Coleman, F. Yousef, B.T. Johnston, D.T. McManus, A.T. Gavin, and L.J. Murray. (2011) Risk of malignant progression in Barrett's esophagus patients: results from a large population‐based study. J Natl Cancer Inst 103: 1049‐57. 9. Jung, K.W., N.J. Talley, Y. Romero, D.A. Katzka, C.D. Schleck, A.R. Zinsmeister, K.T. Dunagan, L.S. Lutzke, T.T. Wu, K.K. Wang, M. Frederickson, D.M. Geno, G.R. Locke, and G.A. Prasad. (2011) Epidemiology and natural history of intestinal metaplasia of the gastroesophageal junction and Barrett's esophagus: a population‐based study. Am J Gastroenterol 106: 1447‐55. 10. El‐Serag, H.B., S. Sweet, C.C. Winchester, and J. Dent. (2014) Update on the epidemiology of gastro‐oesophageal reflux disease: a systematic review. Gut 63: 871‐80. 11. Horn, J. (2000) The proton‐pump inhibitors: similarities and differences. Clin Ther 22: 266‐80. 12. Pohl, H., B. Sirovich, and H.G. Welch. (2010) Esophageal adenocarcinoma incidence: are we reaching the peak? Cancer Epidemiol Biomarkers Prev 19: 1468‐70. 13. Lozano, R. (2016) Adverse Effects of Proton Pump Inhibitors in Chronic Kidney Disease. JAMA Intern Med 176: 866‐7. 14. Shah, N.H., P. LePendu, A. Bauer‐Mehren, Y.T. Ghebremariam, S.V. Iyer, J. Marcus, K.T. Nead, J.P. Cooke, and N.J. Leeper. (2015) Proton Pump Inhibitor Usage and the Risk of Myocardial Infarction in the General Population. PLoS One 10: e0124653. 15. Orlando, L.A. and R.C. Orlando. (2009) Dilated intercellular spaces as a marker of GERD. Curr Gastroenterol Rep 11: 190‐4. 16. Farre, R., K. Blondeau, D. Clement, M. Vicario, L. Cardozo, M. Vieth, V. Mertens, A. Pauwels, J. Silny, M. Jimenez, J. Tack, and D. Sifrim. (2011) Evaluation of oesophageal mucosa integrity by the intraluminal impedance technique. Gut 60: 885‐92.UR 6-23001 / FR Ref.: 161118.04201 17. Farre, R., H. van Malenstein, R. De Vos, K. Geboes, I. Depoortere, P. Vanden Berghe, F. Fornari, K. Blondeau, V. Mertens, J. Tack, and D. Sifrim. (2008) Short exposure of oesophageal mucosa to bile acids, both in acidic and weakly acidic conditions, can impair mucosal integrity and provoke dilated intercellular spaces. Gut 57: 1366‐74. 18. Bjorkman, E.V., A. Edebo, M. Oltean, and A. Casselbrant. (2013) Esophageal barrier function and tight junction expression in healthy subjects and patients with gastroesophageal reflux disease: functionality of esophageal mucosa exposed to bile salt and trypsin in vitro. Scand J Gastroenterol 48: 1118‐26. 19. Gyorffy, H., A. Holczbauer, P. Nagy, Z. Szabo, P. Kupcsulik, C. Paska, J. Papp, Z. Schaff, and A. Kiss. (2005) Claudin expression in Barrett's esophagus and adenocarcinoma. Virchows Arch 447: 961‐8. 20. Abu‐Farsakh, S., T. Wu, A. Lalonde, J. Sun, and Z. Zhou. (2017) High expression of the leaky protein claudin‐2 in esophageal carcinoma and precancerous lesions is significantly associated with the bile salt receptors VDR and TGR5. BMC Gastroenterology: in press 21. Jiang, M., H. Li, Y. Zhang, Y. Yang, R. Lu, K. Liu, S. Lin, X. Lan, H. Wang, H. Wu, J. Zhu, Z. Zhou, J. Xu, D.K. Lee, L. Zhang, Y.C. Lee, J. Yuan, J.A. Abrams, T.C. Wang, A.R. Sepulveda, Q. Wu, H. Chen, X. Sun, J. She, X. Chen, and J. Que. (2017) Transitional basal cells at the squamous‐columnar junction generate Barrett's oesophagus. Nature. 22. Souza, R.F. (2016) From Reflux Esophagitis to Esophageal Adenocarcinoma. Dig Dis 34: 483‐90. 23. Orlando, R.C. (2010) The integrity of the esophageal mucosa. Balance between offensive and defensive mechanisms. Best Pract Res Clin Gastroenterol 24: 873‐82. 24. Lin, X., M. Barravecchia, P. Kothari, J.L. Young, and D.A. Dean. (2016) beta1‐Na(+),K(+)‐ATPase gene therapy upregulates tight junctions to rescue lipopolysaccharide‐induced acute lung injury. Gene Ther 23: 489‐99. 25. Dean, D.A., D. Machado‐Aranda, K. Blair‐Parks, A.V. Yeldandi, and J.L. Young. (2003) Electroporation as a method for high‐level non‐viral gene transfer to the lung. Gene Ther 10: 1608‐1615. 26. Machado‐Aranda, D., Y. Adir, J.L. Young, A. Briva, G.R.S. Budinger, A. Yeldandi, J.I. Sznajder, and D.A. Dean. (2005) Gene transfer of the Na+,K+‐ATPase b1 subunit using electroporation increases lung liquid clearance in rats. Am J Respir Crit Care Med 171: 204‐211. 27. Mutlu, G.M., D. Machado‐Aranda, J.E. Norton, A. Bellmeyer, D. Urich, R. Zhou, and D.A. Dean. (2007) Electroporation‐mediated gene transfer of the Na+,K+‐ATPase rescues endotoxin‐induced lung injury. Am J Respir Crit Care Med 176: 582‐590. 28. Lin, X. and D.A. Dean. (2011) Gene therapy for ALI / ARDS. Crit Care Clin 27: 705‐18. 29. Emr, B.M., S. Roy, M. Kollisch‐Singule, L.A. Gatto, M. Barravecchia, X. Lin, J.L. Young, G. Wang, J. Liu, J. Satalin, K. Snyder, G.F. Nieman, and D.A. Dean. (2015) Electroporation‐mediated gene delivery of Na+,K+ ‐ATPase, and ENaC subunits to the lung attenuates acute respiratory distress syndrome in a two‐hit porcine model. Shock 43: 16‐23. The foregoing examples and description of the preferred embodiments should be taken as illustrating, rather than as limiting the present disclosure as defined by the claims. As will be readily appreciated, numerous variations and combinations of the features set forth above can be utilized without departing from the present disclosure as set forth in the claims.UR 6-23001 / FR Ref.: 161118.04201 Such variations are not regarded as a departure from the scope of the disclosure, and all such variations are intended to be included within the scope of the following claims. All references cited herein are incorporated by reference in their entireties.
Claims
UR 6-23001 / FR Ref.: 161118.04201 CLAIMS WHAT IS CLAIMED IS:
1. A method of treating a gastroesophageal reflux disease (GERD) in a subject in need thereof, comprising expressing a Na+, K+-ATPase (NKA) β1 subunit or a myotonic dystrophy kinase-related Cdc42-binding kinases α (MRCKα) or both in one or more cells in the esophagus of the subject.
2. A method of reducing the risk of developing esophageal cancer in a subject in need thereof, comprising expressing a NKAβ1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject.
3. A method of increasing expression of a tight junction protein in the esophagus of a subject in need thereof, comprising expressing a NKAβ1 subunit or a MRCKα or both in one or more cells in the esophagus of the subject.
4. The method of any of the preceding claims, wherein said expressing step comprises administering to the subject a genetic construct comprising a nucleic acid sequence encoding the NKAβ1 subunit or the MRCKα or both.
5. The method of claim 4, wherein the genetic construct further comprises a regulatory sequence that is operatively linked to the nucleic acid sequence.
6. The method of claim 5, wherein the regulatory sequence comprises a promoter or an enhancer.
7. The method of claim 6, wherein the promoter is one selected from the group consisting of a CMV promoter, a ubiquitin (Ubc) promoter, a CAG promoter, an EF1a promoter, a SV40 early promoter, and a PGK promoter.
8. The method of claim 6, wherein the promoter is an inducible promoter.
9. The method of claim 8, wherein the inducible promoter is a tetracycline (doxycycline)-controlled inducible protomer or a tamoxifen-inducible promoter.UR 6-23001 / FR Ref.: 161118.04201 10. The method of claim 6, wherein the promoter or enhancer is selective or specific for an esophagus cell.
11. The method of any one of claims 4-10, wherein the genetic construct is administered by electroporation or in a liposome.
12. The method of any one of claims 4-10, wherein the genetic construct is administered in an expression vector.
13. The method of claim 12, wherein the expression vector is a viral vector, plasmid vector, or bacterial vector.
14. The method of claim 13, wherein the viral vector is selected from the group consisting of a lentiviral vector, an adenoviral vector, an adeno-associated viral vector, and a vaccinia vector.
15. The method of any one of the preceding claims, wherein the subject is mammal.
16. The method of claim 15, wherein the subject is human.